-
Notifications
You must be signed in to change notification settings - Fork 35
Commit
This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository.
Revert "ESM2 Finetuning refactor (#574)"
This reverts commit 81e0b24.
- Loading branch information
Showing
20 changed files
with
951 additions
and
2,493 deletions.
There are no files selected for viewing
898 changes: 0 additions & 898 deletions
898
docs/docs/user-guide/examples/bionemo-esm2/finetune.ipynb
This file was deleted.
Oops, something went wrong.
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,263 @@ | ||
# ESM-2 Fine-Tuning | ||
|
||
This readme serves as a demo for implementing ESM-2 Fine-tuning module, running a regression example and using the model for inference. | ||
|
||
The ESM-2 model is a transformer-based protein language model that has achieved state-of-the-art results in various protein-related tasks. When fine-tuning ESM2, the task head plays a crucial role. A task head refers to the additional layer or set of layers added on top of a pre-trained model, like the ESM-2 transformer-based protein language model, to adapt it for a specific downstream task. As a part of transfer learning, a pre-trained model is often utilized to learn generic features from a large-scale dataset. However, these features might not be directly applicable to the specific task at hand. By incorporating a task head, which consists of learnable parameters, the model can adapt and specialize to the target task. The task head serves as a flexible and adaptable component that learns task-specific representations by leveraging the pre-trained features as a foundation. Through fine-tuning, the task head enables the model to learn and extract task-specific patterns, improving performance and addressing the nuances of the downstream task. It acts as a critical bridge between the pre-trained model and the specific task, enabling efficient and effective transfer of knowledge. | ||
|
||
|
||
# Setup and Assumptions | ||
|
||
In this tutorial, we will demonstrate how to create a fine-tune module, train a regression task head, and use the fine-tuned model for inference. | ||
|
||
All commands should be executed inside the BioNeMo docker container, which has all ESM-2 dependencies pre-installed. This tutorial assumes that a copy of the BioNeMo framework repo exists on workstation or server and has been mounted inside the container at `/workspace/bionemo2`. (**Note**: This `WORKDIR` may be `/workspaces/bionemo-framework` if you are using the VSCode Dev Container.) For more information on how to build or pull the BioNeMo2 container, refer to the [Access and Startup](../../getting-started/access-startup.md). | ||
|
||
To successfully accomplish this we need to define some key classes: | ||
|
||
1. Loss Reduction Method - To compute the supervised fine-tuning loss. | ||
2. Fine-Tuned Model Head - Downstream task head model. | ||
3. Fine-Tuned Model - Model that combines ESM-2 with the task head model. | ||
4. Fine-Tuning Config - Configures the fine-tuning model and loss to use in the training and inference framework. | ||
5. Dataset - Training and inference datasets for ESM2. | ||
|
||
## 1 - Loss Reduction Class | ||
|
||
A class for calculating the supervised loss of the fine-tune model from targets. We inherit from Megatron Bert Masked Language Model Loss (`BERTMLMLossWithReduction`) and override the `forward()` pass to compute MSE loss of the regression head within a micro-batch. The `reduce()` method is used for computing the average over the micro-batches and is only used for logging. | ||
|
||
```python | ||
class RegressorLossReduction(BERTMLMLossWithReduction): | ||
def forward( | ||
self, batch: Dict[str, torch.Tensor], forward_out: Dict[str, torch.Tensor] | ||
) -> Tuple[torch.Tensor, Union[PerTokenLossDict, SameSizeLossDict]]: | ||
|
||
targets = batch["labels"] # [b, 1] | ||
regression_output = forward_out | ||
loss = torch.nn.functional.mse_loss(regression_output, targets) | ||
return loss, {"avg": loss} | ||
|
||
def reduce(self, losses_reduced_per_micro_batch: Sequence[ReductionT]) -> torch.Tensor: | ||
losses = torch.stack([loss["avg"] for loss in losses_reduced_per_micro_batch]) | ||
return losses.mean() | ||
``` | ||
|
||
## 2 - Fine-Tuned Model Head | ||
|
||
An MLP class for sequence-level regression. This class inherits `MegatronModule` and uses the fine-tune config (`TransformerConfig`) to configure the regression head for the fine-tuned ESM-2 model. | ||
|
||
```python | ||
class MegatronMLPHead(MegatronModule): | ||
def __init__(self, config: TransformerConfig): | ||
super().__init__(config) | ||
layer_sizes = [config.hidden_size, 256, 1] | ||
self.linear_layers = torch.nn.ModuleList( | ||
[torch.nn.Linear(i, o) for i, o in zip(layer_sizes[:-1], layer_sizes[1:])] | ||
) | ||
self.act = torch.nn.ReLU() | ||
self.dropout = torch.nn.Dropout(p=config.ft_dropout) | ||
|
||
def forward(self, hidden_states: torch.Tensor) -> List[torch.Tensor]: | ||
... | ||
``` | ||
|
||
## 3 - Fine-Tuned Model | ||
|
||
A fine-tuned ESM-2 model class for token classification tasks. This class inherits from the `ESM2Model` class and adds the custom regression head `MegatronMLPHead` the we created in the previous step. Optionally one can freeze all or parts of the encoder by parsing through the model parameters in the model constructor. | ||
|
||
```python | ||
class ESM2FineTuneSeqModel(ESM2Model): | ||
def __init__(self, config, *args, post_process: bool = True, return_embeddings: bool = False, **kwargs): | ||
super().__init__(config, *args, post_process=post_process, return_embeddings=True, **kwargs) | ||
|
||
# freeze encoder parameters | ||
if config.encoder_frozen: | ||
for _, param in self.named_parameters(): | ||
param.requires_grad = False | ||
|
||
if post_process: | ||
self.regression_head = MegatronMLPHead(config) | ||
|
||
def forward(self, *args, **kwargs,): | ||
output = super().forward(*args, **kwargs) | ||
... | ||
regression_output = self.regression_head(embeddings) | ||
return regression_output | ||
``` | ||
|
||
## 4 - Fine-Tuning Config | ||
|
||
A `dataclass` that configures the fine-tuned ESM-2 model. In this example `ESM2FineTuneSeqConfig` inherits from `ESM2GenericConfig` and adds custom arguments to setup the fine-tuned model. The `configure_model()` method of this `dataclass` is called within the `Lightning` module to call the model constructor with the `dataclass` arguments. | ||
|
||
The common arguments among different fine-tuning tasks are | ||
|
||
- `model_cls`: The fine-tune model class (`ESM2FineTuneSeqModel`) | ||
- `initial_ckpt_path`: BioNeMo 2.0 ESM-2 pre-trained checkpoint | ||
- `initial_ckpt_skip_keys_with_these_prefixes`: skip keys when loading parameters from a checkpoint. Here we should not look for `regression_head` in the pre-trained checkpoint. | ||
- `get_loss_reduction_class()`: Implements selection of the appropriate `MegatronLossReduction` class, e.g. `bionemo.esm2.model.finetune.finetune_regressor.RegressorLossReduction`. | ||
|
||
```python | ||
|
||
@dataclass | ||
class ESM2FineTuneSeqConfig(ESM2GenericConfig[ESM2FineTuneSeqModel], iom.IOMixinWithGettersSetters): | ||
model_cls: Type[ESM2FineTuneSeqModel] = ESM2FineTuneSeqModel | ||
# The following checkpoint path is for nemo2 checkpoints. Config parameters not present in | ||
# self.override_parent_fields will be loaded from the checkpoint and override those values here. | ||
initial_ckpt_path: str | None = None | ||
# typical case is fine-tune the base biobert that doesn't have this head. If you are instead loading a checkpoint | ||
# that has this new head and want to keep using these weights, please drop this next line or set to [] | ||
initial_ckpt_skip_keys_with_these_prefixes: List[str] = field(default_factory=lambda: ["regression_head"]) | ||
|
||
encoder_frozen: bool = True # freeze encoder parameters | ||
ft_dropout: float = 0.25 # MLP layer dropout | ||
|
||
def get_loss_reduction_class(self) -> Type[MegatronLossReduction]: | ||
return RegressorLossReduction | ||
``` | ||
|
||
## 5 - Dataset | ||
|
||
We will use a sample dataset for demonstration purposes. Create a dataset class by extending from ```torch.utils.data.Dataset```. For the purposes of this demo, we'll assume dataset consists of small set of protein sequences with a target value of `len(sequence) / 100.0` as their labels. | ||
|
||
```python | ||
data = [ | ||
("MVLSPADKTNVKAAWGKVGAHAGEYGAEALERH", 0.33), | ||
... | ||
] | ||
``` | ||
|
||
Therefore, the custom BioNeMo dataset class will be appropriate (found in ```bionemo.esm2.model.finetune.finetune_regressor.InMemorySingleValueDataset```) as it facilitates predicting on a single value. An excerpt from the class is shown below. This example dataset expected a sequence of `Tuple` that hold `(sequence, target)` values. However, one can simply extend ```InMemorySingleValueDataset``` class in a similar way to customize your class for your data. | ||
|
||
```python | ||
class InMemorySingleValueDataset(Dataset): | ||
def __init__( | ||
self, | ||
data: Sequence[Tuple[str, float]], | ||
tokenizer: tokenizer.BioNeMoESMTokenizer = tokenizer.get_tokenizer(), | ||
seed: int = np.random.SeedSequence().entropy, | ||
): | ||
``` | ||
|
||
For any arbitrary data file formats, user can process the data into a list of tuples containing (sequence, label) and use this dataset class. Or override the dataset class to load their custom data files. | ||
|
||
To coordinate the creation of training, validation and testing datasets from your data, we need to use a `datamodule` class. To do this we can directly use or extend the ```ESM2FineTuneDataModule``` class (located at ```bionemo.esm2.model.finetune.datamodule.ESM2FineTuneDataModule```) which defines helpful abstract methods that use your dataset class. | ||
|
||
```python | ||
dataset = InMemorySingleValueDataset(data) | ||
data_module = ESM2FineTuneDataModule( | ||
train_dataset=train_dataset, | ||
valid_dataset=valid_dataset | ||
micro_batch_size=4, # size of a batch to be processed in a device | ||
global_batch_size=8, # size of batch across all devices. Should be multiple of micro_batch_size | ||
) | ||
``` | ||
|
||
# Fine-Tuning the Regressor Task Head for ESM2 | ||
|
||
Now we can put these five requirements together to fine-tune a regressor task head starting from a pre-trained 650M ESM-2 model (`pretrain_ckpt_path`). We can take advantage of a simple training loop in ```bionemo.esm2.model.fnetune.train``` and use the ```train_model()`` function to start the fine-tuning process in the following. | ||
|
||
```python | ||
# create a List[Tuple] with (sequence, target) values | ||
artificial_sequence_data = [ | ||
"TLILGWSDKLGSLLNQLAIANESLGGGTIAVMAERDKEDMELDIGKMEFDFKGTSVI", | ||
"LYSGDHSTQGARFLRDLAENTGRAEYELLSLF", | ||
"GRFNVWLGGNESKIRQVLKAVKEIGVSPTLFAVYEKN", | ||
"DELTALGGLLHDIGKPVQRAGLYSGDHSTQGARFLRDLAENTGRAEYELLSLF", | ||
"KLGSLLNQLAIANESLGGGTIAVMAERDKEDMELDIGKMEFDFKGTSVI", | ||
"LFGAIGNAISAIHGQSAVEELVDAFVGGARISSAFPYSGDTYYLPKP", | ||
"LGGLLHDIGKPVQRAGLYSGDHSTQGARFLRDLAENTGRAEYELLSLF", | ||
"LYSGDHSTQGARFLRDLAENTGRAEYELLSLF", | ||
"ISAIHGQSAVEELVDAFVGGARISSAFPYSGDTYYLPKP", | ||
"SGSKASSDSQDANQCCTSCEDNAPATSYCVECSEPLCETCVEAHQRVKYTKDHTVRSTGPAKT", | ||
] | ||
|
||
data = [(seq, len(seq)/100.0) for seq in artificial_sequence_data] | ||
|
||
# we are training and validating on the same dataset for simplicity | ||
dataset = InMemorySingleValueDataset(data) | ||
data_module = ESM2FineTuneDataModule(train_dataset=dataset, valid_dataset=dataset) | ||
|
||
experiment_name = "finetune_regressor" | ||
n_steps_train = 50 | ||
seed = 42 | ||
|
||
# To download a 650M pre-trained ESM2 model | ||
pretrain_ckpt_path = load("esm2/650m:2.0") | ||
|
||
config = ESM2FineTuneSeqConfig( | ||
initial_ckpt_path=str(pretrain_ckpt_path) | ||
) | ||
|
||
checkpoint, metrics, trainer = train_model( | ||
experiment_name=experiment_name, | ||
experiment_dir=Path(experiment_results_dir), # new checkpoint will land in a subdir of this | ||
config=config, # same config as before since we are just continuing training | ||
data_module=data_module, | ||
n_steps_train=n_steps_train, | ||
) | ||
``` | ||
|
||
This example is fully implemented in ```bionemo.esm2.model.finetune.train``` and can be executed by: | ||
```bash | ||
python -m bionemo.esm2.model.finetune.train | ||
``` | ||
|
||
## Notes | ||
1. The above example is fine-tuning a 650M ESM-2 model. The pre-trained checkpoints can be downloaded from NGC resources using either the following bash command or the `load` function in `bionemo.core.data.load` as shown above. | ||
```bash | ||
download_bionemo_data esm2/650m:2.0 | ||
``` | ||
and pass the output path (e.g. `.../.cache/bionemo/975d29ee980fcb08c97401bbdfdcf8ce-esm2_650M_nemo2.tar.gz.untar`) as an argument into `initial_ckpt_path` while setting the config object: | ||
```python | ||
config = ESM2FineTuneSeqConfig( | ||
initial_ckpt_path=str(pretrain_ckpt_path) | ||
) | ||
``` | ||
2. Due to Megatron limitations, the log produced by the training run iterates on steps/iterations and not epochs. Therefore, `Training epoch` counter stays at value zero while `iteration` and `global_ste`p increase during the course of training (example in the following). | ||
```bash | ||
Training epoch 0, iteration <x/max_steps> | ... | global_step: <x> | reduced_train_loss: ... | val_loss: ... | ||
``` | ||
to achieve the same epoch-based effect while training, please choose the number of training steps (`n_steps_train`) so that: | ||
```bash | ||
n_steps_train * global_batch_size = len(dataset) * desired_num_epochs | ||
``` | ||
3. We are using a small dataset of artificial sequences as our fine-tuning data in this example. You may experience over-fitting and observe no change in the validation metrics. | ||
|
||
# Fine-Tuned ESM-2 Model Inference | ||
Now we can use ```bionemo.esm2.model.finetune.train.infer``` to run inference on an example prediction dataset. | ||
Record the checkpoint path reported at the end of the finetuning run, after executing `python -m bionemo.esm2.model.finetune.train` (e.g. `/tmp/tmp1b5wlnba/finetune_regressor/checkpoints/finetune_regressor--reduced_train_loss=0.0016-epoch=0-last`) and use that as an argument to inference script (`--checkpoint-path`). | ||
|
||
We download a CSV example dataset of articical sequences for this inference example. Please refer to [ESM-2 Inference](./inference) tutorial for detailed explanation of the arguments and how to create your own CSV file. | ||
|
||
```bash | ||
mkdir -p $WORKDIR/esm2_finetune_tutorial | ||
# download sample data CSV for inference | ||
DATA_PATH=$(download_bionemo_data esm2/testdata_esm2_infer:2.0) | ||
RESULTS_PATH=$WORKDIR/esm2_finetune_tutorial/ | ||
infer_esm2 --checkpoint-path <finetune checkpoint path> \ | ||
--data-path $DATA_PATH \ | ||
--results-path $RESULTS_PATH \ | ||
--config-class ESM2FineTuneSeqConfig | ||
``` | ||
|
||
This will create a result `.pt` file under `$WORKDIR/esm2_finetune_tutorial/predictions__rank_0.pt` which can be loaded via PyTorch library in python environment: | ||
|
||
```python | ||
import torch | ||
# Set the path to results file e.g. /workspace/bionemo2/esm2_finetune_tutorial/predictions__rank_0.pt | ||
# results_path = /workspace/bionemo2/esm2_finetune_tutorial/predictions__rank_0.pt | ||
results = torch.load(results_path) | ||
# results is a python dict which includes the following result tensors for this example: | ||
# results['regression_output'] is a tensor with shape: torch.Size([10, 1]) | ||
``` | ||
|
||
## Notes | ||
- ESM2 Inference module takes the `--checkpoint-path` and `--config-class` arguments to create a config object by pointing the path in `initial_ckpt_path`. Since we need to load all the parameters from this checkpoint (and don't skip the head) we reset the `initial_ckpt_skip_keys_with_these_prefixes` in this config. | ||
```python | ||
config = ESM2FineTuneSeqConfig( | ||
initial_ckpt_path = <finetuned checkpoint>, | ||
initial_ckpt_skip_keys_with_these_prefixes: List[str] = field(default_factory=list) | ||
) | ||
``` |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Oops, something went wrong.