diff --git a/master/.buildinfo b/master/.buildinfo index 286ebde1ba..b6a6eb3025 100644 --- a/master/.buildinfo +++ b/master/.buildinfo @@ -1,4 +1,4 @@ # Sphinx build info version 1 # This file hashes the configuration used when building these files. When it is not found, a full rebuild will be done. -config: 3f5e8963910ef7e83692b800aaabffad +config: 6d989d0f0862f3371476475716a48fb7 tags: 645f666f9bcd5a90fca523b33c5a78b7 diff --git a/master/.doctrees/api/wildboar/distance/_neighbors/index.doctree b/master/.doctrees/api/wildboar/distance/_neighbors/index.doctree index f6005155f3..68d097450f 100644 Binary files a/master/.doctrees/api/wildboar/distance/_neighbors/index.doctree and b/master/.doctrees/api/wildboar/distance/_neighbors/index.doctree differ diff --git a/master/.doctrees/api/wildboar/distance/index.doctree b/master/.doctrees/api/wildboar/distance/index.doctree index 22821be383..854c63dd1d 100644 Binary files a/master/.doctrees/api/wildboar/distance/index.doctree and b/master/.doctrees/api/wildboar/distance/index.doctree differ diff --git a/master/.doctrees/api/wildboar/explain/counterfactual/_helper/index.doctree b/master/.doctrees/api/wildboar/explain/counterfactual/_helper/index.doctree index 6b07eb9801..4fcdcf707e 100644 Binary files a/master/.doctrees/api/wildboar/explain/counterfactual/_helper/index.doctree and b/master/.doctrees/api/wildboar/explain/counterfactual/_helper/index.doctree differ diff --git a/master/.doctrees/api/wildboar/explain/counterfactual/_nn/index.doctree b/master/.doctrees/api/wildboar/explain/counterfactual/_nn/index.doctree index ded66962f2..68560ef9fa 100644 Binary files a/master/.doctrees/api/wildboar/explain/counterfactual/_nn/index.doctree and b/master/.doctrees/api/wildboar/explain/counterfactual/_nn/index.doctree differ diff --git a/master/.doctrees/api/wildboar/explain/counterfactual/index.doctree b/master/.doctrees/api/wildboar/explain/counterfactual/index.doctree index 27aabfed71..a25019813b 100644 Binary files a/master/.doctrees/api/wildboar/explain/counterfactual/index.doctree and b/master/.doctrees/api/wildboar/explain/counterfactual/index.doctree differ diff --git a/master/.doctrees/environment.pickle b/master/.doctrees/environment.pickle index 912515b33d..bda627372a 100644 Binary files a/master/.doctrees/environment.pickle and b/master/.doctrees/environment.pickle differ diff --git a/master/.doctrees/more/whatsnew.doctree b/master/.doctrees/more/whatsnew.doctree index 2643ef105e..55659e8e51 100644 Binary files a/master/.doctrees/more/whatsnew.doctree and b/master/.doctrees/more/whatsnew.doctree differ diff --git a/master/.doctrees/nbsphinx/examples/hydra.ipynb b/master/.doctrees/nbsphinx/examples/hydra.ipynb index d2c624529a..199b5c7762 100644 --- a/master/.doctrees/nbsphinx/examples/hydra.ipynb +++ b/master/.doctrees/nbsphinx/examples/hydra.ipynb @@ -16,10 +16,10 @@ "id": "d8d8a2e4-bcdf-481f-8c12-6fb7415819ce", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:52:54.998117Z", - "iopub.status.busy": "2023-10-12T13:52:54.997691Z", - "iopub.status.idle": "2023-10-12T13:52:55.909393Z", - "shell.execute_reply": "2023-10-12T13:52:55.908483Z" + "iopub.execute_input": "2023-10-13T12:02:07.885551Z", + "iopub.status.busy": "2023-10-13T12:02:07.885055Z", + "iopub.status.idle": "2023-10-13T12:02:08.783352Z", + "shell.execute_reply": "2023-10-13T12:02:08.782415Z" } }, "outputs": [], @@ -50,10 +50,10 @@ "id": "8c35185f-81cf-494d-9266-2752ac608b99", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:52:55.914193Z", - "iopub.status.busy": "2023-10-12T13:52:55.913412Z", - "iopub.status.idle": "2023-10-12T13:52:56.314882Z", - "shell.execute_reply": "2023-10-12T13:52:56.314059Z" + "iopub.execute_input": "2023-10-13T12:02:08.787683Z", + "iopub.status.busy": "2023-10-13T12:02:08.786930Z", + "iopub.status.idle": "2023-10-13T12:02:09.185767Z", + "shell.execute_reply": "2023-10-13T12:02:09.184756Z" } }, "outputs": [], @@ -77,10 +77,10 @@ "id": "3c3e0c6f-5947-4ce0-9e7f-bc7a77441af7", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:52:56.319236Z", - "iopub.status.busy": "2023-10-12T13:52:56.318951Z", - "iopub.status.idle": "2023-10-12T13:52:56.324207Z", - "shell.execute_reply": "2023-10-12T13:52:56.323517Z" + "iopub.execute_input": "2023-10-13T12:02:09.191137Z", + "iopub.status.busy": "2023-10-13T12:02:09.190604Z", + "iopub.status.idle": "2023-10-13T12:02:09.195893Z", + "shell.execute_reply": "2023-10-13T12:02:09.195212Z" } }, "outputs": [], @@ -98,10 +98,10 @@ "id": "33c34c1d-160f-457f-9452-bb134de35722", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:52:56.328227Z", - "iopub.status.busy": "2023-10-12T13:52:56.327510Z", - "iopub.status.idle": "2023-10-12T13:53:03.045014Z", - "shell.execute_reply": "2023-10-12T13:53:03.044267Z" + "iopub.execute_input": "2023-10-13T12:02:09.199371Z", + "iopub.status.busy": "2023-10-13T12:02:09.198869Z", + "iopub.status.idle": "2023-10-13T12:02:15.787594Z", + "shell.execute_reply": "2023-10-13T12:02:15.786857Z" } }, "outputs": [ @@ -135,10 +135,10 @@ "id": "9c47dde0-0e6b-4369-b9b2-fbb57badba4a", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:53:03.048452Z", - "iopub.status.busy": "2023-10-12T13:53:03.048090Z", - "iopub.status.idle": "2023-10-12T13:53:05.172312Z", - "shell.execute_reply": "2023-10-12T13:53:05.171539Z" + "iopub.execute_input": "2023-10-13T12:02:15.791367Z", + "iopub.status.busy": "2023-10-13T12:02:15.791080Z", + "iopub.status.idle": "2023-10-13T12:02:17.843891Z", + "shell.execute_reply": "2023-10-13T12:02:17.843100Z" } }, "outputs": [ @@ -172,10 +172,10 @@ "id": "73ec6717-9347-49ef-b14c-b3cb61e75d0c", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:53:05.177868Z", - "iopub.status.busy": "2023-10-12T13:53:05.176317Z", - "iopub.status.idle": "2023-10-12T13:53:05.182151Z", - "shell.execute_reply": "2023-10-12T13:53:05.181515Z" + "iopub.execute_input": "2023-10-13T12:02:17.848387Z", + "iopub.status.busy": "2023-10-13T12:02:17.848068Z", + "iopub.status.idle": "2023-10-13T12:02:17.853101Z", + "shell.execute_reply": "2023-10-13T12:02:17.852384Z" } }, "outputs": [], @@ -193,10 +193,10 @@ "id": "6bec831d-6c7e-4e4f-b52f-7f1ebdfe77f1", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:53:05.187044Z", - "iopub.status.busy": "2023-10-12T13:53:05.185578Z", - "iopub.status.idle": "2023-10-12T13:53:11.784158Z", - "shell.execute_reply": "2023-10-12T13:53:11.783457Z" + "iopub.execute_input": "2023-10-13T12:02:17.856791Z", + "iopub.status.busy": "2023-10-13T12:02:17.856501Z", + "iopub.status.idle": "2023-10-13T12:02:24.393271Z", + "shell.execute_reply": "2023-10-13T12:02:24.392601Z" } }, "outputs": [ @@ -233,10 +233,10 @@ "id": "9663b475-c2c5-46f4-b9f4-5b8d74c64cf7", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:53:11.789534Z", - "iopub.status.busy": "2023-10-12T13:53:11.787897Z", - "iopub.status.idle": "2023-10-12T13:53:13.993528Z", - "shell.execute_reply": "2023-10-12T13:53:13.992599Z" + "iopub.execute_input": "2023-10-13T12:02:24.398450Z", + "iopub.status.busy": "2023-10-13T12:02:24.397115Z", + "iopub.status.idle": "2023-10-13T12:02:26.570663Z", + "shell.execute_reply": "2023-10-13T12:02:26.569992Z" } }, "outputs": [ @@ -271,10 +271,10 @@ "id": "bf7e66b7-db44-4c5d-83f8-e5ba2d5130ce", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:53:13.998509Z", - "iopub.status.busy": "2023-10-12T13:53:13.997785Z", - "iopub.status.idle": "2023-10-12T13:53:14.004676Z", - "shell.execute_reply": "2023-10-12T13:53:14.003922Z" + "iopub.execute_input": "2023-10-13T12:02:26.575668Z", + "iopub.status.busy": "2023-10-13T12:02:26.574412Z", + "iopub.status.idle": "2023-10-13T12:02:26.580513Z", + "shell.execute_reply": "2023-10-13T12:02:26.579848Z" } }, "outputs": [], @@ -298,10 +298,10 @@ "id": "65cb1269-974d-40b7-9e21-d123d020f4f4", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:53:14.010678Z", - "iopub.status.busy": "2023-10-12T13:53:14.008656Z", - "iopub.status.idle": "2023-10-12T13:53:20.599846Z", - "shell.execute_reply": "2023-10-12T13:53:20.599139Z" + "iopub.execute_input": "2023-10-13T12:02:26.585377Z", + "iopub.status.busy": "2023-10-13T12:02:26.584069Z", + "iopub.status.idle": "2023-10-13T12:02:33.024622Z", + "shell.execute_reply": "2023-10-13T12:02:33.023914Z" } }, "outputs": [ @@ -377,10 +377,10 @@ "id": "cb2efdc8-7306-41c0-8403-c191ecc4363e", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:53:20.605059Z", - "iopub.status.busy": "2023-10-12T13:53:20.603726Z", - "iopub.status.idle": "2023-10-12T13:53:22.723882Z", - "shell.execute_reply": "2023-10-12T13:53:22.723179Z" + "iopub.execute_input": "2023-10-13T12:02:33.029813Z", + "iopub.status.busy": "2023-10-13T12:02:33.028507Z", + "iopub.status.idle": "2023-10-13T12:02:35.121885Z", + "shell.execute_reply": "2023-10-13T12:02:35.120904Z" } }, "outputs": [ @@ -415,10 +415,10 @@ "id": "8ffa6d11-0c73-4b26-a2d7-f91b596b2517", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:53:22.729149Z", - "iopub.status.busy": "2023-10-12T13:53:22.727816Z", - "iopub.status.idle": "2023-10-12T13:53:22.733938Z", - "shell.execute_reply": "2023-10-12T13:53:22.733314Z" + "iopub.execute_input": "2023-10-13T12:02:35.127015Z", + "iopub.status.busy": "2023-10-13T12:02:35.125426Z", + "iopub.status.idle": "2023-10-13T12:02:35.131868Z", + "shell.execute_reply": "2023-10-13T12:02:35.131272Z" } }, "outputs": [], @@ -442,10 +442,10 @@ "id": "c2f9e62b-35cb-4cd7-b671-7fab6569b6e0", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:53:22.738793Z", - "iopub.status.busy": "2023-10-12T13:53:22.737510Z", - "iopub.status.idle": "2023-10-12T13:53:29.687365Z", - "shell.execute_reply": "2023-10-12T13:53:29.686675Z" + "iopub.execute_input": "2023-10-13T12:02:35.135784Z", + "iopub.status.busy": "2023-10-13T12:02:35.135323Z", + "iopub.status.idle": "2023-10-13T12:02:41.885374Z", + "shell.execute_reply": "2023-10-13T12:02:41.884668Z" } }, "outputs": [ @@ -521,10 +521,10 @@ "id": "56cf82c3-8097-49a9-9030-d63d7e467d4a", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:53:29.690882Z", - "iopub.status.busy": "2023-10-12T13:53:29.690442Z", - "iopub.status.idle": "2023-10-12T13:53:31.923348Z", - "shell.execute_reply": "2023-10-12T13:53:31.922512Z" + "iopub.execute_input": "2023-10-13T12:02:41.890630Z", + "iopub.status.busy": "2023-10-13T12:02:41.889321Z", + "iopub.status.idle": "2023-10-13T12:02:44.088456Z", + "shell.execute_reply": "2023-10-13T12:02:44.087719Z" } }, "outputs": [ diff --git a/master/_images/emmott-dark.svg b/master/_images/emmott-dark.svg index ea9338ece7..aa2bc418d0 100644 --- a/master/_images/emmott-dark.svg +++ b/master/_images/emmott-dark.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:52:13.196816 + 2023-10-13T12:01:26.515121 image/svg+xml @@ -41,1597 +41,1597 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - + @@ -1678,7 +1678,7 @@ z - + @@ -1708,7 +1708,7 @@ z - + @@ -1744,7 +1744,7 @@ z - + @@ -1757,7 +1757,7 @@ z - + @@ -1770,7 +1770,7 @@ z - + @@ -1819,12 +1819,12 @@ z - - + @@ -1838,7 +1838,7 @@ L -3.5 0 - + @@ -1851,7 +1851,7 @@ L -3.5 0 - + @@ -2093,7 +2093,7 @@ L 90.49513 239.96 L 90.49513 235.721404 L 44.788636 235.721404 z -" clip-path="url(#p3862e7bcbe)" style="fill: #b301b3"/> +" clip-path="url(#pc9d9875cbf)" style="fill: #b301b3"/> +" clip-path="url(#pc9d9875cbf)" style="fill: #e8e467"/> - + @@ -2121,7 +2121,7 @@ z - + @@ -2134,7 +2134,7 @@ z - + @@ -2149,7 +2149,7 @@ z - + @@ -2162,7 +2162,7 @@ z - + @@ -2177,7 +2177,7 @@ z - + @@ -2213,7 +2213,7 @@ z - + @@ -2533,7 +2533,7 @@ L 418.428819 193.90719 L 419.814409 206.589568 L 421.2 202.095266 L 421.2 202.095266 -" clip-path="url(#pd08e4e93cc)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p740b2f7f0c)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p740b2f7f0c)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p740b2f7f0c)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p740b2f7f0c)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p740b2f7f0c)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p740b2f7f0c)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p740b2f7f0c)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p740b2f7f0c)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p740b2f7f0c)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p740b2f7f0c)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> - + @@ -3705,7 +3705,7 @@ L 421.2 201.383567 - + @@ -3746,7 +3746,7 @@ z - + @@ -3763,7 +3763,7 @@ z - + @@ -3777,7 +3777,7 @@ z - + @@ -3790,7 +3790,7 @@ z - + @@ -3803,7 +3803,7 @@ z - + @@ -3986,13 +3986,13 @@ L 394.229687 183.176563 - + - + - + diff --git a/master/_images/emmott-hard-dark.svg b/master/_images/emmott-hard-dark.svg index ffa31564bd..e352fd6aa5 100644 --- a/master/_images/emmott-hard-dark.svg +++ b/master/_images/emmott-hard-dark.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:52:14.887305 + 2023-10-13T12:01:28.265872 image/svg+xml @@ -41,1597 +41,1597 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - + @@ -1678,7 +1678,7 @@ z - + @@ -1708,7 +1708,7 @@ z - + @@ -1744,7 +1744,7 @@ z - + @@ -1757,7 +1757,7 @@ z - + @@ -1770,7 +1770,7 @@ z - + @@ -1819,12 +1819,12 @@ z - - + @@ -1838,7 +1838,7 @@ L -3.5 0 - + @@ -1851,7 +1851,7 @@ L -3.5 0 - + @@ -2093,7 +2093,7 @@ L 90.49513 239.96 L 90.49513 235.721404 L 44.788636 235.721404 z -" clip-path="url(#p5c0875b39f)" style="fill: #b301b3"/> +" clip-path="url(#pfe31fa993f)" style="fill: #b301b3"/> +" clip-path="url(#pfe31fa993f)" style="fill: #e8e467"/> - + @@ -2121,7 +2121,7 @@ z - + @@ -2134,7 +2134,7 @@ z - + @@ -2149,7 +2149,7 @@ z - + @@ -2162,7 +2162,7 @@ z - + @@ -2177,7 +2177,7 @@ z - + @@ -2213,7 +2213,7 @@ z - + @@ -2533,7 +2533,7 @@ L 418.428819 193.90719 L 419.814409 206.589568 L 421.2 202.095266 L 421.2 202.095266 -" clip-path="url(#p34837d6274)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p16e2f6f7cf)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p16e2f6f7cf)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p16e2f6f7cf)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p16e2f6f7cf)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p16e2f6f7cf)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p16e2f6f7cf)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p16e2f6f7cf)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p16e2f6f7cf)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p16e2f6f7cf)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p16e2f6f7cf)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> - + @@ -3705,7 +3705,7 @@ L 421.2 201.383567 - + @@ -3746,7 +3746,7 @@ z - + @@ -3763,7 +3763,7 @@ z - + @@ -3777,7 +3777,7 @@ z - + @@ -3790,7 +3790,7 @@ z - + @@ -3803,7 +3803,7 @@ z - + @@ -3986,13 +3986,13 @@ L 394.229687 183.176563 - + - + - + diff --git a/master/_images/emmott-hard-light.svg b/master/_images/emmott-hard-light.svg index 4ea9c553f8..4739c9a5db 100644 --- a/master/_images/emmott-hard-light.svg +++ b/master/_images/emmott-hard-light.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:52:14.539496 + 2023-10-13T12:01:27.922195 image/svg+xml @@ -41,1597 +41,1597 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - + @@ -1678,7 +1678,7 @@ z - + @@ -1708,7 +1708,7 @@ z - + @@ -1744,7 +1744,7 @@ z - + @@ -1757,7 +1757,7 @@ z - + @@ -1770,7 +1770,7 @@ z - + @@ -1819,12 +1819,12 @@ z - - + @@ -1838,7 +1838,7 @@ L -3.5 0 - + @@ -1851,7 +1851,7 @@ L -3.5 0 - + @@ -2093,7 +2093,7 @@ L 90.49513 239.96 L 90.49513 235.721404 L 44.788636 235.721404 z -" clip-path="url(#p3e170d58d7)" style="fill: #b301b3"/> +" clip-path="url(#p9ca3044348)" style="fill: #b301b3"/> +" clip-path="url(#p9ca3044348)" style="fill: #e8e467"/> - + @@ -2121,7 +2121,7 @@ z - + @@ -2134,7 +2134,7 @@ z - + @@ -2149,7 +2149,7 @@ z - + @@ -2162,7 +2162,7 @@ z - + @@ -2177,7 +2177,7 @@ z - + @@ -2213,7 +2213,7 @@ z - + @@ -2533,7 +2533,7 @@ L 418.428819 193.90719 L 419.814409 206.589568 L 421.2 202.095266 L 421.2 202.095266 -" clip-path="url(#p03818e67a2)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pc3a89a39f4)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pc3a89a39f4)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pc3a89a39f4)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pc3a89a39f4)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pc3a89a39f4)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pc3a89a39f4)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pc3a89a39f4)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pc3a89a39f4)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pc3a89a39f4)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pc3a89a39f4)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> - + @@ -3705,7 +3705,7 @@ L 421.2 201.383567 - + @@ -3746,7 +3746,7 @@ z - + @@ -3763,7 +3763,7 @@ z - + @@ -3777,7 +3777,7 @@ z - + @@ -3790,7 +3790,7 @@ z - + @@ -3803,7 +3803,7 @@ z - + @@ -3986,13 +3986,13 @@ L 394.229687 183.176563 - + - + - + diff --git a/master/_images/emmott-light.svg b/master/_images/emmott-light.svg index 648e4c09da..73f30a519d 100644 --- a/master/_images/emmott-light.svg +++ b/master/_images/emmott-light.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:52:12.855456 + 2023-10-13T12:01:26.179489 image/svg+xml @@ -41,1597 +41,1597 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - + @@ -1678,7 +1678,7 @@ z - + @@ -1708,7 +1708,7 @@ z - + @@ -1744,7 +1744,7 @@ z - + @@ -1757,7 +1757,7 @@ z - + @@ -1770,7 +1770,7 @@ z - + @@ -1819,12 +1819,12 @@ z - - + @@ -1838,7 +1838,7 @@ L -3.5 0 - + @@ -1851,7 +1851,7 @@ L -3.5 0 - + @@ -2093,7 +2093,7 @@ L 90.49513 239.96 L 90.49513 235.721404 L 44.788636 235.721404 z -" clip-path="url(#pcee705529f)" style="fill: #b301b3"/> +" clip-path="url(#p3e63fe5dad)" style="fill: #b301b3"/> +" clip-path="url(#p3e63fe5dad)" style="fill: #e8e467"/> - + @@ -2121,7 +2121,7 @@ z - + @@ -2134,7 +2134,7 @@ z - + @@ -2149,7 +2149,7 @@ z - + @@ -2162,7 +2162,7 @@ z - + @@ -2177,7 +2177,7 @@ z - + @@ -2213,7 +2213,7 @@ z - + @@ -2533,7 +2533,7 @@ L 418.428819 193.90719 L 419.814409 206.589568 L 421.2 202.095266 L 421.2 202.095266 -" clip-path="url(#pc984772247)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pe0941e17c1)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pe0941e17c1)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pe0941e17c1)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pe0941e17c1)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pe0941e17c1)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pe0941e17c1)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pe0941e17c1)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pe0941e17c1)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pe0941e17c1)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pe0941e17c1)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> - + @@ -3705,7 +3705,7 @@ L 421.2 201.383567 - + @@ -3746,7 +3746,7 @@ z - + @@ -3763,7 +3763,7 @@ z - + @@ -3777,7 +3777,7 @@ z - + @@ -3790,7 +3790,7 @@ z - + @@ -3803,7 +3803,7 @@ z - + @@ -3986,13 +3986,13 @@ L 394.229687 183.176563 - + - + - + diff --git a/master/_images/interval-dark.svg b/master/_images/interval-dark.svg index ffc60c71b8..a50f2046d4 100644 --- a/master/_images/interval-dark.svg +++ b/master/_images/interval-dark.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:52:01.822650 + 2023-10-13T12:01:16.444454 image/svg+xml @@ -42,294 +42,294 @@ z +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke-dasharray: 2.5,2.5; stroke-dashoffset: 0; stroke: #808080; stroke-width: 0.5"/> - + - + - + - + - + - + - + - + - + - + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - - - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + - - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + - - - - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + + - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - - - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - - - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + - - - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + - - - - - - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + + + + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#pbd9dc05dec)" style="fill: #b40426; opacity: 0.2; stroke: #b40426; stroke-linejoin: miter"/> +" clip-path="url(#pbd9dc05dec)" style="fill: #b50927; opacity: 0.2; stroke: #b50927; stroke-linejoin: miter"/> +" clip-path="url(#pbd9dc05dec)" style="fill: #ba162b; opacity: 0.2; stroke: #ba162b; stroke-linejoin: miter"/> +" clip-path="url(#pbd9dc05dec)" style="fill: #efcebd; opacity: 0.2; stroke: #efcebd; stroke-linejoin: miter"/> +" clip-path="url(#pbd9dc05dec)" style="fill: #e0dbd8; opacity: 0.2; stroke: #e0dbd8; stroke-linejoin: miter"/> +" clip-path="url(#pbd9dc05dec)" style="fill: #dedcdb; opacity: 0.2; stroke: #dedcdb; stroke-linejoin: miter"/> +" clip-path="url(#pbd9dc05dec)" style="fill: #dddcdc; opacity: 0.2; stroke: #dddcdc; stroke-linejoin: miter"/> +" clip-path="url(#pbd9dc05dec)" style="fill: #dddcdc; opacity: 0.2; stroke: #dddcdc; stroke-linejoin: miter"/> +" clip-path="url(#pbd9dc05dec)" style="fill: #dddcdc; opacity: 0.2; stroke: #dddcdc; stroke-linejoin: miter"/> +" clip-path="url(#pbd9dc05dec)" style="fill: #dddcdc; opacity: 0.2; stroke: #dddcdc; stroke-linejoin: miter"/> +iVBORw0KGgoAAAANSUhEUgAAAa4AAAEKCAYAAABKeLFiAAAEnklEQVR4nO3dwW0DMQwAQZ3B/it0KnF8TAvxy1hgpgL/DmuK0vXzfO4BgIjHt38AAHzChwuAlLmOfwoB6FBcAKTMtfe3fwMA/JviAiDFjAuAFMUFQIoZFwApiguAFDMuAFIUFwApZlwApCguAFLMuABIUVwApMy1iguADsUFQIpThQCkKC4AUpwqBCBFcQGQYsYFQIriAiDFHhcAKYoLgBQfLgBS5joOZwDQobgASJnjcAYAIYoLgBQLyACkKC4AUlyyC0CK4gIgxYwLgBTFBUCKPS4AUhQXAClmXACkKC4AUjwkCUCK4gIgZY4ZFwAhiguAFKcKAUhRXACkuB0egBTFBUCKU4UApCguAFLcnAFAiuICIMWHC4AUhzMASFFcAKTMcTgDgBDFBUCKS3YBSFFcAKSYcQGQorgASDHjAiBFcQGQ4uYMAFIUFwApnjUBIEVxAZAy5zbjAqBDcQGQ4uYMAFIUFwAp9rgASFFcAKTY4wIgRXEBkGLGBUCK4gIgRXEBkKK4AEjx4QIgxXF4AFIUFwApnjUBIEVxAZDiWRMAUhQXACkWkAFIUVwApJhxAZCiuABIsccFQIriAiDFqUIAUhQXAClOFQKQorgASHGqEIAUxQVAihkXACmKC4AUe1wApCguAFLm3GZcAHQoLgBSzLgASFFcAKT4cAGQ4sonAFIUFwAprnwCIEVxAZDiODwAKYoLgBRXPgGQorgASJk14wIgRHEBkGLGBUCK4gIgxR4XACmKC4CUWbfDAxCiuABIcTs8ACmKC4AULyADkKK4AEgx4wIgRXEBkGKPC4AUxQVAitvhAUhRXACk+HABkDLrWRMAQhQXACkOZwCQorgASJljxgVAiOICIGXWjAuAEMUFQIqHJAFIUVwApMx6SBKAEMUFQIoZFwApiguAFHtcAKQoLgBS3FUIQIriAiDFjAuAFMUFQMqsPS4AQhQXAClzzLgACFFcAKT4cAGQMmsBGYAQxQVAigVkAFIUFwApHpIEIEVxAZBixgVAiuICIMUluwCkKC4AUmbXjAuADsUFQIo9LgBSFBcAKfa4AEhRXACkKC4AUhQXACluzgAgRXEBkGLGBUCK4gIgxYwLgBTFBUCKGRcAKYoLgBQfLgBS5nhIEoAQxQVAiuPwAKQoLgBSHIcHIEVxAZBixgVAiuICIMWMC4AUxQVAiuICIEVxAZDiVCEAKYoLgBQzLgBSFBcAKXO/FRcAHYoLgBSnCgFIUVwApDhVCECK4gIgRXEBkKK4AEhRXACkKC4AUny4AEixgAxAiuICIMXhDABSFBcAKZ41ASBFcQGQYsYFQIriAiDFHhcAKYoLgBQzLgBSFBcAKfa4AEhRXACkmHEBkKK4AEixxwVAiuICIGXWqUIAQhQXACn2uABIUVwApNjjAiBFcQGQYsYFQIriAiDFhwuAlNm3K58A6FBcAKQ4Dg9AiuICIMVxeABSFBcAKZ41ASBFcQGQMvev4gKgQ3EBkDL7UlwAdCguAFLMuABIUVwApJhxAZCiuABIMeMCIEVxAZAy+/ICMgAdiguAFDMuAFIUFwAp9rgASFFcAKT8AcwMM/7UKElmAAAAAElFTkSuQmCC" id="imagee363062026" transform="scale(1 -1) translate(0 -191.52)" x="10.8" y="-15.12" width="309.6" height="191.52"/> - - + @@ -469,7 +469,7 @@ z - + @@ -512,7 +512,7 @@ z - + @@ -544,7 +544,7 @@ z - + @@ -560,7 +560,7 @@ z - + @@ -602,7 +602,7 @@ z - + @@ -618,7 +618,7 @@ z - + @@ -767,7 +767,7 @@ L 287.156875 42.536563 - + diff --git a/master/_images/interval-light.svg b/master/_images/interval-light.svg index 4970f2ccd3..30c3f196ce 100644 --- a/master/_images/interval-light.svg +++ b/master/_images/interval-light.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:52:01.338829 + 2023-10-13T12:01:15.958510 image/svg+xml @@ -42,294 +42,294 @@ z +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke-dasharray: 2.5,2.5; stroke-dashoffset: 0; stroke: #808080; stroke-width: 0.5"/> - + - + - + - + - + - + - + - + - + - + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - - - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + - - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + - - - - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + + - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - - - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - - - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + - - - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + - - - - - - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + + + + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#p66216ff1a1)" style="fill: #b40426; opacity: 0.2; stroke: #b40426; stroke-linejoin: miter"/> +" clip-path="url(#p66216ff1a1)" style="fill: #b50927; opacity: 0.2; stroke: #b50927; stroke-linejoin: miter"/> +" clip-path="url(#p66216ff1a1)" style="fill: #ba162b; opacity: 0.2; stroke: #ba162b; stroke-linejoin: miter"/> +" clip-path="url(#p66216ff1a1)" style="fill: #efcebd; opacity: 0.2; stroke: #efcebd; stroke-linejoin: miter"/> +" clip-path="url(#p66216ff1a1)" style="fill: #e0dbd8; opacity: 0.2; stroke: #e0dbd8; stroke-linejoin: miter"/> +" clip-path="url(#p66216ff1a1)" style="fill: #dedcdb; opacity: 0.2; stroke: #dedcdb; stroke-linejoin: miter"/> +" clip-path="url(#p66216ff1a1)" style="fill: #dddcdc; opacity: 0.2; stroke: #dddcdc; stroke-linejoin: miter"/> +" clip-path="url(#p66216ff1a1)" style="fill: #dddcdc; opacity: 0.2; stroke: #dddcdc; stroke-linejoin: miter"/> +" clip-path="url(#p66216ff1a1)" style="fill: #dddcdc; opacity: 0.2; stroke: #dddcdc; stroke-linejoin: miter"/> +" clip-path="url(#p66216ff1a1)" style="fill: #dddcdc; opacity: 0.2; stroke: #dddcdc; stroke-linejoin: miter"/> +iVBORw0KGgoAAAANSUhEUgAAAa4AAAEKCAYAAABKeLFiAAAEnklEQVR4nO3dwW0DMQwAQZ3B/it0KnF8TAvxy1hgpgL/DmuK0vXzfO4BgIjHt38AAHzChwuAlLmOfwoB6FBcAKTMtfe3fwMA/JviAiDFjAuAFMUFQIoZFwApiguAFDMuAFIUFwApZlwApCguAFLMuABIUVwApMy1iguADsUFQIpThQCkKC4AUpwqBCBFcQGQYsYFQIriAiDFHhcAKYoLgBQfLgBS5joOZwDQobgASJnjcAYAIYoLgBQLyACkKC4AUlyyC0CK4gIgxYwLgBTFBUCKPS4AUhQXAClmXACkKC4AUjwkCUCK4gIgZY4ZFwAhiguAFKcKAUhRXACkuB0egBTFBUCKU4UApCguAFLcnAFAiuICIMWHC4AUhzMASFFcAKTMcTgDgBDFBUCKS3YBSFFcAKSYcQGQorgASDHjAiBFcQGQ4uYMAFIUFwApnjUBIEVxAZAy5zbjAqBDcQGQ4uYMAFIUFwAp9rgASFFcAKTY4wIgRXEBkGLGBUCK4gIgRXEBkKK4AEjx4QIgxXF4AFIUFwApnjUBIEVxAZDiWRMAUhQXACkWkAFIUVwApJhxAZCiuABIsccFQIriAiDFqUIAUhQXAClOFQKQorgASHGqEIAUxQVAihkXACmKC4AUe1wApCguAFLm3GZcAHQoLgBSzLgASFFcAKT4cAGQ4sonAFIUFwAprnwCIEVxAZDiODwAKYoLgBRXPgGQorgASJk14wIgRHEBkGLGBUCK4gIgxR4XACmKC4CUWbfDAxCiuABIcTs8ACmKC4AULyADkKK4AEgx4wIgRXEBkGKPC4AUxQVAitvhAUhRXACk+HABkDLrWRMAQhQXACkOZwCQorgASJljxgVAiOICIGXWjAuAEMUFQIqHJAFIUVwApMx6SBKAEMUFQIoZFwApiguAFHtcAKQoLgBS3FUIQIriAiDFjAuAFMUFQMqsPS4AQhQXAClzzLgACFFcAKT4cAGQMmsBGYAQxQVAigVkAFIUFwApHpIEIEVxAZBixgVAiuICIMUluwCkKC4AUmbXjAuADsUFQIo9LgBSFBcAKfa4AEhRXACkKC4AUhQXACluzgAgRXEBkGLGBUCK4gIgxYwLgBTFBUCKGRcAKYoLgBQfLgBS5nhIEoAQxQVAiuPwAKQoLgBSHIcHIEVxAZBixgVAiuICIMWMC4AUxQVAiuICIEVxAZDiVCEAKYoLgBQzLgBSFBcAKXO/FRcAHYoLgBSnCgFIUVwApDhVCECK4gIgRXEBkKK4AEhRXACkKC4AUny4AEixgAxAiuICIMXhDABSFBcAKZ41ASBFcQGQYsYFQIriAiDFHhcAKYoLgBQzLgBSFBcAKfa4AEhRXACkmHEBkKK4AEixxwVAiuICIGXWqUIAQhQXACn2uABIUVwApNjjAiBFcQGQYsYFQIriAiDFhwuAlNm3K58A6FBcAKQ4Dg9AiuICIMVxeABSFBcAKZ41ASBFcQGQMvev4gKgQ3EBkDL7UlwAdCguAFLMuABIUVwApJhxAZCiuABIMeMCIEVxAZAy+/ICMgAdiguAFDMuAFIUFwAp9rgASFFcAKT8AcwMM/7UKElmAAAAAElFTkSuQmCC" id="image6793938482" transform="scale(1 -1) translate(0 -191.52)" x="10.8" y="-15.12" width="309.6" height="191.52"/> - - + @@ -469,7 +469,7 @@ z - + @@ -512,7 +512,7 @@ z - + @@ -544,7 +544,7 @@ z - + @@ -560,7 +560,7 @@ z - + @@ -602,7 +602,7 @@ z - + @@ -618,7 +618,7 @@ z - + @@ -767,7 +767,7 @@ L 287.156875 42.536563 - + diff --git a/master/_images/majority-dark.svg b/master/_images/majority-dark.svg index 8d6801d382..ca3304def7 100644 --- a/master/_images/majority-dark.svg +++ b/master/_images/majority-dark.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:52:09.908580 + 2023-10-13T12:01:23.211557 image/svg+xml @@ -41,1303 +41,1303 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + - - + @@ -1384,7 +1384,7 @@ z - + @@ -1414,7 +1414,7 @@ z - + @@ -1450,7 +1450,7 @@ z - + @@ -1463,7 +1463,7 @@ z - + @@ -1476,7 +1476,7 @@ z - + @@ -1525,12 +1525,12 @@ z - - + @@ -1544,7 +1544,7 @@ L -3.5 0 - + @@ -1557,7 +1557,7 @@ L -3.5 0 - + @@ -1799,7 +1799,7 @@ L 90.49513 239.96 L 90.49513 235.803441 L 44.788636 235.803441 z -" clip-path="url(#pa0db33546c)" style="fill: #b301b3"/> +" clip-path="url(#p1190047142)" style="fill: #b301b3"/> +" clip-path="url(#p1190047142)" style="fill: #e8e467"/> - + @@ -1827,7 +1827,7 @@ z - + @@ -1840,7 +1840,7 @@ z - + @@ -1855,7 +1855,7 @@ z - + @@ -1868,7 +1868,7 @@ z - + @@ -1883,7 +1883,7 @@ z - + @@ -1898,7 +1898,7 @@ z - + @@ -2060,1294 +2060,1294 @@ z " style="fill: none"/> - - - - - - - - - - + + + + + + + + + + - + @@ -3360,7 +3360,7 @@ L 421.2 211.767872 - + @@ -3401,7 +3401,7 @@ z - + @@ -3418,12 +3418,12 @@ z - + - + @@ -3432,12 +3432,12 @@ z - + - + @@ -3445,12 +3445,12 @@ z - + - + @@ -3643,13 +3643,13 @@ L 384.689062 183.176563 - + - + - + diff --git a/master/_images/majority-light.svg b/master/_images/majority-light.svg index 59a6900ad4..54e1005d75 100644 --- a/master/_images/majority-light.svg +++ b/master/_images/majority-light.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:52:09.578075 + 2023-10-13T12:01:22.886420 image/svg+xml @@ -41,1303 +41,1303 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + - - + @@ -1384,7 +1384,7 @@ z - + @@ -1414,7 +1414,7 @@ z - + @@ -1450,7 +1450,7 @@ z - + @@ -1463,7 +1463,7 @@ z - + @@ -1476,7 +1476,7 @@ z - + @@ -1525,12 +1525,12 @@ z - - + @@ -1544,7 +1544,7 @@ L -3.5 0 - + @@ -1557,7 +1557,7 @@ L -3.5 0 - + @@ -1799,7 +1799,7 @@ L 90.49513 239.96 L 90.49513 235.803441 L 44.788636 235.803441 z -" clip-path="url(#p33180634c2)" style="fill: #b301b3"/> +" clip-path="url(#p5d0e3288fb)" style="fill: #b301b3"/> +" clip-path="url(#p5d0e3288fb)" style="fill: #e8e467"/> - + @@ -1827,7 +1827,7 @@ z - + @@ -1840,7 +1840,7 @@ z - + @@ -1855,7 +1855,7 @@ z - + @@ -1868,7 +1868,7 @@ z - + @@ -1883,7 +1883,7 @@ z - + @@ -1898,7 +1898,7 @@ z - + @@ -2060,1294 +2060,1294 @@ z " style="fill: none"/> - - - - - - - - - - + + + + + + + + + + - + @@ -3360,7 +3360,7 @@ L 421.2 211.767872 - + @@ -3401,7 +3401,7 @@ z - + @@ -3418,12 +3418,12 @@ z - + - + @@ -3432,12 +3432,12 @@ z - + - + @@ -3445,12 +3445,12 @@ z - + - + @@ -3643,13 +3643,13 @@ L 384.689062 183.176563 - + - + - + diff --git a/master/_images/minmax_scale-dark.svg b/master/_images/minmax_scale-dark.svg index 34baf98589..12fba4647b 100644 --- a/master/_images/minmax_scale-dark.svg +++ b/master/_images/minmax_scale-dark.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:51:01.145476 + 2023-10-13T12:00:16.477851 image/svg+xml @@ -43,12 +43,12 @@ z - - + @@ -84,7 +84,7 @@ z - + @@ -124,7 +124,7 @@ z - + @@ -159,7 +159,7 @@ z - + @@ -205,7 +205,7 @@ z - + @@ -260,7 +260,7 @@ z - + @@ -291,7 +291,7 @@ z - + @@ -306,7 +306,7 @@ z - + @@ -323,12 +323,12 @@ z - - + @@ -385,7 +385,7 @@ z - + @@ -400,7 +400,7 @@ z - + @@ -415,7 +415,7 @@ z - + @@ -430,7 +430,7 @@ z - + @@ -545,7 +545,7 @@ L 314.609908 177.589843 L 320.234314 177.822233 L 335.232727 177.754682 L 335.232727 177.754682 -" clip-path="url(#p80957cd510)" style="fill: none; stroke: #b301b3; stroke-width: 1.5; stroke-linecap: square"/> +" clip-path="url(#p6aabf0bee3)" style="fill: none; stroke: #b301b3; stroke-width: 1.5; stroke-linecap: square"/> +" clip-path="url(#p6aabf0bee3)" style="fill: none; stroke: #e8e467; stroke-width: 1.5; stroke-linecap: square"/> + diff --git a/master/_images/minmax_scale-light.svg b/master/_images/minmax_scale-light.svg index c9cc444ca7..3dd75dab92 100644 --- a/master/_images/minmax_scale-light.svg +++ b/master/_images/minmax_scale-light.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:51:01.028315 + 2023-10-13T12:00:16.359019 image/svg+xml @@ -43,12 +43,12 @@ z - - + @@ -84,7 +84,7 @@ z - + @@ -124,7 +124,7 @@ z - + @@ -159,7 +159,7 @@ z - + @@ -205,7 +205,7 @@ z - + @@ -260,7 +260,7 @@ z - + @@ -291,7 +291,7 @@ z - + @@ -306,7 +306,7 @@ z - + @@ -323,12 +323,12 @@ z - - + @@ -385,7 +385,7 @@ z - + @@ -400,7 +400,7 @@ z - + @@ -415,7 +415,7 @@ z - + @@ -430,7 +430,7 @@ z - + @@ -545,7 +545,7 @@ L 314.609908 177.589843 L 320.234314 177.822233 L 335.232727 177.754682 L 335.232727 177.754682 -" clip-path="url(#p6363612e9a)" style="fill: none; stroke: #b301b3; stroke-width: 1.5; stroke-linecap: square"/> +" clip-path="url(#p2297942b9e)" style="fill: none; stroke: #b301b3; stroke-width: 1.5; stroke-linecap: square"/> +" clip-path="url(#p2297942b9e)" style="fill: none; stroke: #e8e467; stroke-width: 1.5; stroke-linecap: square"/> + diff --git a/master/_images/minority-dark.svg b/master/_images/minority-dark.svg index 55a8178e82..2d48134240 100644 --- a/master/_images/minority-dark.svg +++ b/master/_images/minority-dark.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:52:08.820994 + 2023-10-13T12:01:22.145465 image/svg+xml @@ -41,1628 +41,1628 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - + @@ -1709,7 +1709,7 @@ z - + @@ -1739,7 +1739,7 @@ z - + @@ -1775,7 +1775,7 @@ z - + @@ -1788,7 +1788,7 @@ z - + @@ -1801,7 +1801,7 @@ z - + @@ -1850,12 +1850,12 @@ z - - + @@ -1869,7 +1869,7 @@ L -3.5 0 - + @@ -1882,7 +1882,7 @@ L -3.5 0 - + @@ -2124,7 +2124,7 @@ L 90.49513 239.96 L 90.49513 235.933333 L 44.788636 235.933333 z -" clip-path="url(#pc3e27d8934)" style="fill: #b301b3"/> +" clip-path="url(#p3a693a788c)" style="fill: #b301b3"/> +" clip-path="url(#p3a693a788c)" style="fill: #e8e467"/> - + @@ -2152,7 +2152,7 @@ z - + @@ -2165,7 +2165,7 @@ z - + @@ -2180,7 +2180,7 @@ z - + @@ -2193,7 +2193,7 @@ z - + @@ -2208,7 +2208,7 @@ z - + @@ -2244,7 +2244,7 @@ z - + @@ -2438,1287 +2438,1284 @@ z " style="fill: none"/> - - - - - - - - - - + + + + + + + + + + - + @@ -3731,7 +3728,7 @@ L 421.2 202.120154 - + @@ -3772,7 +3769,7 @@ z - + @@ -3789,12 +3786,12 @@ z - + - + @@ -3803,12 +3800,12 @@ z - + - + @@ -3816,12 +3813,12 @@ z - + - + @@ -3829,12 +3826,12 @@ z - + - + @@ -4027,13 +4024,13 @@ L 384.689062 183.176563 - + - + - + diff --git a/master/_images/minority-light.svg b/master/_images/minority-light.svg index 0d21656752..b13700ce35 100644 --- a/master/_images/minority-light.svg +++ b/master/_images/minority-light.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:52:08.467776 + 2023-10-13T12:01:21.807088 image/svg+xml @@ -41,1628 +41,1628 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - + @@ -1709,7 +1709,7 @@ z - + @@ -1739,7 +1739,7 @@ z - + @@ -1775,7 +1775,7 @@ z - + @@ -1788,7 +1788,7 @@ z - + @@ -1801,7 +1801,7 @@ z - + @@ -1850,12 +1850,12 @@ z - - + @@ -1869,7 +1869,7 @@ L -3.5 0 - + @@ -1882,7 +1882,7 @@ L -3.5 0 - + @@ -2124,7 +2124,7 @@ L 90.49513 239.96 L 90.49513 235.933333 L 44.788636 235.933333 z -" clip-path="url(#pe1c92368bf)" style="fill: #b301b3"/> +" clip-path="url(#p81ecc11f56)" style="fill: #b301b3"/> +" clip-path="url(#p81ecc11f56)" style="fill: #e8e467"/> - + @@ -2152,7 +2152,7 @@ z - + @@ -2165,7 +2165,7 @@ z - + @@ -2180,7 +2180,7 @@ z - + @@ -2193,7 +2193,7 @@ z - + @@ -2208,7 +2208,7 @@ z - + @@ -2244,7 +2244,7 @@ z - + @@ -2438,1287 +2438,1284 @@ z " style="fill: none"/> - - - - - - - - - - + + + + + + + + + + - + @@ -3731,7 +3728,7 @@ L 421.2 202.120154 - + @@ -3772,7 +3769,7 @@ z - + @@ -3789,12 +3786,12 @@ z - + - + @@ -3803,12 +3800,12 @@ z - + - + @@ -3816,12 +3813,12 @@ z - + - + @@ -3829,12 +3826,12 @@ z - + - + @@ -4027,13 +4024,13 @@ L 384.689062 183.176563 - + - + - + diff --git a/master/_images/no-truncate-dark.svg b/master/_images/no-truncate-dark.svg index 979d12c442..d0d09e86a6 100644 --- a/master/_images/no-truncate-dark.svg +++ b/master/_images/no-truncate-dark.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:51:23.535823 + 2023-10-13T12:00:38.716237 image/svg+xml @@ -41,50 +41,50 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - - + @@ -120,7 +120,7 @@ z - + @@ -160,7 +160,7 @@ z - + @@ -190,7 +190,7 @@ z - + @@ -204,7 +204,7 @@ z - + @@ -244,7 +244,7 @@ z - + @@ -260,12 +260,12 @@ z - - + @@ -313,7 +313,7 @@ z - + @@ -461,45 +461,45 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - + @@ -512,7 +512,7 @@ L 3 3 - + @@ -525,7 +525,7 @@ L 3 3 - + @@ -539,7 +539,7 @@ L 3 3 - + @@ -553,7 +553,7 @@ L 3 3 - + @@ -567,7 +567,7 @@ L 3 3 - + @@ -583,7 +583,7 @@ L 3 3 - + @@ -597,7 +597,7 @@ L 3 3 - + @@ -652,45 +652,45 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - + @@ -703,7 +703,7 @@ L 3 3 - + @@ -716,7 +716,7 @@ L 3 3 - + @@ -730,7 +730,7 @@ L 3 3 - + @@ -744,7 +744,7 @@ L 3 3 - + @@ -758,7 +758,7 @@ L 3 3 - + @@ -774,7 +774,7 @@ L 3 3 - + @@ -788,7 +788,7 @@ L 3 3 - + @@ -833,13 +833,13 @@ L 345.17677 152.4 - + - + - + diff --git a/master/_images/no-truncate-light.svg b/master/_images/no-truncate-light.svg index 024247053d..ab04cbf29d 100644 --- a/master/_images/no-truncate-light.svg +++ b/master/_images/no-truncate-light.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:51:20.319833 + 2023-10-13T12:00:35.547485 image/svg+xml @@ -41,50 +41,50 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - - + @@ -120,7 +120,7 @@ z - + @@ -160,7 +160,7 @@ z - + @@ -190,7 +190,7 @@ z - + @@ -204,7 +204,7 @@ z - + @@ -244,7 +244,7 @@ z - + @@ -260,12 +260,12 @@ z - - + @@ -313,7 +313,7 @@ z - + @@ -461,45 +461,45 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - + @@ -512,7 +512,7 @@ L 3 3 - + @@ -525,7 +525,7 @@ L 3 3 - + @@ -539,7 +539,7 @@ L 3 3 - + @@ -553,7 +553,7 @@ L 3 3 - + @@ -567,7 +567,7 @@ L 3 3 - + @@ -583,7 +583,7 @@ L 3 3 - + @@ -597,7 +597,7 @@ L 3 3 - + @@ -652,45 +652,45 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - + @@ -703,7 +703,7 @@ L 3 3 - + @@ -716,7 +716,7 @@ L 3 3 - + @@ -730,7 +730,7 @@ L 3 3 - + @@ -744,7 +744,7 @@ L 3 3 - + @@ -758,7 +758,7 @@ L 3 3 - + @@ -774,7 +774,7 @@ L 3 3 - + @@ -788,7 +788,7 @@ L 3 3 - + @@ -833,13 +833,13 @@ L 345.17677 152.4 - + - + - + diff --git a/master/_images/truncate-dark.svg b/master/_images/truncate-dark.svg index ce0b72080c..ced3595127 100644 --- a/master/_images/truncate-dark.svg +++ b/master/_images/truncate-dark.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:51:29.954044 + 2023-10-13T12:00:44.921790 image/svg+xml @@ -41,50 +41,50 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - - + @@ -120,7 +120,7 @@ z - + @@ -160,7 +160,7 @@ z - + @@ -190,7 +190,7 @@ z - + @@ -204,7 +204,7 @@ z - + @@ -244,7 +244,7 @@ z - + @@ -260,12 +260,12 @@ z - - + @@ -313,7 +313,7 @@ z - + @@ -461,45 +461,45 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - + @@ -512,7 +512,7 @@ L 3 3 - + @@ -525,7 +525,7 @@ L 3 3 - + @@ -539,7 +539,7 @@ L 3 3 - + @@ -553,7 +553,7 @@ L 3 3 - + @@ -567,7 +567,7 @@ L 3 3 - + @@ -583,7 +583,7 @@ L 3 3 - + @@ -597,7 +597,7 @@ L 3 3 - + @@ -652,45 +652,45 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - + @@ -703,7 +703,7 @@ L 3 3 - + @@ -716,7 +716,7 @@ L 3 3 - + @@ -730,7 +730,7 @@ L 3 3 - + @@ -744,7 +744,7 @@ L 3 3 - + @@ -758,7 +758,7 @@ L 3 3 - + @@ -774,7 +774,7 @@ L 3 3 - + @@ -788,7 +788,7 @@ L 3 3 - + @@ -833,13 +833,13 @@ L 345.17677 152.4 - + - + - + diff --git a/master/_images/truncate-light.svg b/master/_images/truncate-light.svg index d32e81f963..b15d0bf4ac 100644 --- a/master/_images/truncate-light.svg +++ b/master/_images/truncate-light.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:51:26.746153 + 2023-10-13T12:00:41.813104 image/svg+xml @@ -41,50 +41,50 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - - + @@ -120,7 +120,7 @@ z - + @@ -160,7 +160,7 @@ z - + @@ -190,7 +190,7 @@ z - + @@ -204,7 +204,7 @@ z - + @@ -244,7 +244,7 @@ z - + @@ -260,12 +260,12 @@ z - - + @@ -313,7 +313,7 @@ z - + @@ -461,45 +461,45 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - + @@ -512,7 +512,7 @@ L 3 3 - + @@ -525,7 +525,7 @@ L 3 3 - + @@ -539,7 +539,7 @@ L 3 3 - + @@ -553,7 +553,7 @@ L 3 3 - + @@ -567,7 +567,7 @@ L 3 3 - + @@ -583,7 +583,7 @@ L 3 3 - + @@ -597,7 +597,7 @@ L 3 3 - + @@ -652,45 +652,45 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - + @@ -703,7 +703,7 @@ L 3 3 - + @@ -716,7 +716,7 @@ L 3 3 - + @@ -730,7 +730,7 @@ L 3 3 - + @@ -744,7 +744,7 @@ L 3 3 - + @@ -758,7 +758,7 @@ L 3 3 - + @@ -774,7 +774,7 @@ L 3 3 - + @@ -788,7 +788,7 @@ L 3 3 - + @@ -833,13 +833,13 @@ L 345.17677 152.4 - + - + - + diff --git a/master/_sources/api/wildboar/explain/counterfactual/_nn/index.rst.txt b/master/_sources/api/wildboar/explain/counterfactual/_nn/index.rst.txt index ddf1437a3c..a0239fa52c 100644 --- a/master/_sources/api/wildboar/explain/counterfactual/_nn/index.rst.txt +++ b/master/_sources/api/wildboar/explain/counterfactual/_nn/index.rst.txt @@ -21,7 +21,7 @@ Classes -.. py:class:: KNeighborsCounterfactual(random_state=None) +.. py:class:: KNeighborsCounterfactual(method='auto', random_state=None) @@ -30,6 +30,22 @@ Classes Fit a counterfactual explainer to a k-nearest neighbors classifier. + :Parameters: + + **method** : {"auto", "mean", "medoid"}, optional + The method for generating counterfactuals. If 'auto', counterfactuals + are generated using k-means if possible and k-medoids otherwise. If + 'mean', counterfactuals are always generated using k-means, which fails + if the estimator is fitted with a metric other than 'euclidean', 'dtw' + or 'wdtw. If 'medoid', counterfactuals are generated using k-medoids. + + .. versionadded:: 1.2 + + **random_state** : int or RandomState, optional + - If `int`, `random_state` is the seed used by the random number generator. + - If `RandomState` instance, `random_state` is the random number generator. + - If `None`, the random number generator is the `RandomState` instance used + by `np.random`. diff --git a/master/_sources/api/wildboar/explain/counterfactual/index.rst.txt b/master/_sources/api/wildboar/explain/counterfactual/index.rst.txt index 0a8efcd383..71714f99e7 100644 --- a/master/_sources/api/wildboar/explain/counterfactual/index.rst.txt +++ b/master/_sources/api/wildboar/explain/counterfactual/index.rst.txt @@ -55,7 +55,7 @@ Functions -.. py:class:: KNeighborsCounterfactual(random_state=None) +.. py:class:: KNeighborsCounterfactual(method='auto', random_state=None) @@ -64,6 +64,22 @@ Functions Fit a counterfactual explainer to a k-nearest neighbors classifier. + :Parameters: + + **method** : {"auto", "mean", "medoid"}, optional + The method for generating counterfactuals. If 'auto', counterfactuals + are generated using k-means if possible and k-medoids otherwise. If + 'mean', counterfactuals are always generated using k-means, which fails + if the estimator is fitted with a metric other than 'euclidean', 'dtw' + or 'wdtw. If 'medoid', counterfactuals are generated using k-medoids. + + .. versionadded:: 1.2 + + **random_state** : int or RandomState, optional + - If `int`, `random_state` is the seed used by the random number generator. + - If `RandomState` instance, `random_state` is the random number generator. + - If `None`, the random number generator is the `RandomState` instance used + by `np.random`. diff --git a/master/_sources/more/whatsnew.rst.txt b/master/_sources/more/whatsnew.rst.txt index 8f8cc07673..e6f3496974 100644 --- a/master/_sources/more/whatsnew.rst.txt +++ b/master/_sources/more/whatsnew.rst.txt @@ -104,6 +104,18 @@ Changelog - |API| Drop support for ``criterion="mse"`` in :class:`ensemble.ShapeletForestRegressor` and :class:`ensemble.ExtraShapeletTreesRegressor`. + .. grid-item-card:: + + :mod:`wildboar.explain.counterfactual` + ^^^ + + - |Feature| Add support for KNeighborsClassifiers fitted with any metric + in `explain.counterfactual.KNeighborsCounterfactual`. We allow for using + different methods for finding the counterfactuals for `n_neighbors > 1` + by setting `method='mean'` or `method='medoid'`. We have also improved + the way in which cluster centroids are selected, resulting in a more + robust counterfactuals. + .. grid-item-card:: :mod:`wildboar.linear_model` diff --git a/master/_static/documentation_options.js b/master/_static/documentation_options.js index 47f50390c2..00600c9225 100644 --- a/master/_static/documentation_options.js +++ b/master/_static/documentation_options.js @@ -1,6 +1,6 @@ var DOCUMENTATION_OPTIONS = { URL_ROOT: document.getElementById("documentation_options").getAttribute('data-url_root'), - VERSION: '1.1.1.dev181', + VERSION: '1.1.1.dev185', LANGUAGE: 'en', COLLAPSE_INDEX: false, BUILDER: 'html', diff --git a/master/_static/fig/getting-started/interval-dark.svg b/master/_static/fig/getting-started/interval-dark.svg index ffc60c71b8..a50f2046d4 100644 --- a/master/_static/fig/getting-started/interval-dark.svg +++ b/master/_static/fig/getting-started/interval-dark.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:52:01.822650 + 2023-10-13T12:01:16.444454 image/svg+xml @@ -42,294 +42,294 @@ z +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke-dasharray: 2.5,2.5; stroke-dashoffset: 0; stroke: #808080; stroke-width: 0.5"/> - + - + - + - + - + - + - + - + - + - + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - - - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + - - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + - - - - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + + - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - - - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - - - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + - - - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + - - - - - - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + + + + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#pbd9dc05dec)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#pbd9dc05dec)" style="fill: #b40426; opacity: 0.2; stroke: #b40426; stroke-linejoin: miter"/> +" clip-path="url(#pbd9dc05dec)" style="fill: #b50927; opacity: 0.2; stroke: #b50927; stroke-linejoin: miter"/> +" clip-path="url(#pbd9dc05dec)" style="fill: #ba162b; opacity: 0.2; stroke: #ba162b; stroke-linejoin: miter"/> +" clip-path="url(#pbd9dc05dec)" style="fill: #efcebd; opacity: 0.2; stroke: #efcebd; stroke-linejoin: miter"/> +" clip-path="url(#pbd9dc05dec)" style="fill: #e0dbd8; opacity: 0.2; stroke: #e0dbd8; stroke-linejoin: miter"/> +" clip-path="url(#pbd9dc05dec)" style="fill: #dedcdb; opacity: 0.2; stroke: #dedcdb; stroke-linejoin: miter"/> +" clip-path="url(#pbd9dc05dec)" style="fill: #dddcdc; opacity: 0.2; stroke: #dddcdc; stroke-linejoin: miter"/> +" clip-path="url(#pbd9dc05dec)" style="fill: #dddcdc; opacity: 0.2; stroke: #dddcdc; stroke-linejoin: miter"/> +" clip-path="url(#pbd9dc05dec)" style="fill: #dddcdc; opacity: 0.2; stroke: #dddcdc; stroke-linejoin: miter"/> +" clip-path="url(#pbd9dc05dec)" style="fill: #dddcdc; opacity: 0.2; stroke: #dddcdc; stroke-linejoin: miter"/> +iVBORw0KGgoAAAANSUhEUgAAAa4AAAEKCAYAAABKeLFiAAAEnklEQVR4nO3dwW0DMQwAQZ3B/it0KnF8TAvxy1hgpgL/DmuK0vXzfO4BgIjHt38AAHzChwuAlLmOfwoB6FBcAKTMtfe3fwMA/JviAiDFjAuAFMUFQIoZFwApiguAFDMuAFIUFwApZlwApCguAFLMuABIUVwApMy1iguADsUFQIpThQCkKC4AUpwqBCBFcQGQYsYFQIriAiDFHhcAKYoLgBQfLgBS5joOZwDQobgASJnjcAYAIYoLgBQLyACkKC4AUlyyC0CK4gIgxYwLgBTFBUCKPS4AUhQXAClmXACkKC4AUjwkCUCK4gIgZY4ZFwAhiguAFKcKAUhRXACkuB0egBTFBUCKU4UApCguAFLcnAFAiuICIMWHC4AUhzMASFFcAKTMcTgDgBDFBUCKS3YBSFFcAKSYcQGQorgASDHjAiBFcQGQ4uYMAFIUFwApnjUBIEVxAZAy5zbjAqBDcQGQ4uYMAFIUFwAp9rgASFFcAKTY4wIgRXEBkGLGBUCK4gIgRXEBkKK4AEjx4QIgxXF4AFIUFwApnjUBIEVxAZDiWRMAUhQXACkWkAFIUVwApJhxAZCiuABIsccFQIriAiDFqUIAUhQXAClOFQKQorgASHGqEIAUxQVAihkXACmKC4AUe1wApCguAFLm3GZcAHQoLgBSzLgASFFcAKT4cAGQ4sonAFIUFwAprnwCIEVxAZDiODwAKYoLgBRXPgGQorgASJk14wIgRHEBkGLGBUCK4gIgxR4XACmKC4CUWbfDAxCiuABIcTs8ACmKC4AULyADkKK4AEgx4wIgRXEBkGKPC4AUxQVAitvhAUhRXACk+HABkDLrWRMAQhQXACkOZwCQorgASJljxgVAiOICIGXWjAuAEMUFQIqHJAFIUVwApMx6SBKAEMUFQIoZFwApiguAFHtcAKQoLgBS3FUIQIriAiDFjAuAFMUFQMqsPS4AQhQXAClzzLgACFFcAKT4cAGQMmsBGYAQxQVAigVkAFIUFwApHpIEIEVxAZBixgVAiuICIMUluwCkKC4AUmbXjAuADsUFQIo9LgBSFBcAKfa4AEhRXACkKC4AUhQXACluzgAgRXEBkGLGBUCK4gIgxYwLgBTFBUCKGRcAKYoLgBQfLgBS5nhIEoAQxQVAiuPwAKQoLgBSHIcHIEVxAZBixgVAiuICIMWMC4AUxQVAiuICIEVxAZDiVCEAKYoLgBQzLgBSFBcAKXO/FRcAHYoLgBSnCgFIUVwApDhVCECK4gIgRXEBkKK4AEhRXACkKC4AUny4AEixgAxAiuICIMXhDABSFBcAKZ41ASBFcQGQYsYFQIriAiDFHhcAKYoLgBQzLgBSFBcAKfa4AEhRXACkmHEBkKK4AEixxwVAiuICIGXWqUIAQhQXACn2uABIUVwApNjjAiBFcQGQYsYFQIriAiDFhwuAlNm3K58A6FBcAKQ4Dg9AiuICIMVxeABSFBcAKZ41ASBFcQGQMvev4gKgQ3EBkDL7UlwAdCguAFLMuABIUVwApJhxAZCiuABIMeMCIEVxAZAy+/ICMgAdiguAFDMuAFIUFwAp9rgASFFcAKT8AcwMM/7UKElmAAAAAElFTkSuQmCC" id="imagee363062026" transform="scale(1 -1) translate(0 -191.52)" x="10.8" y="-15.12" width="309.6" height="191.52"/> - - + @@ -469,7 +469,7 @@ z - + @@ -512,7 +512,7 @@ z - + @@ -544,7 +544,7 @@ z - + @@ -560,7 +560,7 @@ z - + @@ -602,7 +602,7 @@ z - + @@ -618,7 +618,7 @@ z - + @@ -767,7 +767,7 @@ L 287.156875 42.536563 - + diff --git a/master/_static/fig/getting-started/interval-light.svg b/master/_static/fig/getting-started/interval-light.svg index 4970f2ccd3..30c3f196ce 100644 --- a/master/_static/fig/getting-started/interval-light.svg +++ b/master/_static/fig/getting-started/interval-light.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:52:01.338829 + 2023-10-13T12:01:15.958510 image/svg+xml @@ -42,294 +42,294 @@ z +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke-dasharray: 2.5,2.5; stroke-dashoffset: 0; stroke: #808080; stroke-width: 0.5"/> - + - + - + - + - + - + - + - + - + - + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - - - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + - - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + - - - - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + + - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - - - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - - - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + - - - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + - - - - - - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> + + + + + + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #1b9e77; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> - +" clip-path="url(#p66216ff1a1)" style="fill: none; stroke: #666666; stroke-opacity: 0.5; stroke-width: 0.5"/> + +" clip-path="url(#p66216ff1a1)" style="fill: #b40426; opacity: 0.2; stroke: #b40426; stroke-linejoin: miter"/> +" clip-path="url(#p66216ff1a1)" style="fill: #b50927; opacity: 0.2; stroke: #b50927; stroke-linejoin: miter"/> +" clip-path="url(#p66216ff1a1)" style="fill: #ba162b; opacity: 0.2; stroke: #ba162b; stroke-linejoin: miter"/> +" clip-path="url(#p66216ff1a1)" style="fill: #efcebd; opacity: 0.2; stroke: #efcebd; stroke-linejoin: miter"/> +" clip-path="url(#p66216ff1a1)" style="fill: #e0dbd8; opacity: 0.2; stroke: #e0dbd8; stroke-linejoin: miter"/> +" clip-path="url(#p66216ff1a1)" style="fill: #dedcdb; opacity: 0.2; stroke: #dedcdb; stroke-linejoin: miter"/> +" clip-path="url(#p66216ff1a1)" style="fill: #dddcdc; opacity: 0.2; stroke: #dddcdc; stroke-linejoin: miter"/> +" clip-path="url(#p66216ff1a1)" style="fill: #dddcdc; opacity: 0.2; stroke: #dddcdc; stroke-linejoin: miter"/> +" clip-path="url(#p66216ff1a1)" style="fill: #dddcdc; opacity: 0.2; stroke: #dddcdc; stroke-linejoin: miter"/> +" clip-path="url(#p66216ff1a1)" style="fill: #dddcdc; opacity: 0.2; stroke: #dddcdc; stroke-linejoin: miter"/> +iVBORw0KGgoAAAANSUhEUgAAAa4AAAEKCAYAAABKeLFiAAAEnklEQVR4nO3dwW0DMQwAQZ3B/it0KnF8TAvxy1hgpgL/DmuK0vXzfO4BgIjHt38AAHzChwuAlLmOfwoB6FBcAKTMtfe3fwMA/JviAiDFjAuAFMUFQIoZFwApiguAFDMuAFIUFwApZlwApCguAFLMuABIUVwApMy1iguADsUFQIpThQCkKC4AUpwqBCBFcQGQYsYFQIriAiDFHhcAKYoLgBQfLgBS5joOZwDQobgASJnjcAYAIYoLgBQLyACkKC4AUlyyC0CK4gIgxYwLgBTFBUCKPS4AUhQXAClmXACkKC4AUjwkCUCK4gIgZY4ZFwAhiguAFKcKAUhRXACkuB0egBTFBUCKU4UApCguAFLcnAFAiuICIMWHC4AUhzMASFFcAKTMcTgDgBDFBUCKS3YBSFFcAKSYcQGQorgASDHjAiBFcQGQ4uYMAFIUFwApnjUBIEVxAZAy5zbjAqBDcQGQ4uYMAFIUFwAp9rgASFFcAKTY4wIgRXEBkGLGBUCK4gIgRXEBkKK4AEjx4QIgxXF4AFIUFwApnjUBIEVxAZDiWRMAUhQXACkWkAFIUVwApJhxAZCiuABIsccFQIriAiDFqUIAUhQXAClOFQKQorgASHGqEIAUxQVAihkXACmKC4AUe1wApCguAFLm3GZcAHQoLgBSzLgASFFcAKT4cAGQ4sonAFIUFwAprnwCIEVxAZDiODwAKYoLgBRXPgGQorgASJk14wIgRHEBkGLGBUCK4gIgxR4XACmKC4CUWbfDAxCiuABIcTs8ACmKC4AULyADkKK4AEgx4wIgRXEBkGKPC4AUxQVAitvhAUhRXACk+HABkDLrWRMAQhQXACkOZwCQorgASJljxgVAiOICIGXWjAuAEMUFQIqHJAFIUVwApMx6SBKAEMUFQIoZFwApiguAFHtcAKQoLgBS3FUIQIriAiDFjAuAFMUFQMqsPS4AQhQXAClzzLgACFFcAKT4cAGQMmsBGYAQxQVAigVkAFIUFwApHpIEIEVxAZBixgVAiuICIMUluwCkKC4AUmbXjAuADsUFQIo9LgBSFBcAKfa4AEhRXACkKC4AUhQXACluzgAgRXEBkGLGBUCK4gIgxYwLgBTFBUCKGRcAKYoLgBQfLgBS5nhIEoAQxQVAiuPwAKQoLgBSHIcHIEVxAZBixgVAiuICIMWMC4AUxQVAiuICIEVxAZDiVCEAKYoLgBQzLgBSFBcAKXO/FRcAHYoLgBSnCgFIUVwApDhVCECK4gIgRXEBkKK4AEhRXACkKC4AUny4AEixgAxAiuICIMXhDABSFBcAKZ41ASBFcQGQYsYFQIriAiDFHhcAKYoLgBQzLgBSFBcAKfa4AEhRXACkmHEBkKK4AEixxwVAiuICIGXWqUIAQhQXACn2uABIUVwApNjjAiBFcQGQYsYFQIriAiDFhwuAlNm3K58A6FBcAKQ4Dg9AiuICIMVxeABSFBcAKZ41ASBFcQGQMvev4gKgQ3EBkDL7UlwAdCguAFLMuABIUVwApJhxAZCiuABIMeMCIEVxAZAy+/ICMgAdiguAFDMuAFIUFwAp9rgASFFcAKT8AcwMM/7UKElmAAAAAElFTkSuQmCC" id="image6793938482" transform="scale(1 -1) translate(0 -191.52)" x="10.8" y="-15.12" width="309.6" height="191.52"/> - - + @@ -469,7 +469,7 @@ z - + @@ -512,7 +512,7 @@ z - + @@ -544,7 +544,7 @@ z - + @@ -560,7 +560,7 @@ z - + @@ -602,7 +602,7 @@ z - + @@ -618,7 +618,7 @@ z - + @@ -767,7 +767,7 @@ L 287.156875 42.536563 - + diff --git a/master/_static/fig/guide/datasets/repository/preprocess/minmax_scale-dark.svg b/master/_static/fig/guide/datasets/repository/preprocess/minmax_scale-dark.svg index 34baf98589..12fba4647b 100644 --- a/master/_static/fig/guide/datasets/repository/preprocess/minmax_scale-dark.svg +++ b/master/_static/fig/guide/datasets/repository/preprocess/minmax_scale-dark.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:51:01.145476 + 2023-10-13T12:00:16.477851 image/svg+xml @@ -43,12 +43,12 @@ z - - + @@ -84,7 +84,7 @@ z - + @@ -124,7 +124,7 @@ z - + @@ -159,7 +159,7 @@ z - + @@ -205,7 +205,7 @@ z - + @@ -260,7 +260,7 @@ z - + @@ -291,7 +291,7 @@ z - + @@ -306,7 +306,7 @@ z - + @@ -323,12 +323,12 @@ z - - + @@ -385,7 +385,7 @@ z - + @@ -400,7 +400,7 @@ z - + @@ -415,7 +415,7 @@ z - + @@ -430,7 +430,7 @@ z - + @@ -545,7 +545,7 @@ L 314.609908 177.589843 L 320.234314 177.822233 L 335.232727 177.754682 L 335.232727 177.754682 -" clip-path="url(#p80957cd510)" style="fill: none; stroke: #b301b3; stroke-width: 1.5; stroke-linecap: square"/> +" clip-path="url(#p6aabf0bee3)" style="fill: none; stroke: #b301b3; stroke-width: 1.5; stroke-linecap: square"/> +" clip-path="url(#p6aabf0bee3)" style="fill: none; stroke: #e8e467; stroke-width: 1.5; stroke-linecap: square"/> + diff --git a/master/_static/fig/guide/datasets/repository/preprocess/minmax_scale-light.svg b/master/_static/fig/guide/datasets/repository/preprocess/minmax_scale-light.svg index c9cc444ca7..3dd75dab92 100644 --- a/master/_static/fig/guide/datasets/repository/preprocess/minmax_scale-light.svg +++ b/master/_static/fig/guide/datasets/repository/preprocess/minmax_scale-light.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:51:01.028315 + 2023-10-13T12:00:16.359019 image/svg+xml @@ -43,12 +43,12 @@ z - - + @@ -84,7 +84,7 @@ z - + @@ -124,7 +124,7 @@ z - + @@ -159,7 +159,7 @@ z - + @@ -205,7 +205,7 @@ z - + @@ -260,7 +260,7 @@ z - + @@ -291,7 +291,7 @@ z - + @@ -306,7 +306,7 @@ z - + @@ -323,12 +323,12 @@ z - - + @@ -385,7 +385,7 @@ z - + @@ -400,7 +400,7 @@ z - + @@ -415,7 +415,7 @@ z - + @@ -430,7 +430,7 @@ z - + @@ -545,7 +545,7 @@ L 314.609908 177.589843 L 320.234314 177.822233 L 335.232727 177.754682 L 335.232727 177.754682 -" clip-path="url(#p6363612e9a)" style="fill: none; stroke: #b301b3; stroke-width: 1.5; stroke-linecap: square"/> +" clip-path="url(#p2297942b9e)" style="fill: none; stroke: #b301b3; stroke-width: 1.5; stroke-linecap: square"/> +" clip-path="url(#p2297942b9e)" style="fill: none; stroke: #e8e467; stroke-width: 1.5; stroke-linecap: square"/> + diff --git a/master/_static/fig/guide/datasets/repository/preprocess/no-truncate-dark.svg b/master/_static/fig/guide/datasets/repository/preprocess/no-truncate-dark.svg index 979d12c442..d0d09e86a6 100644 --- a/master/_static/fig/guide/datasets/repository/preprocess/no-truncate-dark.svg +++ b/master/_static/fig/guide/datasets/repository/preprocess/no-truncate-dark.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:51:23.535823 + 2023-10-13T12:00:38.716237 image/svg+xml @@ -41,50 +41,50 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - - + @@ -120,7 +120,7 @@ z - + @@ -160,7 +160,7 @@ z - + @@ -190,7 +190,7 @@ z - + @@ -204,7 +204,7 @@ z - + @@ -244,7 +244,7 @@ z - + @@ -260,12 +260,12 @@ z - - + @@ -313,7 +313,7 @@ z - + @@ -461,45 +461,45 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - + @@ -512,7 +512,7 @@ L 3 3 - + @@ -525,7 +525,7 @@ L 3 3 - + @@ -539,7 +539,7 @@ L 3 3 - + @@ -553,7 +553,7 @@ L 3 3 - + @@ -567,7 +567,7 @@ L 3 3 - + @@ -583,7 +583,7 @@ L 3 3 - + @@ -597,7 +597,7 @@ L 3 3 - + @@ -652,45 +652,45 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - + @@ -703,7 +703,7 @@ L 3 3 - + @@ -716,7 +716,7 @@ L 3 3 - + @@ -730,7 +730,7 @@ L 3 3 - + @@ -744,7 +744,7 @@ L 3 3 - + @@ -758,7 +758,7 @@ L 3 3 - + @@ -774,7 +774,7 @@ L 3 3 - + @@ -788,7 +788,7 @@ L 3 3 - + @@ -833,13 +833,13 @@ L 345.17677 152.4 - + - + - + diff --git a/master/_static/fig/guide/datasets/repository/preprocess/no-truncate-light.svg b/master/_static/fig/guide/datasets/repository/preprocess/no-truncate-light.svg index 024247053d..ab04cbf29d 100644 --- a/master/_static/fig/guide/datasets/repository/preprocess/no-truncate-light.svg +++ b/master/_static/fig/guide/datasets/repository/preprocess/no-truncate-light.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:51:20.319833 + 2023-10-13T12:00:35.547485 image/svg+xml @@ -41,50 +41,50 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - - + @@ -120,7 +120,7 @@ z - + @@ -160,7 +160,7 @@ z - + @@ -190,7 +190,7 @@ z - + @@ -204,7 +204,7 @@ z - + @@ -244,7 +244,7 @@ z - + @@ -260,12 +260,12 @@ z - - + @@ -313,7 +313,7 @@ z - + @@ -461,45 +461,45 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - + @@ -512,7 +512,7 @@ L 3 3 - + @@ -525,7 +525,7 @@ L 3 3 - + @@ -539,7 +539,7 @@ L 3 3 - + @@ -553,7 +553,7 @@ L 3 3 - + @@ -567,7 +567,7 @@ L 3 3 - + @@ -583,7 +583,7 @@ L 3 3 - + @@ -597,7 +597,7 @@ L 3 3 - + @@ -652,45 +652,45 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - + @@ -703,7 +703,7 @@ L 3 3 - + @@ -716,7 +716,7 @@ L 3 3 - + @@ -730,7 +730,7 @@ L 3 3 - + @@ -744,7 +744,7 @@ L 3 3 - + @@ -758,7 +758,7 @@ L 3 3 - + @@ -774,7 +774,7 @@ L 3 3 - + @@ -788,7 +788,7 @@ L 3 3 - + @@ -833,13 +833,13 @@ L 345.17677 152.4 - + - + - + diff --git a/master/_static/fig/guide/datasets/repository/preprocess/truncate-dark.svg b/master/_static/fig/guide/datasets/repository/preprocess/truncate-dark.svg index ce0b72080c..ced3595127 100644 --- a/master/_static/fig/guide/datasets/repository/preprocess/truncate-dark.svg +++ b/master/_static/fig/guide/datasets/repository/preprocess/truncate-dark.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:51:29.954044 + 2023-10-13T12:00:44.921790 image/svg+xml @@ -41,50 +41,50 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - - + @@ -120,7 +120,7 @@ z - + @@ -160,7 +160,7 @@ z - + @@ -190,7 +190,7 @@ z - + @@ -204,7 +204,7 @@ z - + @@ -244,7 +244,7 @@ z - + @@ -260,12 +260,12 @@ z - - + @@ -313,7 +313,7 @@ z - + @@ -461,45 +461,45 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - + @@ -512,7 +512,7 @@ L 3 3 - + @@ -525,7 +525,7 @@ L 3 3 - + @@ -539,7 +539,7 @@ L 3 3 - + @@ -553,7 +553,7 @@ L 3 3 - + @@ -567,7 +567,7 @@ L 3 3 - + @@ -583,7 +583,7 @@ L 3 3 - + @@ -597,7 +597,7 @@ L 3 3 - + @@ -652,45 +652,45 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - + @@ -703,7 +703,7 @@ L 3 3 - + @@ -716,7 +716,7 @@ L 3 3 - + @@ -730,7 +730,7 @@ L 3 3 - + @@ -744,7 +744,7 @@ L 3 3 - + @@ -758,7 +758,7 @@ L 3 3 - + @@ -774,7 +774,7 @@ L 3 3 - + @@ -788,7 +788,7 @@ L 3 3 - + @@ -833,13 +833,13 @@ L 345.17677 152.4 - + - + - + diff --git a/master/_static/fig/guide/datasets/repository/preprocess/truncate-light.svg b/master/_static/fig/guide/datasets/repository/preprocess/truncate-light.svg index d32e81f963..b15d0bf4ac 100644 --- a/master/_static/fig/guide/datasets/repository/preprocess/truncate-light.svg +++ b/master/_static/fig/guide/datasets/repository/preprocess/truncate-light.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:51:26.746153 + 2023-10-13T12:00:41.813104 image/svg+xml @@ -41,50 +41,50 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - - + @@ -120,7 +120,7 @@ z - + @@ -160,7 +160,7 @@ z - + @@ -190,7 +190,7 @@ z - + @@ -204,7 +204,7 @@ z - + @@ -244,7 +244,7 @@ z - + @@ -260,12 +260,12 @@ z - - + @@ -313,7 +313,7 @@ z - + @@ -461,45 +461,45 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - + @@ -512,7 +512,7 @@ L 3 3 - + @@ -525,7 +525,7 @@ L 3 3 - + @@ -539,7 +539,7 @@ L 3 3 - + @@ -553,7 +553,7 @@ L 3 3 - + @@ -567,7 +567,7 @@ L 3 3 - + @@ -583,7 +583,7 @@ L 3 3 - + @@ -597,7 +597,7 @@ L 3 3 - + @@ -652,45 +652,45 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - + @@ -703,7 +703,7 @@ L 3 3 - + @@ -716,7 +716,7 @@ L 3 3 - + @@ -730,7 +730,7 @@ L 3 3 - + @@ -744,7 +744,7 @@ L 3 3 - + @@ -758,7 +758,7 @@ L 3 3 - + @@ -774,7 +774,7 @@ L 3 3 - + @@ -788,7 +788,7 @@ L 3 3 - + @@ -833,13 +833,13 @@ L 345.17677 152.4 - + - + - + diff --git a/master/_static/fig/guide/unsupervised/outlier/emmott-dark.svg b/master/_static/fig/guide/unsupervised/outlier/emmott-dark.svg index ea9338ece7..aa2bc418d0 100644 --- a/master/_static/fig/guide/unsupervised/outlier/emmott-dark.svg +++ b/master/_static/fig/guide/unsupervised/outlier/emmott-dark.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:52:13.196816 + 2023-10-13T12:01:26.515121 image/svg+xml @@ -41,1597 +41,1597 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - + @@ -1678,7 +1678,7 @@ z - + @@ -1708,7 +1708,7 @@ z - + @@ -1744,7 +1744,7 @@ z - + @@ -1757,7 +1757,7 @@ z - + @@ -1770,7 +1770,7 @@ z - + @@ -1819,12 +1819,12 @@ z - - + @@ -1838,7 +1838,7 @@ L -3.5 0 - + @@ -1851,7 +1851,7 @@ L -3.5 0 - + @@ -2093,7 +2093,7 @@ L 90.49513 239.96 L 90.49513 235.721404 L 44.788636 235.721404 z -" clip-path="url(#p3862e7bcbe)" style="fill: #b301b3"/> +" clip-path="url(#pc9d9875cbf)" style="fill: #b301b3"/> +" clip-path="url(#pc9d9875cbf)" style="fill: #e8e467"/> - + @@ -2121,7 +2121,7 @@ z - + @@ -2134,7 +2134,7 @@ z - + @@ -2149,7 +2149,7 @@ z - + @@ -2162,7 +2162,7 @@ z - + @@ -2177,7 +2177,7 @@ z - + @@ -2213,7 +2213,7 @@ z - + @@ -2533,7 +2533,7 @@ L 418.428819 193.90719 L 419.814409 206.589568 L 421.2 202.095266 L 421.2 202.095266 -" clip-path="url(#pd08e4e93cc)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p740b2f7f0c)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p740b2f7f0c)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p740b2f7f0c)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p740b2f7f0c)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p740b2f7f0c)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p740b2f7f0c)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p740b2f7f0c)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p740b2f7f0c)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p740b2f7f0c)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p740b2f7f0c)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> - + @@ -3705,7 +3705,7 @@ L 421.2 201.383567 - + @@ -3746,7 +3746,7 @@ z - + @@ -3763,7 +3763,7 @@ z - + @@ -3777,7 +3777,7 @@ z - + @@ -3790,7 +3790,7 @@ z - + @@ -3803,7 +3803,7 @@ z - + @@ -3986,13 +3986,13 @@ L 394.229687 183.176563 - + - + - + diff --git a/master/_static/fig/guide/unsupervised/outlier/emmott-hard-dark.svg b/master/_static/fig/guide/unsupervised/outlier/emmott-hard-dark.svg index ffa31564bd..e352fd6aa5 100644 --- a/master/_static/fig/guide/unsupervised/outlier/emmott-hard-dark.svg +++ b/master/_static/fig/guide/unsupervised/outlier/emmott-hard-dark.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:52:14.887305 + 2023-10-13T12:01:28.265872 image/svg+xml @@ -41,1597 +41,1597 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - + @@ -1678,7 +1678,7 @@ z - + @@ -1708,7 +1708,7 @@ z - + @@ -1744,7 +1744,7 @@ z - + @@ -1757,7 +1757,7 @@ z - + @@ -1770,7 +1770,7 @@ z - + @@ -1819,12 +1819,12 @@ z - - + @@ -1838,7 +1838,7 @@ L -3.5 0 - + @@ -1851,7 +1851,7 @@ L -3.5 0 - + @@ -2093,7 +2093,7 @@ L 90.49513 239.96 L 90.49513 235.721404 L 44.788636 235.721404 z -" clip-path="url(#p5c0875b39f)" style="fill: #b301b3"/> +" clip-path="url(#pfe31fa993f)" style="fill: #b301b3"/> +" clip-path="url(#pfe31fa993f)" style="fill: #e8e467"/> - + @@ -2121,7 +2121,7 @@ z - + @@ -2134,7 +2134,7 @@ z - + @@ -2149,7 +2149,7 @@ z - + @@ -2162,7 +2162,7 @@ z - + @@ -2177,7 +2177,7 @@ z - + @@ -2213,7 +2213,7 @@ z - + @@ -2533,7 +2533,7 @@ L 418.428819 193.90719 L 419.814409 206.589568 L 421.2 202.095266 L 421.2 202.095266 -" clip-path="url(#p34837d6274)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p16e2f6f7cf)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p16e2f6f7cf)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p16e2f6f7cf)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p16e2f6f7cf)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p16e2f6f7cf)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p16e2f6f7cf)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p16e2f6f7cf)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p16e2f6f7cf)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p16e2f6f7cf)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#p16e2f6f7cf)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> - + @@ -3705,7 +3705,7 @@ L 421.2 201.383567 - + @@ -3746,7 +3746,7 @@ z - + @@ -3763,7 +3763,7 @@ z - + @@ -3777,7 +3777,7 @@ z - + @@ -3790,7 +3790,7 @@ z - + @@ -3803,7 +3803,7 @@ z - + @@ -3986,13 +3986,13 @@ L 394.229687 183.176563 - + - + - + diff --git a/master/_static/fig/guide/unsupervised/outlier/emmott-hard-light.svg b/master/_static/fig/guide/unsupervised/outlier/emmott-hard-light.svg index 4ea9c553f8..4739c9a5db 100644 --- a/master/_static/fig/guide/unsupervised/outlier/emmott-hard-light.svg +++ b/master/_static/fig/guide/unsupervised/outlier/emmott-hard-light.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:52:14.539496 + 2023-10-13T12:01:27.922195 image/svg+xml @@ -41,1597 +41,1597 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - + @@ -1678,7 +1678,7 @@ z - + @@ -1708,7 +1708,7 @@ z - + @@ -1744,7 +1744,7 @@ z - + @@ -1757,7 +1757,7 @@ z - + @@ -1770,7 +1770,7 @@ z - + @@ -1819,12 +1819,12 @@ z - - + @@ -1838,7 +1838,7 @@ L -3.5 0 - + @@ -1851,7 +1851,7 @@ L -3.5 0 - + @@ -2093,7 +2093,7 @@ L 90.49513 239.96 L 90.49513 235.721404 L 44.788636 235.721404 z -" clip-path="url(#p3e170d58d7)" style="fill: #b301b3"/> +" clip-path="url(#p9ca3044348)" style="fill: #b301b3"/> +" clip-path="url(#p9ca3044348)" style="fill: #e8e467"/> - + @@ -2121,7 +2121,7 @@ z - + @@ -2134,7 +2134,7 @@ z - + @@ -2149,7 +2149,7 @@ z - + @@ -2162,7 +2162,7 @@ z - + @@ -2177,7 +2177,7 @@ z - + @@ -2213,7 +2213,7 @@ z - + @@ -2533,7 +2533,7 @@ L 418.428819 193.90719 L 419.814409 206.589568 L 421.2 202.095266 L 421.2 202.095266 -" clip-path="url(#p03818e67a2)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pc3a89a39f4)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pc3a89a39f4)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pc3a89a39f4)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pc3a89a39f4)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pc3a89a39f4)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pc3a89a39f4)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pc3a89a39f4)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pc3a89a39f4)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pc3a89a39f4)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pc3a89a39f4)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> - + @@ -3705,7 +3705,7 @@ L 421.2 201.383567 - + @@ -3746,7 +3746,7 @@ z - + @@ -3763,7 +3763,7 @@ z - + @@ -3777,7 +3777,7 @@ z - + @@ -3790,7 +3790,7 @@ z - + @@ -3803,7 +3803,7 @@ z - + @@ -3986,13 +3986,13 @@ L 394.229687 183.176563 - + - + - + diff --git a/master/_static/fig/guide/unsupervised/outlier/emmott-light.svg b/master/_static/fig/guide/unsupervised/outlier/emmott-light.svg index 648e4c09da..73f30a519d 100644 --- a/master/_static/fig/guide/unsupervised/outlier/emmott-light.svg +++ b/master/_static/fig/guide/unsupervised/outlier/emmott-light.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:52:12.855456 + 2023-10-13T12:01:26.179489 image/svg+xml @@ -41,1597 +41,1597 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - + @@ -1678,7 +1678,7 @@ z - + @@ -1708,7 +1708,7 @@ z - + @@ -1744,7 +1744,7 @@ z - + @@ -1757,7 +1757,7 @@ z - + @@ -1770,7 +1770,7 @@ z - + @@ -1819,12 +1819,12 @@ z - - + @@ -1838,7 +1838,7 @@ L -3.5 0 - + @@ -1851,7 +1851,7 @@ L -3.5 0 - + @@ -2093,7 +2093,7 @@ L 90.49513 239.96 L 90.49513 235.721404 L 44.788636 235.721404 z -" clip-path="url(#pcee705529f)" style="fill: #b301b3"/> +" clip-path="url(#p3e63fe5dad)" style="fill: #b301b3"/> +" clip-path="url(#p3e63fe5dad)" style="fill: #e8e467"/> - + @@ -2121,7 +2121,7 @@ z - + @@ -2134,7 +2134,7 @@ z - + @@ -2149,7 +2149,7 @@ z - + @@ -2162,7 +2162,7 @@ z - + @@ -2177,7 +2177,7 @@ z - + @@ -2213,7 +2213,7 @@ z - + @@ -2533,7 +2533,7 @@ L 418.428819 193.90719 L 419.814409 206.589568 L 421.2 202.095266 L 421.2 202.095266 -" clip-path="url(#pc984772247)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pe0941e17c1)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pe0941e17c1)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pe0941e17c1)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pe0941e17c1)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pe0941e17c1)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pe0941e17c1)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pe0941e17c1)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pe0941e17c1)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pe0941e17c1)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> +" clip-path="url(#pe0941e17c1)" style="fill: none; stroke: #e8e467; stroke-opacity: 0.5; stroke-width: 0.5"/> - + @@ -3705,7 +3705,7 @@ L 421.2 201.383567 - + @@ -3746,7 +3746,7 @@ z - + @@ -3763,7 +3763,7 @@ z - + @@ -3777,7 +3777,7 @@ z - + @@ -3790,7 +3790,7 @@ z - + @@ -3803,7 +3803,7 @@ z - + @@ -3986,13 +3986,13 @@ L 394.229687 183.176563 - + - + - + diff --git a/master/_static/fig/guide/unsupervised/outlier/kmeans-dark.svg b/master/_static/fig/guide/unsupervised/outlier/kmeans-dark.svg index c6b5715da4..96053ba0fb 100644 --- a/master/_static/fig/guide/unsupervised/outlier/kmeans-dark.svg +++ b/master/_static/fig/guide/unsupervised/outlier/kmeans-dark.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:52:11.346166 + 2023-10-13T12:01:24.633305 image/svg+xml @@ -41,1783 +41,1783 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - + @@ -1864,7 +1864,7 @@ z - + @@ -1894,7 +1894,7 @@ z - + @@ -1930,7 +1930,7 @@ z - + @@ -1943,7 +1943,7 @@ z - + @@ -1956,7 +1956,7 @@ z - + @@ -2005,12 +2005,12 @@ z - - + @@ -2024,7 +2024,7 @@ L -3.5 0 - + @@ -2037,7 +2037,7 @@ L -3.5 0 - + @@ -2279,7 +2279,7 @@ L 90.418864 239.96 L 90.418864 235.865085 L 44.700682 235.865085 z -" clip-path="url(#pac8ceb9665)" style="fill: #b301b3"/> +" clip-path="url(#p922715ec02)" style="fill: #b301b3"/> +" clip-path="url(#p922715ec02)" style="fill: #e8e467"/> - + @@ -2307,7 +2307,7 @@ z - + @@ -2320,7 +2320,7 @@ z - + @@ -2335,7 +2335,7 @@ z - + @@ -2348,7 +2348,7 @@ z - + @@ -2390,7 +2390,7 @@ z - + @@ -2405,7 +2405,7 @@ z - + @@ -2579,1289 +2579,1282 @@ z " style="fill: none"/> - - - - - - - - - - + + + + + + + + + + - + @@ -3874,7 +3867,7 @@ L 421.2 207.880397 - + @@ -3888,7 +3881,7 @@ L 421.2 207.880397 - + @@ -3905,12 +3898,12 @@ L 421.2 207.880397 - + - + @@ -3919,12 +3912,12 @@ L 421.2 207.880397 - + - + @@ -3932,12 +3925,12 @@ L 421.2 207.880397 - + - + @@ -3945,12 +3938,12 @@ L 421.2 207.880397 - + - + + - + - + diff --git a/master/_static/fig/guide/unsupervised/outlier/kmeans-light.svg b/master/_static/fig/guide/unsupervised/outlier/kmeans-light.svg index aac61fde29..7e713235de 100644 --- a/master/_static/fig/guide/unsupervised/outlier/kmeans-light.svg +++ b/master/_static/fig/guide/unsupervised/outlier/kmeans-light.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:52:10.996273 + 2023-10-13T12:01:24.290880 image/svg+xml @@ -41,1783 +41,1783 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - + @@ -1864,7 +1864,7 @@ z - + @@ -1894,7 +1894,7 @@ z - + @@ -1930,7 +1930,7 @@ z - + @@ -1943,7 +1943,7 @@ z - + @@ -1956,7 +1956,7 @@ z - + @@ -2005,12 +2005,12 @@ z - - + @@ -2024,7 +2024,7 @@ L -3.5 0 - + @@ -2037,7 +2037,7 @@ L -3.5 0 - + @@ -2279,7 +2279,7 @@ L 90.418864 239.96 L 90.418864 235.865085 L 44.700682 235.865085 z -" clip-path="url(#p9c8510d7e8)" style="fill: #b301b3"/> +" clip-path="url(#pb1df62e54a)" style="fill: #b301b3"/> +" clip-path="url(#pb1df62e54a)" style="fill: #e8e467"/> - + @@ -2307,7 +2307,7 @@ z - + @@ -2320,7 +2320,7 @@ z - + @@ -2335,7 +2335,7 @@ z - + @@ -2348,7 +2348,7 @@ z - + @@ -2390,7 +2390,7 @@ z - + @@ -2405,7 +2405,7 @@ z - + @@ -2579,1289 +2579,1282 @@ z " style="fill: none"/> - - - - - - - - - - + + + + + + + + + + - + @@ -3874,7 +3867,7 @@ L 421.2 207.880397 - + @@ -3888,7 +3881,7 @@ L 421.2 207.880397 - + @@ -3905,12 +3898,12 @@ L 421.2 207.880397 - + - + @@ -3919,12 +3912,12 @@ L 421.2 207.880397 - + - + @@ -3932,12 +3925,12 @@ L 421.2 207.880397 - + - + @@ -3945,12 +3938,12 @@ L 421.2 207.880397 - + - + + - + - + diff --git a/master/_static/fig/guide/unsupervised/outlier/majority-dark.svg b/master/_static/fig/guide/unsupervised/outlier/majority-dark.svg index 8d6801d382..ca3304def7 100644 --- a/master/_static/fig/guide/unsupervised/outlier/majority-dark.svg +++ b/master/_static/fig/guide/unsupervised/outlier/majority-dark.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:52:09.908580 + 2023-10-13T12:01:23.211557 image/svg+xml @@ -41,1303 +41,1303 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + - - + @@ -1384,7 +1384,7 @@ z - + @@ -1414,7 +1414,7 @@ z - + @@ -1450,7 +1450,7 @@ z - + @@ -1463,7 +1463,7 @@ z - + @@ -1476,7 +1476,7 @@ z - + @@ -1525,12 +1525,12 @@ z - - + @@ -1544,7 +1544,7 @@ L -3.5 0 - + @@ -1557,7 +1557,7 @@ L -3.5 0 - + @@ -1799,7 +1799,7 @@ L 90.49513 239.96 L 90.49513 235.803441 L 44.788636 235.803441 z -" clip-path="url(#pa0db33546c)" style="fill: #b301b3"/> +" clip-path="url(#p1190047142)" style="fill: #b301b3"/> +" clip-path="url(#p1190047142)" style="fill: #e8e467"/> - + @@ -1827,7 +1827,7 @@ z - + @@ -1840,7 +1840,7 @@ z - + @@ -1855,7 +1855,7 @@ z - + @@ -1868,7 +1868,7 @@ z - + @@ -1883,7 +1883,7 @@ z - + @@ -1898,7 +1898,7 @@ z - + @@ -2060,1294 +2060,1294 @@ z " style="fill: none"/> - - - - - - - - - - + + + + + + + + + + - + @@ -3360,7 +3360,7 @@ L 421.2 211.767872 - + @@ -3401,7 +3401,7 @@ z - + @@ -3418,12 +3418,12 @@ z - + - + @@ -3432,12 +3432,12 @@ z - + - + @@ -3445,12 +3445,12 @@ z - + - + @@ -3643,13 +3643,13 @@ L 384.689062 183.176563 - + - + - + diff --git a/master/_static/fig/guide/unsupervised/outlier/majority-light.svg b/master/_static/fig/guide/unsupervised/outlier/majority-light.svg index 59a6900ad4..54e1005d75 100644 --- a/master/_static/fig/guide/unsupervised/outlier/majority-light.svg +++ b/master/_static/fig/guide/unsupervised/outlier/majority-light.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:52:09.578075 + 2023-10-13T12:01:22.886420 image/svg+xml @@ -41,1303 +41,1303 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + - - + @@ -1384,7 +1384,7 @@ z - + @@ -1414,7 +1414,7 @@ z - + @@ -1450,7 +1450,7 @@ z - + @@ -1463,7 +1463,7 @@ z - + @@ -1476,7 +1476,7 @@ z - + @@ -1525,12 +1525,12 @@ z - - + @@ -1544,7 +1544,7 @@ L -3.5 0 - + @@ -1557,7 +1557,7 @@ L -3.5 0 - + @@ -1799,7 +1799,7 @@ L 90.49513 239.96 L 90.49513 235.803441 L 44.788636 235.803441 z -" clip-path="url(#p33180634c2)" style="fill: #b301b3"/> +" clip-path="url(#p5d0e3288fb)" style="fill: #b301b3"/> +" clip-path="url(#p5d0e3288fb)" style="fill: #e8e467"/> - + @@ -1827,7 +1827,7 @@ z - + @@ -1840,7 +1840,7 @@ z - + @@ -1855,7 +1855,7 @@ z - + @@ -1868,7 +1868,7 @@ z - + @@ -1883,7 +1883,7 @@ z - + @@ -1898,7 +1898,7 @@ z - + @@ -2060,1294 +2060,1294 @@ z " style="fill: none"/> - - - - - - - - - - + + + + + + + + + + - + @@ -3360,7 +3360,7 @@ L 421.2 211.767872 - + @@ -3401,7 +3401,7 @@ z - + @@ -3418,12 +3418,12 @@ z - + - + @@ -3432,12 +3432,12 @@ z - + - + @@ -3445,12 +3445,12 @@ z - + - + @@ -3643,13 +3643,13 @@ L 384.689062 183.176563 - + - + - + diff --git a/master/_static/fig/guide/unsupervised/outlier/minority-dark.svg b/master/_static/fig/guide/unsupervised/outlier/minority-dark.svg index 55a8178e82..2d48134240 100644 --- a/master/_static/fig/guide/unsupervised/outlier/minority-dark.svg +++ b/master/_static/fig/guide/unsupervised/outlier/minority-dark.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:52:08.820994 + 2023-10-13T12:01:22.145465 image/svg+xml @@ -41,1628 +41,1628 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - + @@ -1709,7 +1709,7 @@ z - + @@ -1739,7 +1739,7 @@ z - + @@ -1775,7 +1775,7 @@ z - + @@ -1788,7 +1788,7 @@ z - + @@ -1801,7 +1801,7 @@ z - + @@ -1850,12 +1850,12 @@ z - - + @@ -1869,7 +1869,7 @@ L -3.5 0 - + @@ -1882,7 +1882,7 @@ L -3.5 0 - + @@ -2124,7 +2124,7 @@ L 90.49513 239.96 L 90.49513 235.933333 L 44.788636 235.933333 z -" clip-path="url(#pc3e27d8934)" style="fill: #b301b3"/> +" clip-path="url(#p3a693a788c)" style="fill: #b301b3"/> +" clip-path="url(#p3a693a788c)" style="fill: #e8e467"/> - + @@ -2152,7 +2152,7 @@ z - + @@ -2165,7 +2165,7 @@ z - + @@ -2180,7 +2180,7 @@ z - + @@ -2193,7 +2193,7 @@ z - + @@ -2208,7 +2208,7 @@ z - + @@ -2244,7 +2244,7 @@ z - + @@ -2438,1287 +2438,1284 @@ z " style="fill: none"/> - - - - - - - - - - + + + + + + + + + + - + @@ -3731,7 +3728,7 @@ L 421.2 202.120154 - + @@ -3772,7 +3769,7 @@ z - + @@ -3789,12 +3786,12 @@ z - + - + @@ -3803,12 +3800,12 @@ z - + - + @@ -3816,12 +3813,12 @@ z - + - + @@ -3829,12 +3826,12 @@ z - + - + @@ -4027,13 +4024,13 @@ L 384.689062 183.176563 - + - + - + diff --git a/master/_static/fig/guide/unsupervised/outlier/minority-light.svg b/master/_static/fig/guide/unsupervised/outlier/minority-light.svg index 0d21656752..b13700ce35 100644 --- a/master/_static/fig/guide/unsupervised/outlier/minority-light.svg +++ b/master/_static/fig/guide/unsupervised/outlier/minority-light.svg @@ -6,7 +6,7 @@ - 2023-10-12T13:52:08.467776 + 2023-10-13T12:01:21.807088 image/svg+xml @@ -41,1628 +41,1628 @@ z - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - + @@ -1709,7 +1709,7 @@ z - + @@ -1739,7 +1739,7 @@ z - + @@ -1775,7 +1775,7 @@ z - + @@ -1788,7 +1788,7 @@ z - + @@ -1801,7 +1801,7 @@ z - + @@ -1850,12 +1850,12 @@ z - - + @@ -1869,7 +1869,7 @@ L -3.5 0 - + @@ -1882,7 +1882,7 @@ L -3.5 0 - + @@ -2124,7 +2124,7 @@ L 90.49513 239.96 L 90.49513 235.933333 L 44.788636 235.933333 z -" clip-path="url(#pe1c92368bf)" style="fill: #b301b3"/> +" clip-path="url(#p81ecc11f56)" style="fill: #b301b3"/> +" clip-path="url(#p81ecc11f56)" style="fill: #e8e467"/> - + @@ -2152,7 +2152,7 @@ z - + @@ -2165,7 +2165,7 @@ z - + @@ -2180,7 +2180,7 @@ z - + @@ -2193,7 +2193,7 @@ z - + @@ -2208,7 +2208,7 @@ z - + @@ -2244,7 +2244,7 @@ z - + @@ -2438,1287 +2438,1284 @@ z " style="fill: none"/> - - - - - - - - - - + + + + + + + + + + - + @@ -3731,7 +3728,7 @@ L 421.2 202.120154 - + @@ -3772,7 +3769,7 @@ z - + @@ -3789,12 +3786,12 @@ z - + - + @@ -3803,12 +3800,12 @@ z - + - + @@ -3816,12 +3813,12 @@ z - + - + @@ -3829,12 +3826,12 @@ z - + - + @@ -4027,13 +4024,13 @@ L 384.689062 183.176563 - + - + - + diff --git a/master/api/index.html b/master/api/index.html index b067e4927d..8f102d540d 100644 --- a/master/api/index.html +++ b/master/api/index.html @@ -6,7 +6,7 @@ - wildboar - Wildboar 1.1.1.dev181 documentation + wildboar - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/annotate/_motifs/index.html b/master/api/wildboar/annotate/_motifs/index.html index 2c4f9a17f6..0bb83d91b0 100644 --- a/master/api/wildboar/annotate/_motifs/index.html +++ b/master/api/wildboar/annotate/_motifs/index.html @@ -6,7 +6,7 @@ - wildboar.annotate._motifs - Wildboar 1.1.1.dev181 documentation + wildboar.annotate._motifs - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/annotate/_segment/index.html b/master/api/wildboar/annotate/_segment/index.html index ed851c0c85..0c2d23e41a 100644 --- a/master/api/wildboar/annotate/_segment/index.html +++ b/master/api/wildboar/annotate/_segment/index.html @@ -6,7 +6,7 @@ - wildboar.annotate._segment - Wildboar 1.1.1.dev181 documentation + wildboar.annotate._segment - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/annotate/index.html b/master/api/wildboar/annotate/index.html index 15492e3af4..0459026764 100644 --- a/master/api/wildboar/annotate/index.html +++ b/master/api/wildboar/annotate/index.html @@ -6,7 +6,7 @@ - wildboar.annotate - Wildboar 1.1.1.dev181 documentation + wildboar.annotate - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/base/index.html b/master/api/wildboar/base/index.html index 08cf8b4adb..4abf0fe985 100644 --- a/master/api/wildboar/base/index.html +++ b/master/api/wildboar/base/index.html @@ -6,7 +6,7 @@ - wildboar.base - Wildboar 1.1.1.dev181 documentation + wildboar.base - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/datasets/_filter/index.html b/master/api/wildboar/datasets/_filter/index.html index 20c561cb8b..9cf96e825c 100644 --- a/master/api/wildboar/datasets/_filter/index.html +++ b/master/api/wildboar/datasets/_filter/index.html @@ -6,7 +6,7 @@ - wildboar.datasets._filter - Wildboar 1.1.1.dev181 documentation + wildboar.datasets._filter - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/datasets/_repository/index.html b/master/api/wildboar/datasets/_repository/index.html index a153b404c7..06bb267236 100644 --- a/master/api/wildboar/datasets/_repository/index.html +++ b/master/api/wildboar/datasets/_repository/index.html @@ -6,7 +6,7 @@ - wildboar.datasets._repository - Wildboar 1.1.1.dev181 documentation + wildboar.datasets._repository - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/datasets/index.html b/master/api/wildboar/datasets/index.html index c3dcbe4018..2002a03638 100644 --- a/master/api/wildboar/datasets/index.html +++ b/master/api/wildboar/datasets/index.html @@ -6,7 +6,7 @@ - wildboar.datasets - Wildboar 1.1.1.dev181 documentation + wildboar.datasets - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/datasets/outlier/index.html b/master/api/wildboar/datasets/outlier/index.html index 2cb7daa78c..0a9aa087a1 100644 --- a/master/api/wildboar/datasets/outlier/index.html +++ b/master/api/wildboar/datasets/outlier/index.html @@ -6,7 +6,7 @@ - wildboar.datasets.outlier - Wildboar 1.1.1.dev181 documentation + wildboar.datasets.outlier - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/datasets/preprocess/index.html b/master/api/wildboar/datasets/preprocess/index.html index 3cbcf2d4f6..4d9a6e8b91 100644 --- a/master/api/wildboar/datasets/preprocess/index.html +++ b/master/api/wildboar/datasets/preprocess/index.html @@ -6,7 +6,7 @@ - wildboar.datasets.preprocess - Wildboar 1.1.1.dev181 documentation + wildboar.datasets.preprocess - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/distance/_distance/index.html b/master/api/wildboar/distance/_distance/index.html index 05ef65c993..49ae8d80dd 100644 --- a/master/api/wildboar/distance/_distance/index.html +++ b/master/api/wildboar/distance/_distance/index.html @@ -6,7 +6,7 @@ - wildboar.distance._distance - Wildboar 1.1.1.dev181 documentation + wildboar.distance._distance - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/distance/_matrix_profile/index.html b/master/api/wildboar/distance/_matrix_profile/index.html index 539c9d22c0..1e88187ea3 100644 --- a/master/api/wildboar/distance/_matrix_profile/index.html +++ b/master/api/wildboar/distance/_matrix_profile/index.html @@ -6,7 +6,7 @@ - wildboar.distance._matrix_profile - Wildboar 1.1.1.dev181 documentation + wildboar.distance._matrix_profile - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/distance/_multi_metric/index.html b/master/api/wildboar/distance/_multi_metric/index.html index 11a92ed47e..6628ae4bf0 100644 --- a/master/api/wildboar/distance/_multi_metric/index.html +++ b/master/api/wildboar/distance/_multi_metric/index.html @@ -6,7 +6,7 @@ - wildboar.distance._multi_metric - Wildboar 1.1.1.dev181 documentation + wildboar.distance._multi_metric - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/distance/_neighbors/index.html b/master/api/wildboar/distance/_neighbors/index.html index bc6c342958..84638629f3 100644 --- a/master/api/wildboar/distance/_neighbors/index.html +++ b/master/api/wildboar/distance/_neighbors/index.html @@ -6,7 +6,7 @@ - wildboar.distance._neighbors - Wildboar 1.1.1.dev181 documentation + wildboar.distance._neighbors - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
@@ -336,7 +336,7 @@

Classes
-class wildboar.distance._neighbors.KMeans(n_clusters=8, *, metric='euclidean', r=1.0, g=None, init='random', n_init='auto', max_iter=300, tol=0.001, verbose=0, random_state=None)[source]#
+class wildboar.distance._neighbors.KMeans(n_clusters=8, *, metric='euclidean', r=1.0, g=None, init='random', n_init='auto', max_iter=300, tol=0.001, verbose=0, random_state=None)[source]#

KMeans clustering with support for DTW and weighted DTW.

Parameters:
@@ -377,7 +377,7 @@

Classes
-fit(x, y=None)[source]#
+fit(x, y=None)[source]#

Compute the kmeans-clustering.

Parameters:
@@ -485,7 +485,7 @@

Classes
-predict(x)[source]#
+predict(x)[source]#

Predict the closest cluster for each sample.

Parameters:
@@ -578,7 +578,7 @@

Classes
-class wildboar.distance._neighbors.KMedoids(n_clusters=8, metric='euclidean', metric_params=None, init='random', n_init='auto', algorithm='fast', max_iter=30, tol=0.0001, verbose=0, n_jobs=None, random_state=None)[source]#
+class wildboar.distance._neighbors.KMedoids(n_clusters=8, metric='euclidean', metric_params=None, init='random', n_init='auto', algorithm='fast', max_iter=30, tol=0.0001, verbose=0, n_jobs=None, random_state=None)[source]#

KMedoid algorithm.

Parameters:
@@ -628,7 +628,7 @@

Classes
-fit(x, y=None)[source]#
+fit(x, y=None)[source]#

Compute the kmedoids-clustering.

Parameters:
@@ -736,7 +736,7 @@

Classes
-predict(x)[source]#
+predict(x)[source]#

Predict the closest cluster for each sample.

Parameters:
@@ -829,7 +829,7 @@

Classes
-class wildboar.distance._neighbors.KNeighborsClassifier(n_neighbors=5, *, metric='euclidean', metric_params=None)[source]#
+class wildboar.distance._neighbors.KNeighborsClassifier(n_neighbors=5, *, metric='euclidean', metric_params=None)[source]#

Classifier implementing k-nearest neighbors.

Parameters:
@@ -853,7 +853,7 @@

Classes
-fit(x, y)[source]#
+fit(x, y)[source]#

Fit the classifier to the training data.

Parameters:
@@ -913,7 +913,7 @@

Classes
-predict(x)[source]#
+predict(x)[source]#

Compute the class label for the samples in x.

Parameters:
@@ -933,7 +933,7 @@

Classes
-predict_proba(x)[source]#
+predict_proba(x)[source]#

Compute probability estimates for the samples in x.

Parameters:
diff --git a/master/api/wildboar/distance/dtw/index.html b/master/api/wildboar/distance/dtw/index.html index 9028ebb53a..6279d7df93 100644 --- a/master/api/wildboar/distance/dtw/index.html +++ b/master/api/wildboar/distance/dtw/index.html @@ -6,7 +6,7 @@ - wildboar.distance.dtw - Wildboar 1.1.1.dev181 documentation + wildboar.distance.dtw - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@

-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/distance/index.html b/master/api/wildboar/distance/index.html index f913a23937..00912247ef 100644 --- a/master/api/wildboar/distance/index.html +++ b/master/api/wildboar/distance/index.html @@ -6,7 +6,7 @@ - wildboar.distance - Wildboar 1.1.1.dev181 documentation + wildboar.distance - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
@@ -379,7 +379,7 @@

Functions
-class wildboar.distance.KMeans(n_clusters=8, *, metric='euclidean', r=1.0, g=None, init='random', n_init='auto', max_iter=300, tol=0.001, verbose=0, random_state=None)[source]#
+class wildboar.distance.KMeans(n_clusters=8, *, metric='euclidean', r=1.0, g=None, init='random', n_init='auto', max_iter=300, tol=0.001, verbose=0, random_state=None)[source]#

KMeans clustering with support for DTW and weighted DTW.

Parameters:
@@ -420,7 +420,7 @@

Functions
-fit(x, y=None)[source]#
+fit(x, y=None)[source]#

Compute the kmeans-clustering.

Parameters:
@@ -528,7 +528,7 @@

Functions
-predict(x)[source]#
+predict(x)[source]#

Predict the closest cluster for each sample.

Parameters:
@@ -621,7 +621,7 @@

Functions
-class wildboar.distance.KMedoids(n_clusters=8, metric='euclidean', metric_params=None, init='random', n_init='auto', algorithm='fast', max_iter=30, tol=0.0001, verbose=0, n_jobs=None, random_state=None)[source]#
+class wildboar.distance.KMedoids(n_clusters=8, metric='euclidean', metric_params=None, init='random', n_init='auto', algorithm='fast', max_iter=30, tol=0.0001, verbose=0, n_jobs=None, random_state=None)[source]#

KMedoid algorithm.

Parameters:
@@ -671,7 +671,7 @@

Functions
-fit(x, y=None)[source]#
+fit(x, y=None)[source]#

Compute the kmedoids-clustering.

Parameters:
@@ -779,7 +779,7 @@

Functions
-predict(x)[source]#
+predict(x)[source]#

Predict the closest cluster for each sample.

Parameters:
@@ -872,7 +872,7 @@

Functions
-class wildboar.distance.KNeighborsClassifier(n_neighbors=5, *, metric='euclidean', metric_params=None)[source]#
+class wildboar.distance.KNeighborsClassifier(n_neighbors=5, *, metric='euclidean', metric_params=None)[source]#

Classifier implementing k-nearest neighbors.

Parameters:
@@ -896,7 +896,7 @@

Functions
-fit(x, y)[source]#
+fit(x, y)[source]#

Fit the classifier to the training data.

Parameters:
@@ -956,7 +956,7 @@

Functions
-predict(x)[source]#
+predict(x)[source]#

Compute the class label for the samples in x.

Parameters:
@@ -976,7 +976,7 @@

Functions
-predict_proba(x)[source]#
+predict_proba(x)[source]#

Compute probability estimates for the samples in x.

Parameters:
diff --git a/master/api/wildboar/ensemble/_ensemble/index.html b/master/api/wildboar/ensemble/_ensemble/index.html index ffd7809e9c..d6bdf30a52 100644 --- a/master/api/wildboar/ensemble/_ensemble/index.html +++ b/master/api/wildboar/ensemble/_ensemble/index.html @@ -6,7 +6,7 @@ - wildboar.ensemble._ensemble - Wildboar 1.1.1.dev181 documentation + wildboar.ensemble._ensemble - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@

-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/ensemble/index.html b/master/api/wildboar/ensemble/index.html index 3522352bac..d4389d267f 100644 --- a/master/api/wildboar/ensemble/index.html +++ b/master/api/wildboar/ensemble/index.html @@ -6,7 +6,7 @@ - wildboar.ensemble - Wildboar 1.1.1.dev181 documentation + wildboar.ensemble - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/explain/_importance/index.html b/master/api/wildboar/explain/_importance/index.html index efda2c85fe..777b8d7b39 100644 --- a/master/api/wildboar/explain/_importance/index.html +++ b/master/api/wildboar/explain/_importance/index.html @@ -6,7 +6,7 @@ - wildboar.explain._importance - Wildboar 1.1.1.dev181 documentation + wildboar.explain._importance - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/explain/counterfactual/_helper/index.html b/master/api/wildboar/explain/counterfactual/_helper/index.html index d7004675cc..9eb4a8c724 100644 --- a/master/api/wildboar/explain/counterfactual/_helper/index.html +++ b/master/api/wildboar/explain/counterfactual/_helper/index.html @@ -6,7 +6,7 @@ - wildboar.explain.counterfactual._helper - Wildboar 1.1.1.dev181 documentation + wildboar.explain.counterfactual._helper - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
@@ -330,7 +330,7 @@

Functions
-wildboar.explain.counterfactual._helper.counterfactuals(estimator, x, y, *, train_x=None, train_y=None, method='best', scoring='deprecated', valid_scoring='deprecated', proximity=None, random_state=None, method_args=None)[source]#
+wildboar.explain.counterfactual._helper.counterfactuals(estimator, x, y, *, train_x=None, train_y=None, method='best', scoring='deprecated', valid_scoring='deprecated', proximity=None, random_state=None, method_args=None)[source]#

Compute a single counterfactual example for each sample.

Parameters:
diff --git a/master/api/wildboar/explain/counterfactual/_nn/index.html b/master/api/wildboar/explain/counterfactual/_nn/index.html index 55b08c5d4a..0cdc09aa27 100644 --- a/master/api/wildboar/explain/counterfactual/_nn/index.html +++ b/master/api/wildboar/explain/counterfactual/_nn/index.html @@ -6,7 +6,7 @@ - wildboar.explain.counterfactual._nn - Wildboar 1.1.1.dev181 documentation + wildboar.explain.counterfactual._nn - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@

-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
@@ -330,8 +330,30 @@

Classes
-class wildboar.explain.counterfactual._nn.KNeighborsCounterfactual(random_state=None)[source]#
+class wildboar.explain.counterfactual._nn.KNeighborsCounterfactual(method='auto', random_state=None)[source]#

Fit a counterfactual explainer to a k-nearest neighbors classifier.

+
+
Parameters:
+
+
method{“auto”, “mean”, “medoid”}, optional

The method for generating counterfactuals. If ‘auto’, counterfactuals +are generated using k-means if possible and k-medoids otherwise. If +‘mean’, counterfactuals are always generated using k-means, which fails +if the estimator is fitted with a metric other than ‘euclidean’, ‘dtw’ +or ‘wdtw. If ‘medoid’, counterfactuals are generated using k-medoids.

+
+

New in version 1.2.

+
+
+
random_stateint or RandomState, optional
    +

  • If int, random_state is the seed used by the random number generator.

    • +

  • If RandomState instance, random_state is the random number generator.

    • +

  • If None, the random number generator is the RandomState instance used +by np.random.

    • +
+
+
+
+

References

Karlsson, I., Rebane, J., Papapetrou, P., & Gionis, A. (2020).

Locally and globally explainable time series tweaking. diff --git a/master/api/wildboar/explain/counterfactual/_proto/index.html b/master/api/wildboar/explain/counterfactual/_proto/index.html index 7f29ca46f0..8ee1f68dbc 100644 --- a/master/api/wildboar/explain/counterfactual/_proto/index.html +++ b/master/api/wildboar/explain/counterfactual/_proto/index.html @@ -6,7 +6,7 @@ - wildboar.explain.counterfactual._proto - Wildboar 1.1.1.dev181 documentation + wildboar.explain.counterfactual._proto - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@

-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/explain/counterfactual/_sf/index.html b/master/api/wildboar/explain/counterfactual/_sf/index.html index 99f5983e00..cc88c3a279 100644 --- a/master/api/wildboar/explain/counterfactual/_sf/index.html +++ b/master/api/wildboar/explain/counterfactual/_sf/index.html @@ -6,7 +6,7 @@ - wildboar.explain.counterfactual._sf - Wildboar 1.1.1.dev181 documentation + wildboar.explain.counterfactual._sf - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/explain/counterfactual/index.html b/master/api/wildboar/explain/counterfactual/index.html index 3b675c7f60..bca9829482 100644 --- a/master/api/wildboar/explain/counterfactual/index.html +++ b/master/api/wildboar/explain/counterfactual/index.html @@ -6,7 +6,7 @@ - wildboar.explain.counterfactual - Wildboar 1.1.1.dev181 documentation + wildboar.explain.counterfactual - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
@@ -354,8 +354,30 @@

Functions
-class wildboar.explain.counterfactual.KNeighborsCounterfactual(random_state=None)[source]#
+class wildboar.explain.counterfactual.KNeighborsCounterfactual(method='auto', random_state=None)[source]#

Fit a counterfactual explainer to a k-nearest neighbors classifier.

+
+
Parameters:
+
+
method{“auto”, “mean”, “medoid”}, optional

The method for generating counterfactuals. If ‘auto’, counterfactuals +are generated using k-means if possible and k-medoids otherwise. If +‘mean’, counterfactuals are always generated using k-means, which fails +if the estimator is fitted with a metric other than ‘euclidean’, ‘dtw’ +or ‘wdtw. If ‘medoid’, counterfactuals are generated using k-medoids.

+
+

New in version 1.2.

+
+
+
random_stateint or RandomState, optional
    +

  • If int, random_state is the seed used by the random number generator.

    • +

  • If RandomState instance, random_state is the random number generator.

    • +

  • If None, the random number generator is the RandomState instance used +by np.random.

    • +
+
+
+
+

References

Karlsson, I., Rebane, J., Papapetrou, P., & Gionis, A. (2020).

Locally and globally explainable time series tweaking. @@ -830,7 +852,7 @@

Functions
-wildboar.explain.counterfactual.counterfactuals(estimator, x, y, *, train_x=None, train_y=None, method='best', scoring='deprecated', valid_scoring='deprecated', proximity=None, random_state=None, method_args=None)[source]#
+wildboar.explain.counterfactual.counterfactuals(estimator, x, y, *, train_x=None, train_y=None, method='best', scoring='deprecated', valid_scoring='deprecated', proximity=None, random_state=None, method_args=None)[source]#

Compute a single counterfactual example for each sample.

Parameters:
diff --git a/master/api/wildboar/explain/index.html b/master/api/wildboar/explain/index.html index 2d201e6393..20507c4401 100644 --- a/master/api/wildboar/explain/index.html +++ b/master/api/wildboar/explain/index.html @@ -6,7 +6,7 @@ - wildboar.explain - Wildboar 1.1.1.dev181 documentation + wildboar.explain - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@

-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/index.html b/master/api/wildboar/index.html index eff5df938d..00601e7766 100644 --- a/master/api/wildboar/index.html +++ b/master/api/wildboar/index.html @@ -6,7 +6,7 @@ - wildboar - Wildboar 1.1.1.dev181 documentation + wildboar - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/linear_model/_hydra/index.html b/master/api/wildboar/linear_model/_hydra/index.html index c5b5f2ca9a..71f8b088ec 100644 --- a/master/api/wildboar/linear_model/_hydra/index.html +++ b/master/api/wildboar/linear_model/_hydra/index.html @@ -6,7 +6,7 @@ - wildboar.linear_model._hydra - Wildboar 1.1.1.dev181 documentation + wildboar.linear_model._hydra - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/linear_model/_rocket/index.html b/master/api/wildboar/linear_model/_rocket/index.html index 314ff5873d..c4cedeb0df 100644 --- a/master/api/wildboar/linear_model/_rocket/index.html +++ b/master/api/wildboar/linear_model/_rocket/index.html @@ -6,7 +6,7 @@ - wildboar.linear_model._rocket - Wildboar 1.1.1.dev181 documentation + wildboar.linear_model._rocket - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/linear_model/_shapelet/index.html b/master/api/wildboar/linear_model/_shapelet/index.html index b105a77139..9ebaf4342e 100644 --- a/master/api/wildboar/linear_model/_shapelet/index.html +++ b/master/api/wildboar/linear_model/_shapelet/index.html @@ -6,7 +6,7 @@ - wildboar.linear_model._shapelet - Wildboar 1.1.1.dev181 documentation + wildboar.linear_model._shapelet - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/linear_model/_transform/index.html b/master/api/wildboar/linear_model/_transform/index.html index dd7c81e5b7..54f44b0175 100644 --- a/master/api/wildboar/linear_model/_transform/index.html +++ b/master/api/wildboar/linear_model/_transform/index.html @@ -6,7 +6,7 @@ - wildboar.linear_model._transform - Wildboar 1.1.1.dev181 documentation + wildboar.linear_model._transform - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/linear_model/index.html b/master/api/wildboar/linear_model/index.html index e7dc0a9389..330f112351 100644 --- a/master/api/wildboar/linear_model/index.html +++ b/master/api/wildboar/linear_model/index.html @@ -6,7 +6,7 @@ - wildboar.linear_model - Wildboar 1.1.1.dev181 documentation + wildboar.linear_model - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/metrics/_cluster/index.html b/master/api/wildboar/metrics/_cluster/index.html index f0a626623c..20787f5b8f 100644 --- a/master/api/wildboar/metrics/_cluster/index.html +++ b/master/api/wildboar/metrics/_cluster/index.html @@ -6,7 +6,7 @@ - wildboar.metrics._cluster - Wildboar 1.1.1.dev181 documentation + wildboar.metrics._cluster - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/metrics/_counterfactual/index.html b/master/api/wildboar/metrics/_counterfactual/index.html index 3b002dfcc3..94d11c70fa 100644 --- a/master/api/wildboar/metrics/_counterfactual/index.html +++ b/master/api/wildboar/metrics/_counterfactual/index.html @@ -6,7 +6,7 @@ - wildboar.metrics._counterfactual - Wildboar 1.1.1.dev181 documentation + wildboar.metrics._counterfactual - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/metrics/index.html b/master/api/wildboar/metrics/index.html index 395ec0bfdc..680cfadbd2 100644 --- a/master/api/wildboar/metrics/index.html +++ b/master/api/wildboar/metrics/index.html @@ -6,7 +6,7 @@ - wildboar.metrics - Wildboar 1.1.1.dev181 documentation + wildboar.metrics - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/model_selection/_cv/index.html b/master/api/wildboar/model_selection/_cv/index.html index 673962c64a..a9efa93abb 100644 --- a/master/api/wildboar/model_selection/_cv/index.html +++ b/master/api/wildboar/model_selection/_cv/index.html @@ -6,7 +6,7 @@ - wildboar.model_selection._cv - Wildboar 1.1.1.dev181 documentation + wildboar.model_selection._cv - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/model_selection/_outlier/index.html b/master/api/wildboar/model_selection/_outlier/index.html index bd93e2dc03..7caaf9ffce 100644 --- a/master/api/wildboar/model_selection/_outlier/index.html +++ b/master/api/wildboar/model_selection/_outlier/index.html @@ -6,7 +6,7 @@ - wildboar.model_selection._outlier - Wildboar 1.1.1.dev181 documentation + wildboar.model_selection._outlier - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/model_selection/index.html b/master/api/wildboar/model_selection/index.html index 484c8f060f..41c15b814e 100644 --- a/master/api/wildboar/model_selection/index.html +++ b/master/api/wildboar/model_selection/index.html @@ -6,7 +6,7 @@ - wildboar.model_selection - Wildboar 1.1.1.dev181 documentation + wildboar.model_selection - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/transform/_base/index.html b/master/api/wildboar/transform/_base/index.html index 4fdbb9c424..e874808588 100644 --- a/master/api/wildboar/transform/_base/index.html +++ b/master/api/wildboar/transform/_base/index.html @@ -6,7 +6,7 @@ - wildboar.transform._base - Wildboar 1.1.1.dev181 documentation + wildboar.transform._base - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/transform/_conv/index.html b/master/api/wildboar/transform/_conv/index.html index a89547f503..19aef7fc11 100644 --- a/master/api/wildboar/transform/_conv/index.html +++ b/master/api/wildboar/transform/_conv/index.html @@ -6,7 +6,7 @@ - wildboar.transform._conv - Wildboar 1.1.1.dev181 documentation + wildboar.transform._conv - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/transform/_diff/index.html b/master/api/wildboar/transform/_diff/index.html index 868793706e..d266b5a794 100644 --- a/master/api/wildboar/transform/_diff/index.html +++ b/master/api/wildboar/transform/_diff/index.html @@ -6,7 +6,7 @@ - wildboar.transform._diff - Wildboar 1.1.1.dev181 documentation + wildboar.transform._diff - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/transform/_hydra/index.html b/master/api/wildboar/transform/_hydra/index.html index 6cdbb7161b..ca6b26fbc7 100644 --- a/master/api/wildboar/transform/_hydra/index.html +++ b/master/api/wildboar/transform/_hydra/index.html @@ -6,7 +6,7 @@ - wildboar.transform._hydra - Wildboar 1.1.1.dev181 documentation + wildboar.transform._hydra - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/transform/_interval/index.html b/master/api/wildboar/transform/_interval/index.html index d7f7d323cf..539ebc579a 100644 --- a/master/api/wildboar/transform/_interval/index.html +++ b/master/api/wildboar/transform/_interval/index.html @@ -6,7 +6,7 @@ - wildboar.transform._interval - Wildboar 1.1.1.dev181 documentation + wildboar.transform._interval - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/transform/_matrix_profile/index.html b/master/api/wildboar/transform/_matrix_profile/index.html index 3e4c6a80ed..624fc3e53a 100644 --- a/master/api/wildboar/transform/_matrix_profile/index.html +++ b/master/api/wildboar/transform/_matrix_profile/index.html @@ -6,7 +6,7 @@ - wildboar.transform._matrix_profile - Wildboar 1.1.1.dev181 documentation + wildboar.transform._matrix_profile - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/transform/_pivot/index.html b/master/api/wildboar/transform/_pivot/index.html index f472b5a5d1..587096181d 100644 --- a/master/api/wildboar/transform/_pivot/index.html +++ b/master/api/wildboar/transform/_pivot/index.html @@ -6,7 +6,7 @@ - wildboar.transform._pivot - Wildboar 1.1.1.dev181 documentation + wildboar.transform._pivot - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/transform/_rocket/index.html b/master/api/wildboar/transform/_rocket/index.html index 9d17833bed..9ea153a043 100644 --- a/master/api/wildboar/transform/_rocket/index.html +++ b/master/api/wildboar/transform/_rocket/index.html @@ -6,7 +6,7 @@ - wildboar.transform._rocket - Wildboar 1.1.1.dev181 documentation + wildboar.transform._rocket - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/transform/_sax/index.html b/master/api/wildboar/transform/_sax/index.html index d7f2d7707c..0225552e8b 100644 --- a/master/api/wildboar/transform/_sax/index.html +++ b/master/api/wildboar/transform/_sax/index.html @@ -6,7 +6,7 @@ - wildboar.transform._sax - Wildboar 1.1.1.dev181 documentation + wildboar.transform._sax - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/transform/_shapelet/index.html b/master/api/wildboar/transform/_shapelet/index.html index c06724bc0d..bf7904f8c1 100644 --- a/master/api/wildboar/transform/_shapelet/index.html +++ b/master/api/wildboar/transform/_shapelet/index.html @@ -6,7 +6,7 @@ - wildboar.transform._shapelet - Wildboar 1.1.1.dev181 documentation + wildboar.transform._shapelet - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/transform/index.html b/master/api/wildboar/transform/index.html index 80ba2d1bf3..2a19653857 100644 --- a/master/api/wildboar/transform/index.html +++ b/master/api/wildboar/transform/index.html @@ -6,7 +6,7 @@ - wildboar.transform - Wildboar 1.1.1.dev181 documentation + wildboar.transform - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/tree/_base/index.html b/master/api/wildboar/tree/_base/index.html index a3709d131f..348a2efc18 100644 --- a/master/api/wildboar/tree/_base/index.html +++ b/master/api/wildboar/tree/_base/index.html @@ -6,7 +6,7 @@ - wildboar.tree._base - Wildboar 1.1.1.dev181 documentation + wildboar.tree._base - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/tree/_ptree/index.html b/master/api/wildboar/tree/_ptree/index.html index 65ce0f3736..4bf125f929 100644 --- a/master/api/wildboar/tree/_ptree/index.html +++ b/master/api/wildboar/tree/_ptree/index.html @@ -6,7 +6,7 @@ - wildboar.tree._ptree - Wildboar 1.1.1.dev181 documentation + wildboar.tree._ptree - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/tree/_tree/index.html b/master/api/wildboar/tree/_tree/index.html index 3497a14520..b5b5d9a3ef 100644 --- a/master/api/wildboar/tree/_tree/index.html +++ b/master/api/wildboar/tree/_tree/index.html @@ -6,7 +6,7 @@ - wildboar.tree._tree - Wildboar 1.1.1.dev181 documentation + wildboar.tree._tree - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/tree/index.html b/master/api/wildboar/tree/index.html index a8c78589cb..c2990d0aa2 100644 --- a/master/api/wildboar/tree/index.html +++ b/master/api/wildboar/tree/index.html @@ -6,7 +6,7 @@ - wildboar.tree - Wildboar 1.1.1.dev181 documentation + wildboar.tree - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/utils/_parallel/index.html b/master/api/wildboar/utils/_parallel/index.html index 5905a480af..0986f704ae 100644 --- a/master/api/wildboar/utils/_parallel/index.html +++ b/master/api/wildboar/utils/_parallel/index.html @@ -6,7 +6,7 @@ - wildboar.utils._parallel - Wildboar 1.1.1.dev181 documentation + wildboar.utils._parallel - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/utils/_testing/index.html b/master/api/wildboar/utils/_testing/index.html index 1a0b18603c..6aaca34029 100644 --- a/master/api/wildboar/utils/_testing/index.html +++ b/master/api/wildboar/utils/_testing/index.html @@ -6,7 +6,7 @@ - wildboar.utils._testing - Wildboar 1.1.1.dev181 documentation + wildboar.utils._testing - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/utils/decorators/index.html b/master/api/wildboar/utils/decorators/index.html index c91ec5c152..376de44e0d 100644 --- a/master/api/wildboar/utils/decorators/index.html +++ b/master/api/wildboar/utils/decorators/index.html @@ -6,7 +6,7 @@ - wildboar.utils.decorators - Wildboar 1.1.1.dev181 documentation + wildboar.utils.decorators - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/utils/estimator_checks/index.html b/master/api/wildboar/utils/estimator_checks/index.html index 25986f8b70..d987c8b1ec 100644 --- a/master/api/wildboar/utils/estimator_checks/index.html +++ b/master/api/wildboar/utils/estimator_checks/index.html @@ -6,7 +6,7 @@ - wildboar.utils.estimator_checks - Wildboar 1.1.1.dev181 documentation + wildboar.utils.estimator_checks - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/utils/index.html b/master/api/wildboar/utils/index.html index 17e92a9c77..58feccb327 100644 --- a/master/api/wildboar/utils/index.html +++ b/master/api/wildboar/utils/index.html @@ -6,7 +6,7 @@ - wildboar.utils - Wildboar 1.1.1.dev181 documentation + wildboar.utils - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/utils/plot/index.html b/master/api/wildboar/utils/plot/index.html index 75526e9bd0..3707693db0 100644 --- a/master/api/wildboar/utils/plot/index.html +++ b/master/api/wildboar/utils/plot/index.html @@ -6,7 +6,7 @@ - wildboar.utils.plot - Wildboar 1.1.1.dev181 documentation + wildboar.utils.plot - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/utils/validation/index.html b/master/api/wildboar/utils/validation/index.html index 6bc7caf774..bdb2e1ad9c 100644 --- a/master/api/wildboar/utils/validation/index.html +++ b/master/api/wildboar/utils/validation/index.html @@ -6,7 +6,7 @@ - wildboar.utils.validation - Wildboar 1.1.1.dev181 documentation + wildboar.utils.validation - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/utils/variable_len/index.html b/master/api/wildboar/utils/variable_len/index.html index 998150cd3c..04963ef517 100644 --- a/master/api/wildboar/utils/variable_len/index.html +++ b/master/api/wildboar/utils/variable_len/index.html @@ -6,7 +6,7 @@ - wildboar.utils.variable_len - Wildboar 1.1.1.dev181 documentation + wildboar.utils.variable_len - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/api/wildboar/version/index.html b/master/api/wildboar/version/index.html index 14cf92b08f..6c688aa8c0 100644 --- a/master/api/wildboar/version/index.html +++ b/master/api/wildboar/version/index.html @@ -6,7 +6,7 @@ - wildboar.version - Wildboar 1.1.1.dev181 documentation + wildboar.version - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/examples.html b/master/examples.html index 6a0ac81e28..db1bd4df0f 100644 --- a/master/examples.html +++ b/master/examples.html @@ -6,7 +6,7 @@ - Examples - Wildboar 1.1.1.dev181 documentation + Examples - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/examples/hydra.html b/master/examples/hydra.html index 6d9bae8bfc..46198eccd3 100644 --- a/master/examples/hydra.html +++ b/master/examples/hydra.html @@ -6,7 +6,7 @@ - Convolution transforms - Wildboar 1.1.1.dev181 documentation + Convolution transforms - Wildboar 1.1.1.dev185 documentation @@ -143,7 +143,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/examples/hydra.ipynb b/master/examples/hydra.ipynb index d2c624529a..199b5c7762 100644 --- a/master/examples/hydra.ipynb +++ b/master/examples/hydra.ipynb @@ -16,10 +16,10 @@ "id": "d8d8a2e4-bcdf-481f-8c12-6fb7415819ce", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:52:54.998117Z", - "iopub.status.busy": "2023-10-12T13:52:54.997691Z", - "iopub.status.idle": "2023-10-12T13:52:55.909393Z", - "shell.execute_reply": "2023-10-12T13:52:55.908483Z" + "iopub.execute_input": "2023-10-13T12:02:07.885551Z", + "iopub.status.busy": "2023-10-13T12:02:07.885055Z", + "iopub.status.idle": "2023-10-13T12:02:08.783352Z", + "shell.execute_reply": "2023-10-13T12:02:08.782415Z" } }, "outputs": [], @@ -50,10 +50,10 @@ "id": "8c35185f-81cf-494d-9266-2752ac608b99", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:52:55.914193Z", - "iopub.status.busy": "2023-10-12T13:52:55.913412Z", - "iopub.status.idle": "2023-10-12T13:52:56.314882Z", - "shell.execute_reply": "2023-10-12T13:52:56.314059Z" + "iopub.execute_input": "2023-10-13T12:02:08.787683Z", + "iopub.status.busy": "2023-10-13T12:02:08.786930Z", + "iopub.status.idle": "2023-10-13T12:02:09.185767Z", + "shell.execute_reply": "2023-10-13T12:02:09.184756Z" } }, "outputs": [], @@ -77,10 +77,10 @@ "id": "3c3e0c6f-5947-4ce0-9e7f-bc7a77441af7", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:52:56.319236Z", - "iopub.status.busy": "2023-10-12T13:52:56.318951Z", - "iopub.status.idle": "2023-10-12T13:52:56.324207Z", - "shell.execute_reply": "2023-10-12T13:52:56.323517Z" + "iopub.execute_input": "2023-10-13T12:02:09.191137Z", + "iopub.status.busy": "2023-10-13T12:02:09.190604Z", + "iopub.status.idle": "2023-10-13T12:02:09.195893Z", + "shell.execute_reply": "2023-10-13T12:02:09.195212Z" } }, "outputs": [], @@ -98,10 +98,10 @@ "id": "33c34c1d-160f-457f-9452-bb134de35722", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:52:56.328227Z", - "iopub.status.busy": "2023-10-12T13:52:56.327510Z", - "iopub.status.idle": "2023-10-12T13:53:03.045014Z", - "shell.execute_reply": "2023-10-12T13:53:03.044267Z" + "iopub.execute_input": "2023-10-13T12:02:09.199371Z", + "iopub.status.busy": "2023-10-13T12:02:09.198869Z", + "iopub.status.idle": "2023-10-13T12:02:15.787594Z", + "shell.execute_reply": "2023-10-13T12:02:15.786857Z" } }, "outputs": [ @@ -135,10 +135,10 @@ "id": "9c47dde0-0e6b-4369-b9b2-fbb57badba4a", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:53:03.048452Z", - "iopub.status.busy": "2023-10-12T13:53:03.048090Z", - "iopub.status.idle": "2023-10-12T13:53:05.172312Z", - "shell.execute_reply": "2023-10-12T13:53:05.171539Z" + "iopub.execute_input": "2023-10-13T12:02:15.791367Z", + "iopub.status.busy": "2023-10-13T12:02:15.791080Z", + "iopub.status.idle": "2023-10-13T12:02:17.843891Z", + "shell.execute_reply": "2023-10-13T12:02:17.843100Z" } }, "outputs": [ @@ -172,10 +172,10 @@ "id": "73ec6717-9347-49ef-b14c-b3cb61e75d0c", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:53:05.177868Z", - "iopub.status.busy": "2023-10-12T13:53:05.176317Z", - "iopub.status.idle": "2023-10-12T13:53:05.182151Z", - "shell.execute_reply": "2023-10-12T13:53:05.181515Z" + "iopub.execute_input": "2023-10-13T12:02:17.848387Z", + "iopub.status.busy": "2023-10-13T12:02:17.848068Z", + "iopub.status.idle": "2023-10-13T12:02:17.853101Z", + "shell.execute_reply": "2023-10-13T12:02:17.852384Z" } }, "outputs": [], @@ -193,10 +193,10 @@ "id": "6bec831d-6c7e-4e4f-b52f-7f1ebdfe77f1", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:53:05.187044Z", - "iopub.status.busy": "2023-10-12T13:53:05.185578Z", - "iopub.status.idle": "2023-10-12T13:53:11.784158Z", - "shell.execute_reply": "2023-10-12T13:53:11.783457Z" + "iopub.execute_input": "2023-10-13T12:02:17.856791Z", + "iopub.status.busy": "2023-10-13T12:02:17.856501Z", + "iopub.status.idle": "2023-10-13T12:02:24.393271Z", + "shell.execute_reply": "2023-10-13T12:02:24.392601Z" } }, "outputs": [ @@ -233,10 +233,10 @@ "id": "9663b475-c2c5-46f4-b9f4-5b8d74c64cf7", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:53:11.789534Z", - "iopub.status.busy": "2023-10-12T13:53:11.787897Z", - "iopub.status.idle": "2023-10-12T13:53:13.993528Z", - "shell.execute_reply": "2023-10-12T13:53:13.992599Z" + "iopub.execute_input": "2023-10-13T12:02:24.398450Z", + "iopub.status.busy": "2023-10-13T12:02:24.397115Z", + "iopub.status.idle": "2023-10-13T12:02:26.570663Z", + "shell.execute_reply": "2023-10-13T12:02:26.569992Z" } }, "outputs": [ @@ -271,10 +271,10 @@ "id": "bf7e66b7-db44-4c5d-83f8-e5ba2d5130ce", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:53:13.998509Z", - "iopub.status.busy": "2023-10-12T13:53:13.997785Z", - "iopub.status.idle": "2023-10-12T13:53:14.004676Z", - "shell.execute_reply": "2023-10-12T13:53:14.003922Z" + "iopub.execute_input": "2023-10-13T12:02:26.575668Z", + "iopub.status.busy": "2023-10-13T12:02:26.574412Z", + "iopub.status.idle": "2023-10-13T12:02:26.580513Z", + "shell.execute_reply": "2023-10-13T12:02:26.579848Z" } }, "outputs": [], @@ -298,10 +298,10 @@ "id": "65cb1269-974d-40b7-9e21-d123d020f4f4", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:53:14.010678Z", - "iopub.status.busy": "2023-10-12T13:53:14.008656Z", - "iopub.status.idle": "2023-10-12T13:53:20.599846Z", - "shell.execute_reply": "2023-10-12T13:53:20.599139Z" + "iopub.execute_input": "2023-10-13T12:02:26.585377Z", + "iopub.status.busy": "2023-10-13T12:02:26.584069Z", + "iopub.status.idle": "2023-10-13T12:02:33.024622Z", + "shell.execute_reply": "2023-10-13T12:02:33.023914Z" } }, "outputs": [ @@ -377,10 +377,10 @@ "id": "cb2efdc8-7306-41c0-8403-c191ecc4363e", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:53:20.605059Z", - "iopub.status.busy": "2023-10-12T13:53:20.603726Z", - "iopub.status.idle": "2023-10-12T13:53:22.723882Z", - "shell.execute_reply": "2023-10-12T13:53:22.723179Z" + "iopub.execute_input": "2023-10-13T12:02:33.029813Z", + "iopub.status.busy": "2023-10-13T12:02:33.028507Z", + "iopub.status.idle": "2023-10-13T12:02:35.121885Z", + "shell.execute_reply": "2023-10-13T12:02:35.120904Z" } }, "outputs": [ @@ -415,10 +415,10 @@ "id": "8ffa6d11-0c73-4b26-a2d7-f91b596b2517", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:53:22.729149Z", - "iopub.status.busy": "2023-10-12T13:53:22.727816Z", - "iopub.status.idle": "2023-10-12T13:53:22.733938Z", - "shell.execute_reply": "2023-10-12T13:53:22.733314Z" + "iopub.execute_input": "2023-10-13T12:02:35.127015Z", + "iopub.status.busy": "2023-10-13T12:02:35.125426Z", + "iopub.status.idle": "2023-10-13T12:02:35.131868Z", + "shell.execute_reply": "2023-10-13T12:02:35.131272Z" } }, "outputs": [], @@ -442,10 +442,10 @@ "id": "c2f9e62b-35cb-4cd7-b671-7fab6569b6e0", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:53:22.738793Z", - "iopub.status.busy": "2023-10-12T13:53:22.737510Z", - "iopub.status.idle": "2023-10-12T13:53:29.687365Z", - "shell.execute_reply": "2023-10-12T13:53:29.686675Z" + "iopub.execute_input": "2023-10-13T12:02:35.135784Z", + "iopub.status.busy": "2023-10-13T12:02:35.135323Z", + "iopub.status.idle": "2023-10-13T12:02:41.885374Z", + "shell.execute_reply": "2023-10-13T12:02:41.884668Z" } }, "outputs": [ @@ -521,10 +521,10 @@ "id": "56cf82c3-8097-49a9-9030-d63d7e467d4a", "metadata": { "execution": { - "iopub.execute_input": "2023-10-12T13:53:29.690882Z", - "iopub.status.busy": "2023-10-12T13:53:29.690442Z", - "iopub.status.idle": "2023-10-12T13:53:31.923348Z", - "shell.execute_reply": "2023-10-12T13:53:31.922512Z" + "iopub.execute_input": "2023-10-13T12:02:41.890630Z", + "iopub.status.busy": "2023-10-13T12:02:41.889321Z", + "iopub.status.idle": "2023-10-13T12:02:44.088456Z", + "shell.execute_reply": "2023-10-13T12:02:44.087719Z" } }, "outputs": [ diff --git a/master/genindex.html b/master/genindex.html index 08d29d64c0..86bfbe4b56 100644 --- a/master/genindex.html +++ b/master/genindex.html @@ -4,7 +4,7 @@ - Index - Wildboar 1.1.1.dev181 documentation + Index - Wildboar 1.1.1.dev185 documentation @@ -140,7 +140,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/guide.html b/master/guide.html index 4e5cf918da..e806d8e2cc 100644 --- a/master/guide.html +++ b/master/guide.html @@ -6,7 +6,7 @@ - User guide - Wildboar 1.1.1.dev181 documentation + User guide - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/guide/annotate.html b/master/guide/annotate.html index 07f333310b..e4a7b55271 100644 --- a/master/guide/annotate.html +++ b/master/guide/annotate.html @@ -6,7 +6,7 @@ - Annotate - Wildboar 1.1.1.dev181 documentation + Annotate - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/guide/basics.html b/master/guide/basics.html index 748eb4624d..cb8f32242f 100644 --- a/master/guide/basics.html +++ b/master/guide/basics.html @@ -6,7 +6,7 @@ - Time series - Wildboar 1.1.1.dev181 documentation + Time series - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/guide/datasets.html b/master/guide/datasets.html index 674d1a0847..9d5d301895 100644 --- a/master/guide/datasets.html +++ b/master/guide/datasets.html @@ -6,7 +6,7 @@ - Datasets - Wildboar 1.1.1.dev181 documentation + Datasets - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/guide/datasets/preprocess.html b/master/guide/datasets/preprocess.html index ec61cb3b3a..2dad919b3f 100644 --- a/master/guide/datasets/preprocess.html +++ b/master/guide/datasets/preprocess.html @@ -6,7 +6,7 @@ - Pre-processing - Wildboar 1.1.1.dev181 documentation + Pre-processing - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/guide/datasets/repositories.html b/master/guide/datasets/repositories.html index 9953621de7..cedc9f5048 100644 --- a/master/guide/datasets/repositories.html +++ b/master/guide/datasets/repositories.html @@ -6,7 +6,7 @@ - Repositories - Wildboar 1.1.1.dev181 documentation + Repositories - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/guide/glossary.html b/master/guide/glossary.html index 71f7f2c7ac..19d5399ccd 100644 --- a/master/guide/glossary.html +++ b/master/guide/glossary.html @@ -6,7 +6,7 @@ - Glossary - Wildboar 1.1.1.dev181 documentation + Glossary - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/guide/metrics.html b/master/guide/metrics.html index fda3d7d30b..b042e6fb84 100644 --- a/master/guide/metrics.html +++ b/master/guide/metrics.html @@ -6,7 +6,7 @@ - Metrics - Wildboar 1.1.1.dev181 documentation + Metrics - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/guide/metrics/distance.html b/master/guide/metrics/distance.html index 7308b1baab..934d669b37 100644 --- a/master/guide/metrics/distance.html +++ b/master/guide/metrics/distance.html @@ -6,7 +6,7 @@ - Distance - Wildboar 1.1.1.dev181 documentation + Distance - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/guide/metrics/elastic.html b/master/guide/metrics/elastic.html index 175ffc5c42..f78b07a11d 100644 --- a/master/guide/metrics/elastic.html +++ b/master/guide/metrics/elastic.html @@ -6,7 +6,7 @@ - Elastic metrics - Wildboar 1.1.1.dev181 documentation + Elastic metrics - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/guide/supervised.html b/master/guide/supervised.html index e021b3ed68..5b38e7a958 100644 --- a/master/guide/supervised.html +++ b/master/guide/supervised.html @@ -6,7 +6,7 @@ - Supervised learning - Wildboar 1.1.1.dev181 documentation + Supervised learning - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/guide/supervised/ensemble.html b/master/guide/supervised/ensemble.html index cd36b7bfe4..cb057db1f5 100644 --- a/master/guide/supervised/ensemble.html +++ b/master/guide/supervised/ensemble.html @@ -6,7 +6,7 @@ - Ensemble estimators - Wildboar 1.1.1.dev181 documentation + Ensemble estimators - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/guide/supervised/transform.html b/master/guide/supervised/transform.html index 4e422c1abc..136b45a2af 100644 --- a/master/guide/supervised/transform.html +++ b/master/guide/supervised/transform.html @@ -6,7 +6,7 @@ - Transform-based estimators - Wildboar 1.1.1.dev181 documentation + Transform-based estimators - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/guide/supervised/trees.html b/master/guide/supervised/trees.html index cbf5fc496d..0c9e745f91 100644 --- a/master/guide/supervised/trees.html +++ b/master/guide/supervised/trees.html @@ -6,7 +6,7 @@ - Tree-based estimators - Wildboar 1.1.1.dev181 documentation + Tree-based estimators - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/guide/unsupervised.html b/master/guide/unsupervised.html index 38307112a1..6891bb8919 100644 --- a/master/guide/unsupervised.html +++ b/master/guide/unsupervised.html @@ -6,7 +6,7 @@ - Unsupervised learning - Wildboar 1.1.1.dev181 documentation + Unsupervised learning - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/guide/unsupervised/outlier.html b/master/guide/unsupervised/outlier.html index b1cd68abed..7799431dd1 100644 --- a/master/guide/unsupervised/outlier.html +++ b/master/guide/unsupervised/outlier.html @@ -6,7 +6,7 @@ - Outlier detection - Wildboar 1.1.1.dev181 documentation + Outlier detection - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/guide/unsupervised/outlier/generation.html b/master/guide/unsupervised/outlier/generation.html index 79442caede..17d52a4aad 100644 --- a/master/guide/unsupervised/outlier/generation.html +++ b/master/guide/unsupervised/outlier/generation.html @@ -6,7 +6,7 @@ - Outlier detection benchmarks - Wildboar 1.1.1.dev181 documentation + Outlier detection benchmarks - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/index.html b/master/index.html index 62085c9b91..5688673a09 100644 --- a/master/index.html +++ b/master/index.html @@ -6,7 +6,7 @@ - Wildboar 1.1.1.dev181 documentation + Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/more/whatsnew.html b/master/more/whatsnew.html index 6e19405d17..a7894c28ab 100644 --- a/master/more/whatsnew.html +++ b/master/more/whatsnew.html @@ -6,7 +6,7 @@ - What’s new - Wildboar 1.1.1.dev181 documentation + What’s new - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
@@ -411,6 +411,23 @@

Changelog
+

wildboar.explain.counterfactual

+
+
+
    +

  • Feature Add support for KNeighborsClassifiers fitted with any metric +in explain.counterfactual.KNeighborsCounterfactual. We allow for using +different methods for finding the counterfactuals for n_neighbors > 1 +by setting method=’mean’ or method=’medoid’. We have also improved +the way in which cluster centroids are selected, resulting in a more +robust counterfactuals.

    • +
+
+
+

+
+
+

wildboar.linear_model

diff --git a/master/py-modindex.html b/master/py-modindex.html index 151e6261f4..82ec63d05b 100644 --- a/master/py-modindex.html +++ b/master/py-modindex.html @@ -4,7 +4,7 @@ - Python Module Index - Wildboar 1.1.1.dev181 documentation + Python Module Index - Wildboar 1.1.1.dev185 documentation @@ -140,7 +140,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/quickstart.html b/master/quickstart.html index 0149e4d944..d06c7e5e0b 100644 --- a/master/quickstart.html +++ b/master/quickstart.html @@ -6,7 +6,7 @@ - Quickstart - Wildboar 1.1.1.dev181 documentation + Quickstart - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/quickstart/getting-started.html b/master/quickstart/getting-started.html index e05b41baba..77a0d9a437 100644 --- a/master/quickstart/getting-started.html +++ b/master/quickstart/getting-started.html @@ -6,7 +6,7 @@ - Getting started - Wildboar 1.1.1.dev181 documentation + Getting started - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/quickstart/install.html b/master/quickstart/install.html index 63e6ee6406..38f0420867 100644 --- a/master/quickstart/install.html +++ b/master/quickstart/install.html @@ -6,7 +6,7 @@ - Install wildboar - Wildboar 1.1.1.dev181 documentation + Install wildboar - Wildboar 1.1.1.dev185 documentation @@ -142,7 +142,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/search.html b/master/search.html index 5c152e65a0..d473465ebe 100644 --- a/master/search.html +++ b/master/search.html @@ -4,7 +4,7 @@ - Search - Wildboar 1.1.1.dev181 documentation + Search - Wildboar 1.1.1.dev185 documentation @@ -139,7 +139,7 @@
-
Wildboar 1.1.1.dev181 documentation
 +
Wildboar 1.1.1.dev185 documentation
diff --git a/master/searchindex.js b/master/searchindex.js index 835a4c0728..afe737cb85 100644 --- a/master/searchindex.js +++ b/master/searchindex.js @@ -1 +1 @@ -Search.setIndex({"docnames": ["api/index", "api/wildboar/annotate/_motifs/index", "api/wildboar/annotate/_segment/index", "api/wildboar/annotate/index", "api/wildboar/base/index", "api/wildboar/datasets/_filter/index", "api/wildboar/datasets/_repository/index", "api/wildboar/datasets/index", "api/wildboar/datasets/outlier/index", "api/wildboar/datasets/preprocess/index", "api/wildboar/distance/_distance/index", "api/wildboar/distance/_matrix_profile/index", "api/wildboar/distance/_multi_metric/index", "api/wildboar/distance/_neighbors/index", "api/wildboar/distance/dtw/index", "api/wildboar/distance/index", "api/wildboar/ensemble/_ensemble/index", "api/wildboar/ensemble/index", "api/wildboar/explain/_importance/index", "api/wildboar/explain/counterfactual/_helper/index", "api/wildboar/explain/counterfactual/_nn/index", "api/wildboar/explain/counterfactual/_proto/index", "api/wildboar/explain/counterfactual/_sf/index", "api/wildboar/explain/counterfactual/index", "api/wildboar/explain/index", "api/wildboar/index", "api/wildboar/linear_model/_hydra/index", "api/wildboar/linear_model/_rocket/index", "api/wildboar/linear_model/_shapelet/index", "api/wildboar/linear_model/_transform/index", "api/wildboar/linear_model/index", "api/wildboar/metrics/_cluster/index", "api/wildboar/metrics/_counterfactual/index", "api/wildboar/metrics/index", "api/wildboar/model_selection/_cv/index", "api/wildboar/model_selection/_outlier/index", "api/wildboar/model_selection/index", "api/wildboar/transform/_base/index", "api/wildboar/transform/_conv/index", "api/wildboar/transform/_diff/index", "api/wildboar/transform/_hydra/index", "api/wildboar/transform/_interval/index", "api/wildboar/transform/_matrix_profile/index", "api/wildboar/transform/_pivot/index", "api/wildboar/transform/_rocket/index", "api/wildboar/transform/_sax/index", "api/wildboar/transform/_shapelet/index", "api/wildboar/transform/index", "api/wildboar/tree/_base/index", "api/wildboar/tree/_ptree/index", "api/wildboar/tree/_tree/index", "api/wildboar/tree/index", "api/wildboar/utils/_parallel/index", "api/wildboar/utils/_testing/index", "api/wildboar/utils/decorators/index", "api/wildboar/utils/estimator_checks/index", "api/wildboar/utils/index", "api/wildboar/utils/plot/index", "api/wildboar/utils/validation/index", "api/wildboar/utils/variable_len/index", "api/wildboar/version/index", "examples", "examples/hydra", "guide", "guide/annotate", "guide/basics", "guide/datasets", "guide/datasets/preprocess", "guide/datasets/repositories", "guide/glossary", "guide/metrics", "guide/metrics/distance", "guide/metrics/elastic", "guide/supervised", "guide/supervised/ensemble", "guide/supervised/transform", "guide/supervised/trees", "guide/unsupervised", "guide/unsupervised/outlier", "guide/unsupervised/outlier/generation", "index", "more/whatsnew", "quickstart", "quickstart/getting-started", "quickstart/install"], "filenames": ["api/index.rst", "api/wildboar/annotate/_motifs/index.rst", "api/wildboar/annotate/_segment/index.rst", "api/wildboar/annotate/index.rst", "api/wildboar/base/index.rst", "api/wildboar/datasets/_filter/index.rst", "api/wildboar/datasets/_repository/index.rst", "api/wildboar/datasets/index.rst", "api/wildboar/datasets/outlier/index.rst", "api/wildboar/datasets/preprocess/index.rst", "api/wildboar/distance/_distance/index.rst", "api/wildboar/distance/_matrix_profile/index.rst", "api/wildboar/distance/_multi_metric/index.rst", "api/wildboar/distance/_neighbors/index.rst", "api/wildboar/distance/dtw/index.rst", "api/wildboar/distance/index.rst", "api/wildboar/ensemble/_ensemble/index.rst", "api/wildboar/ensemble/index.rst", "api/wildboar/explain/_importance/index.rst", "api/wildboar/explain/counterfactual/_helper/index.rst", "api/wildboar/explain/counterfactual/_nn/index.rst", "api/wildboar/explain/counterfactual/_proto/index.rst", "api/wildboar/explain/counterfactual/_sf/index.rst", "api/wildboar/explain/counterfactual/index.rst", "api/wildboar/explain/index.rst", "api/wildboar/index.rst", "api/wildboar/linear_model/_hydra/index.rst", "api/wildboar/linear_model/_rocket/index.rst", "api/wildboar/linear_model/_shapelet/index.rst", "api/wildboar/linear_model/_transform/index.rst", "api/wildboar/linear_model/index.rst", "api/wildboar/metrics/_cluster/index.rst", "api/wildboar/metrics/_counterfactual/index.rst", "api/wildboar/metrics/index.rst", "api/wildboar/model_selection/_cv/index.rst", "api/wildboar/model_selection/_outlier/index.rst", "api/wildboar/model_selection/index.rst", "api/wildboar/transform/_base/index.rst", "api/wildboar/transform/_conv/index.rst", "api/wildboar/transform/_diff/index.rst", "api/wildboar/transform/_hydra/index.rst", "api/wildboar/transform/_interval/index.rst", "api/wildboar/transform/_matrix_profile/index.rst", "api/wildboar/transform/_pivot/index.rst", "api/wildboar/transform/_rocket/index.rst", "api/wildboar/transform/_sax/index.rst", "api/wildboar/transform/_shapelet/index.rst", "api/wildboar/transform/index.rst", "api/wildboar/tree/_base/index.rst", "api/wildboar/tree/_ptree/index.rst", "api/wildboar/tree/_tree/index.rst", "api/wildboar/tree/index.rst", "api/wildboar/utils/_parallel/index.rst", "api/wildboar/utils/_testing/index.rst", "api/wildboar/utils/decorators/index.rst", "api/wildboar/utils/estimator_checks/index.rst", "api/wildboar/utils/index.rst", "api/wildboar/utils/plot/index.rst", "api/wildboar/utils/validation/index.rst", "api/wildboar/utils/variable_len/index.rst", "api/wildboar/version/index.rst", "examples.rst", "examples/hydra.ipynb", "guide.rst", "guide/annotate.rst", "guide/basics.rst", "guide/datasets.rst", "guide/datasets/preprocess.rst", "guide/datasets/repositories.rst", "guide/glossary.rst", "guide/metrics.rst", "guide/metrics/distance.rst", "guide/metrics/elastic.rst", "guide/supervised.rst", "guide/supervised/ensemble.rst", "guide/supervised/transform.rst", "guide/supervised/trees.rst", "guide/unsupervised.rst", "guide/unsupervised/outlier.rst", "guide/unsupervised/outlier/generation.rst", "index.rst", "more/whatsnew.rst", "quickstart.rst", "quickstart/getting-started.rst", "quickstart/install.rst"], "titles": ["wildboar", "wildboar.annotate._motifs", "wildboar.annotate._segment", "wildboar.annotate", "wildboar.base", "wildboar.datasets._filter", "wildboar.datasets._repository", "wildboar.datasets", "wildboar.datasets.outlier", "wildboar.datasets.preprocess", "wildboar.distance._distance", "wildboar.distance._matrix_profile", "wildboar.distance._multi_metric", "wildboar.distance._neighbors", "wildboar.distance.dtw", "wildboar.distance", "wildboar.ensemble._ensemble", "wildboar.ensemble", "wildboar.explain._importance", "wildboar.explain.counterfactual._helper", "wildboar.explain.counterfactual._nn", "wildboar.explain.counterfactual._proto", "wildboar.explain.counterfactual._sf", "wildboar.explain.counterfactual", "wildboar.explain", "wildboar", "wildboar.linear_model._hydra", "wildboar.linear_model._rocket", "wildboar.linear_model._shapelet", "wildboar.linear_model._transform", "wildboar.linear_model", "wildboar.metrics._cluster", "wildboar.metrics._counterfactual", "wildboar.metrics", "wildboar.model_selection._cv", "wildboar.model_selection._outlier", "wildboar.model_selection", "wildboar.transform._base", "wildboar.transform._conv", "wildboar.transform._diff", "wildboar.transform._hydra", "wildboar.transform._interval", "wildboar.transform._matrix_profile", "wildboar.transform._pivot", "wildboar.transform._rocket", "wildboar.transform._sax", "wildboar.transform._shapelet", "wildboar.transform", "wildboar.tree._base", "wildboar.tree._ptree", "wildboar.tree._tree", "wildboar.tree", "wildboar.utils._parallel", "wildboar.utils._testing", "wildboar.utils.decorators", "wildboar.utils.estimator_checks", "wildboar.utils", "wildboar.utils.plot", "wildboar.utils.validation", "wildboar.utils.variable_len", "wildboar.version", "Examples", "Convolution transforms", "User guide", "Annotate", "Time series", "Datasets", "Pre-processing", "Repositories", "Glossary", "Metrics", "Distance", "Elastic metrics", "Supervised learning", "Ensemble estimators", "Transform-based estimators", "Tree-based estimators", "Unsupervised learning", "Outlier detection", "Outlier detection benchmarks", "Wildboar", "What\u2019s new", "Quickstart", "Getting started", "Install wildboar"], "terms": {"librari": [0, 25, 80], "tempor": [0, 22, 23, 25, 65, 80, 83], "machin": [0, 25, 70, 80], "learn": [0, 14, 25, 29, 39, 40, 47, 48, 50, 55, 56, 58, 62, 69, 80, 81], "includ": [0, 1, 3, 8, 11, 15, 23, 25, 56, 58, 71, 76, 80, 81, 83], "numer": [0, 23, 25, 56, 58, 80, 83], "algorithm": [0, 8, 13, 14, 15, 22, 23, 25, 62, 65, 67, 70, 80, 81], "seamlessli": [0, 25, 80, 83], "integr": [0, 25, 68, 71, 80], "them": [0, 8, 25, 57, 65, 67, 68, 80], "scikit": [0, 25, 29, 39, 40, 47, 48, 50, 55, 56, 58, 62, 69, 80, 81, 83], "iseo": [0, 25, 65, 67, 80], "boolean": [0, 14, 25, 59, 80], "indic": [0, 7, 10, 14, 15, 16, 17, 19, 23, 25, 32, 33, 48, 49, 50, 51, 59, 69, 80], "valu": [0, 4, 6, 7, 8, 9, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 62, 65, 66, 67, 68, 69, 71, 74, 80, 81, 83], "i": [0, 1, 2, 3, 4, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 54, 55, 56, 57, 58, 59, 62, 65, 66, 67, 68, 69, 70, 71, 73, 74, 79, 80, 81, 83, 84], "end": [0, 18, 24, 25, 48, 49, 50, 51, 56, 58, 65, 67, 69, 80], "sequenc": [0, 9, 25, 56, 57, 58, 65, 67, 70, 80], "time": [0, 1, 2, 3, 4, 9, 10, 11, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 30, 31, 32, 33, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 55, 56, 57, 58, 59, 62, 66, 67, 68, 69, 70, 71, 73, 74, 75, 79, 80], "seri": [0, 1, 2, 3, 4, 9, 10, 11, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 30, 31, 32, 33, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 55, 56, 58, 59, 62, 66, 67, 68, 69, 70, 71, 73, 74, 75, 79, 80], "see": [0, 3, 7, 8, 10, 13, 15, 19, 23, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 62, 71, 80, 81], "section": [0, 3, 7, 18, 24, 80], "user": [0, 3, 4, 7, 8, 10, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 68, 71, 79, 80, 83, 84], "guid": [0, 3, 4, 7, 8, 10, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 80], "more": [0, 3, 7, 8, 10, 13, 15, 16, 17, 18, 23, 24, 31, 32, 33, 43, 46, 47, 49, 50, 51, 56, 58, 62, 68, 70, 71, 79, 80, 83], "detail": [0, 3, 7, 8, 15, 39, 47, 71, 80, 81], "exampl": [0, 3, 7, 8, 13, 14, 15, 16, 17, 19, 21, 23, 35, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 57, 59, 62, 65, 66, 67, 68, 71, 80], "motif": [0, 1, 3, 11, 15, 80], "find": [0, 1, 2, 3, 10, 15, 66, 80, 84], "segment": [0, 2, 3, 80], "chang": [0, 2, 3, 7, 14, 16, 17, 19, 22, 23, 32, 33, 50, 51, 65, 66, 68, 71, 80], "regim": [0, 2, 3, 80], "all": [0, 1, 3, 4, 6, 7, 8, 10, 11, 13, 15, 16, 17, 18, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 39, 40, 44, 46, 47, 48, 50, 51, 53, 55, 56, 57, 58, 66, 67, 68, 70, 71, 80, 81, 83, 84], "estim": [0, 4, 8, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 53, 55, 56, 58, 63, 66, 69, 71, 73, 79, 80, 81, 83], "baseestim": [0, 4, 39, 47, 53, 80], "counterfactualmixin": [0, 4, 80], "mixin": [0, 4, 16, 29, 39, 41, 43, 44, 46, 47, 48, 50, 80], "explainermixin": [0, 4, 80], "is_counterfactu": [0, 4, 21, 80], "check": [0, 4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 53, 55, 56, 58, 67, 69, 80], "is_explain": [0, 4, 80], "an": [0, 4, 8, 10, 13, 15, 16, 17, 21, 26, 30, 32, 33, 34, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 54, 56, 58, 65, 66, 68, 69, 71, 73, 74, 79, 80, 81, 84], "load": [0, 6, 7, 62, 68, 80], "from": [0, 1, 3, 6, 7, 8, 14, 16, 17, 19, 21, 22, 23, 26, 27, 28, 29, 30, 32, 33, 35, 36, 40, 41, 42, 44, 45, 46, 47, 48, 49, 50, 51, 54, 57, 59, 62, 66, 67, 68, 70, 71, 79, 80, 81, 83], "import": [0, 7, 14, 16, 17, 18, 24, 35, 36, 40, 41, 42, 44, 46, 47, 48, 49, 50, 51, 57, 59, 62, 65, 66, 67, 68, 71, 79, 80, 83], "load_dataset": [0, 7, 41, 47, 49, 51, 62, 66, 67, 68, 71, 80, 83], "x": [0, 1, 2, 3, 4, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 59, 62, 65, 66, 67, 68, 70, 71, 79, 80, 83], "y": [0, 4, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 34, 35, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 62, 66, 67, 68, 70, 71, 79, 80, 83], "gunpoint": [0, 7, 41, 47, 49, 51, 66, 67, 68, 80], "shape": [0, 1, 2, 3, 4, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 57, 65, 66, 67, 69, 70, 71, 80, 83], "200": [0, 7, 66, 80], "60": [0, 7, 66, 71, 80], "bundl": [0, 6, 7, 66, 68, 79, 80], "handl": [0, 6, 7, 66, 80], "jsonrepositori": [0, 6, 7, 68, 80], "A": [0, 4, 5, 6, 7, 8, 10, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 57, 65, 66, 67, 68, 69, 70, 71, 79, 80, 83], "repositori": [0, 6, 7, 66, 80, 83], "collect": [0, 6, 7, 19, 23, 41, 47, 68, 73, 79, 80, 83, 84], "npbundl": [0, 6, 7, 80], "numpi": [0, 6, 7, 16, 17, 18, 24, 26, 30, 37, 40, 41, 44, 47, 50, 51, 65, 67, 68, 69, 71, 80, 81, 83, 84], "binari": [0, 6, 7, 8, 16, 17, 58, 79, 80, 84], "file": [0, 6, 7, 68, 80, 84], "clear_cach": [0, 7, 80], "clear": [0, 7, 80], "cach": [0, 6, 7, 66, 80], "delet": [0, 7, 80], "get_bundl": [0, 6, 7, 80], "get": [0, 4, 6, 7, 9, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 67, 80], "get_repositori": [0, 7, 80], "name": [0, 4, 6, 7, 9, 10, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 58, 66, 67, 68, 70, 71, 80, 83], "install_repositori": [0, 7, 68, 80], "instal": [0, 7, 66, 79, 80], "list_bundl": [0, 7, 68, 80], "list": [0, 1, 3, 5, 6, 7, 10, 15, 16, 17, 18, 19, 23, 24, 27, 28, 29, 30, 32, 33, 41, 43, 46, 47, 48, 49, 50, 51, 53, 54, 55, 56, 58, 66, 68, 71, 79, 80, 81], "specifi": [0, 6, 7, 16, 17, 18, 24, 32, 33, 43, 46, 47, 50, 51, 57, 66, 67, 68, 70, 71, 79, 80, 83, 84], "list_collect": [0, 7, 80], "list_dataset": [0, 7, 68, 80], "list_repositori": [0, 7, 68, 80], "kei": [0, 6, 7, 10, 15, 16, 17, 19, 23, 32, 33, 41, 43, 46, 47, 49, 50, 51, 58, 68, 80], "gener": [0, 7, 8, 13, 14, 15, 16, 17, 18, 19, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 40, 41, 44, 46, 47, 48, 49, 50, 51, 55, 66, 79, 80, 83], "load_gun_point": [0, 7, 40, 41, 44, 47, 48, 49, 50, 51, 57, 66, 80], "load_synthetic_control": [0, 7, 16, 17, 80, 83], "synthetic_control": [0, 7, 80, 83], "load_two_lead_ecg": [0, 7, 14, 16, 17, 35, 36, 42, 47, 71, 80, 83], "twoleadecg": [0, 7, 66, 68, 71, 80, 83], "refresh_repositori": [0, 7, 68, 80], "refresh": [0, 6, 7, 68, 80], "set_cache_dir": [0, 7, 68, 80], "global": [0, 7, 20, 22, 23, 32, 33, 41, 47, 68, 80], "directori": [0, 7, 68, 80, 84], "synthet": [0, 8, 79, 80], "us": [0, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 35, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 54, 56, 57, 58, 62, 66, 67, 68, 69, 70, 71, 75, 79, 80, 81, 83, 84], "density_outli": [0, 8, 80], "densitii": [0, 8, 80], "emmott_outli": [0, 8, 79, 80], "difficulti": [0, 8, 79, 80], "kmeans_outli": [0, 8, 80], "k": [0, 8, 13, 15, 16, 17, 18, 20, 23, 24, 49, 51, 74, 79, 80, 81], "mean": [0, 7, 8, 9, 10, 13, 14, 15, 16, 17, 22, 23, 26, 27, 28, 29, 30, 31, 32, 33, 37, 40, 41, 44, 46, 47, 48, 49, 50, 51, 67, 70, 71, 80, 81, 83], "majority_outli": [0, 8, 80], "label": [0, 4, 6, 7, 8, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 42, 47, 48, 49, 50, 51, 56, 57, 58, 66, 68, 73, 78, 80, 83], "major": [0, 8, 14, 68, 78, 80], "inlier": [0, 8, 16, 17, 34, 36, 79, 80], "minority_outli": [0, 8, 79, 80], "fraction": [0, 1, 2, 3, 8, 11, 14, 15, 16, 17, 18, 22, 23, 24, 32, 33, 34, 36, 42, 47, 48, 49, 50, 51, 79, 80], "minor": [0, 8, 68, 78, 80, 81], "maxabs_scal": [0, 9, 67, 80], "scale": [0, 8, 9, 16, 17, 26, 30, 40, 44, 45, 47, 57, 62, 67, 70, 79, 80], "each": [0, 2, 3, 4, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 59, 62, 65, 67, 68, 69, 70, 71, 80, 83], "its": [0, 9, 11, 15, 41, 42, 47, 56, 57, 58, 66, 80, 84], "maximum": [0, 1, 3, 9, 13, 14, 15, 16, 17, 18, 24, 34, 36, 41, 44, 46, 47, 49, 50, 51, 57, 62, 67, 69, 71, 80], "absolut": [0, 9, 32, 33, 67, 80], "minmax_scal": [0, 9, 45, 47, 66, 67, 80], "along": [0, 9, 18, 24, 26, 30, 67, 80], "dimens": [0, 9, 14, 26, 30, 32, 33, 42, 47, 56, 58, 65, 66, 67, 69, 71, 80, 81, 83], "named_preprocess": [0, 9, 80], "preprocessor": [0, 9, 67, 80], "standard": [0, 9, 16, 17, 21, 26, 30, 40, 41, 47, 62, 67, 80, 83], "truncat": [0, 9, 67, 80], "shortest": [0, 9, 67, 80], "fast": [0, 13, 15, 26, 30, 40, 44, 46, 47, 70, 80], "comput": [0, 1, 2, 3, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 31, 32, 33, 42, 43, 47, 48, 49, 50, 51, 62, 70, 71, 75, 80, 81], "The": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 53, 54, 55, 56, 57, 58, 59, 62, 63, 65, 66, 67, 68, 69, 70, 71, 79, 80, 81, 83, 84], "modul": [0, 15, 23, 66, 67, 79, 80, 81, 83], "pair": [0, 1, 3, 7, 11, 15, 16, 17, 32, 33, 43, 46, 47, 49, 50, 51, 58, 80], "pairwis": [0, 15, 80], "between": [0, 1, 3, 9, 10, 13, 14, 15, 19, 22, 23, 31, 32, 33, 38, 46, 47, 67, 70, 71, 79, 80, 83], "subsequ": [0, 1, 3, 10, 11, 15, 16, 17, 42, 44, 47, 62, 80, 81], "kmean": [0, 13, 15, 80, 81], "cluster": [0, 8, 13, 15, 79, 80, 81], "support": [0, 8, 10, 13, 15, 16, 17, 22, 23, 32, 33, 41, 44, 50, 51, 65, 66, 67, 68, 70, 79, 80, 81, 83], "weight": [0, 13, 14, 15, 16, 17, 26, 27, 28, 29, 30, 32, 33, 40, 43, 47, 48, 49, 50, 51, 70, 80], "kmedoid": [0, 13, 15, 80, 81], "kneighborsclassifi": [0, 13, 15, 80, 81], "classifi": [0, 8, 13, 15, 16, 17, 20, 22, 23, 24, 27, 28, 29, 30, 40, 47, 49, 50, 51, 55, 62, 74, 80, 81, 83], "implement": [0, 13, 14, 15, 16, 17, 18, 22, 23, 24, 27, 30, 32, 33, 40, 41, 44, 47, 62, 67, 68, 70, 71, 74, 79, 80, 81, 83], "nearest": [0, 11, 13, 15, 20, 21, 23, 80], "neighbor": [0, 11, 13, 15, 20, 21, 23, 80, 81], "matrix_profil": [0, 1, 2, 3, 11, 15, 80], "matrix": [0, 1, 2, 3, 11, 14, 15, 16, 17, 19, 21, 23, 27, 28, 29, 30, 42, 47, 48, 49, 50, 51, 71, 80, 83], "profil": [0, 1, 2, 3, 11, 15, 42, 47, 80], "paired_dist": [0, 10, 15, 71, 80, 81], "th": [0, 10, 15, 16, 17, 32, 33, 80], "paired_subsequence_dist": [0, 10, 15, 71, 80], "minimum": [0, 1, 3, 6, 7, 9, 10, 14, 15, 16, 17, 18, 24, 41, 44, 46, 47, 49, 50, 51, 56, 58, 68, 70, 71, 80], "paired_subsequence_match": [0, 10, 15, 80], "match": [0, 1, 3, 10, 11, 15, 21, 68, 70, 71, 80, 81], "subsequnc": [0, 10, 15, 80], "pairwise_dist": [0, 10, 15, 70, 71, 80, 81], "pairwise_subsequence_dist": [0, 10, 15, 70, 71, 80], "subsequence_match": [0, 1, 3, 10, 15, 71, 80], "align": [0, 14, 18, 21, 24, 32, 33, 80], "sever": [0, 14, 48, 49, 50, 51, 70, 80, 81, 83], "ddtw_distanc": [0, 14, 80], "deriv": [0, 14, 16, 32, 33, 70, 80], "dynam": [0, 14, 16, 17, 49, 50, 51, 70, 71, 80], "warp": [0, 13, 14, 15, 49, 51, 70, 71, 80], "dtw_align": [0, 14, 80], "dtw_averag": [0, 14, 80], "barycent": [0, 13, 14, 15, 80], "averag": [0, 14, 16, 17, 32, 33, 62, 80], "dba": [0, 14, 80], "dtw_distanc": [0, 14, 80], "dtw_envelop": [0, 14, 80], "envelop": [0, 14, 80], "lb_keogh": [0, 14, 80], "dtw_lb_keogh": [0, 14, 80], "lower": [0, 8, 10, 14, 15, 16, 17, 32, 33, 43, 44, 46, 47, 49, 50, 51, 57, 71, 80], "bound": [0, 14, 16, 17, 34, 36, 43, 46, 47, 49, 50, 51, 71, 80], "dtw_map": [0, 14, 80], "optim": [0, 14, 71, 80, 81, 84], "path": [0, 14, 22, 23, 48, 49, 50, 51, 68, 80, 84], "two": [0, 13, 14, 15, 16, 17, 26, 30, 40, 41, 43, 46, 47, 49, 50, 51, 57, 62, 68, 70, 71, 76, 80, 81, 83], "given": [0, 2, 3, 8, 10, 11, 13, 14, 15, 16, 17, 18, 24, 26, 27, 28, 29, 30, 38, 45, 47, 48, 49, 50, 51, 69, 73, 80], "jeong_weight": [0, 14, 80], "describ": [0, 8, 14, 22, 23, 40, 47, 62, 66, 68, 71, 80, 81], "jeong": [0, 14, 80], "et": [0, 1, 2, 3, 8, 11, 14, 15, 16, 17, 40, 47, 49, 51, 62, 79, 80, 81], "al": [0, 1, 2, 3, 8, 11, 14, 15, 16, 17, 40, 47, 49, 51, 62, 79, 80, 81], "2011": [0, 14, 80], "r4bf7d056babf": [0, 14, 80], "1": [0, 1, 2, 3, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 26, 27, 28, 29, 30, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 56, 57, 58, 59, 62, 65, 66, 67, 68, 69, 70, 71, 79, 80, 83, 84], "_": [0, 14, 80], "wddtw_distanc": [0, 14, 80], "wdtw_align": [0, 14, 80], "wdtw_distanc": [0, 14, 80], "method": [0, 4, 8, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 55, 62, 63, 74, 80, 81, 83], "classif": [0, 8, 13, 14, 15, 16, 17, 26, 27, 28, 29, 30, 32, 33, 35, 36, 40, 44, 46, 47, 48, 49, 50, 51, 58, 76, 79, 80, 83], "regress": [0, 8, 16, 17, 29, 30, 48, 49, 50, 51, 75, 79, 80, 83], "detect": [0, 8, 17, 71, 80], "baggingclassifi": [0, 16, 17, 80, 81], "bag": [0, 16, 17, 80], "baggingregressor": [0, 16, 17, 80, 81], "regressor": [0, 16, 17, 24, 27, 28, 29, 30, 48, 50, 51, 55, 74, 80], "basebag": [0, 16, 17, 80], "extrashapelettreesclassifi": [0, 16, 17, 80], "extrem": [0, 16, 17, 80], "random": [0, 8, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 26, 28, 30, 31, 33, 34, 35, 36, 37, 40, 41, 43, 44, 46, 47, 49, 50, 51, 62, 74, 75, 80, 83], "shapelet": [0, 1, 3, 10, 11, 15, 16, 17, 18, 21, 22, 23, 24, 28, 30, 44, 46, 47, 50, 51, 76, 80, 83], "extrashapelettreesregressor": [0, 16, 17, 80, 81], "intervalforestclassifi": [0, 16, 17, 80], "interv": [0, 8, 16, 17, 18, 24, 32, 33, 41, 45, 47, 50, 51, 79, 80, 83], "intervalforestregressor": [0, 16, 17, 80], "isolationshapeletforest": [0, 16, 17, 80], "isol": [0, 16, 17, 80, 84], "forest": [0, 8, 16, 17, 22, 23, 49, 51, 80, 83], "pivotforestclassifi": [0, 16, 17, 80], "proximityforestclassifi": [0, 16, 17, 74, 80], "proxim": [0, 16, 17, 19, 23, 32, 33, 49, 51, 80], "rocketforestclassifi": [0, 16, 17, 80, 81], "rocket": [0, 16, 17, 27, 30, 44, 47, 80, 83], "rocketforestregressor": [0, 16, 17, 80, 81], "shapeletforestclassifi": [0, 16, 17, 62, 74, 80, 81, 83], "shapeletforestembed": [0, 16, 17, 80], "shapeletforestregressor": [0, 16, 17, 74, 80, 81], "explan": [0, 4, 18, 19, 20, 21, 22, 23, 24, 32, 33, 80], "amplitudeimport": [0, 18, 24, 80], "equi": [0, 18, 24, 80], "probabl": [0, 4, 8, 13, 15, 16, 17, 18, 21, 24, 43, 44, 47, 48, 49, 50, 51, 80], "amplitud": [0, 18, 24, 57, 80], "intervalimport": [0, 18, 24, 80, 83], "shapeletimport": [0, 18, 24, 80], "plot_import": [0, 18, 24, 80], "plot": [0, 4, 18, 20, 21, 22, 23, 24, 67, 80, 83], "boxplot": [0, 18, 24, 80], "kneighborscounterfactu": [0, 20, 23, 80], "fit": [0, 4, 8, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 62, 66, 75, 80, 83], "prototypecounterfactu": [0, 21, 23, 80], "model": [0, 8, 16, 17, 21, 23, 26, 27, 28, 29, 30, 36, 48, 50, 51, 75, 79, 80], "agnost": [0, 2, 3, 21, 23, 80], "approach": [0, 21, 23, 26, 30, 40, 47, 66, 79, 80, 83, 84], "construct": [0, 8, 21, 23, 32, 33, 45, 47, 50, 51, 56, 58, 62, 74, 79, 80], "shapeletforestcounterfactu": [0, 22, 23, 80], "singl": [0, 13, 15, 16, 17, 19, 23, 26, 30, 32, 33, 37, 40, 44, 47, 48, 49, 50, 51, 54, 62, 65, 68, 69, 71, 80, 81], "sampl": [0, 4, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 39, 40, 41, 42, 43, 44, 45, 47, 48, 49, 50, 51, 56, 57, 58, 65, 66, 67, 68, 69, 71, 76, 79, 80, 81, 83], "linear": [0, 30, 80], "both": [0, 8, 10, 11, 14, 15, 30, 38, 47, 56, 58, 62, 65, 67, 68, 70, 71, 76, 79, 80], "hydraclassifi": [0, 26, 30, 40, 47, 75, 80, 81], "dictionari": [0, 6, 7, 16, 17, 21, 22, 23, 26, 30, 40, 43, 46, 47, 49, 50, 51, 58, 68, 80, 81], "convolut": [0, 16, 17, 26, 30, 38, 40, 44, 47, 50, 51, 75, 80, 81], "kernel": [0, 8, 16, 17, 26, 27, 28, 29, 30, 38, 40, 44, 47, 48, 50, 51, 62, 75, 79, 80], "randomshapeletclassifi": [0, 28, 30, 80], "randomshapeletregressor": [0, 28, 30, 80], "rocketclassifi": [0, 27, 30, 75, 80, 81], "rocketregressor": [0, 27, 30, 75, 80, 81], "evalu": [0, 16, 17, 21, 22, 23, 32, 33, 50, 51, 55, 62, 66, 80, 83], "compactness_scor": [0, 32, 33, 80], "compact": [0, 32, 33, 80], "score": [0, 4, 8, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 48, 49, 50, 51, 62, 79, 80, 83], "plausability_scor": [0, 32, 33, 80], "plausibl": [0, 32, 33, 80], "proximity_scor": [0, 32, 33, 80], "redudancy_scor": [0, 32, 33, 80], "redud": [0, 32, 33, 80], "relative_proximity_scor": [0, 32, 33, 80], "rel": [0, 13, 15, 32, 33, 71, 80], "silhouette_sampl": [0, 31, 33, 80], "silhouett": [0, 31, 33, 80], "coeffici": [0, 16, 17, 27, 28, 29, 30, 31, 33, 48, 50, 51, 80], "silhouette_scor": [0, 31, 33, 80], "validity_scor": [0, 32, 33, 80], "valid": [0, 7, 19, 23, 26, 30, 32, 33, 34, 36, 48, 49, 50, 51, 56, 65, 66, 68, 80, 81], "select": [0, 8, 10, 13, 15, 19, 23, 31, 33, 36, 41, 46, 47, 66, 67, 79, 80, 83, 84], "repeatedoutliersplit": [0, 34, 36, 80], "repeat": [0, 18, 24, 34, 36, 80], "cross": [0, 26, 30, 34, 36, 80], "outlier_train_test_split": [0, 16, 17, 35, 36, 80], "train": [0, 6, 7, 13, 15, 16, 17, 32, 33, 34, 35, 36, 44, 47, 48, 49, 50, 51, 66, 67, 68, 80, 83], "test": [0, 7, 13, 15, 16, 17, 26, 27, 28, 29, 30, 32, 33, 34, 35, 36, 48, 49, 50, 51, 53, 55, 59, 66, 67, 68, 71, 74, 80, 83], "split": [0, 7, 16, 17, 26, 30, 34, 35, 36, 48, 49, 50, 51, 62, 68, 70, 80, 83], "raw": [0, 47, 80], "tabular": [0, 47, 80], "represent": [0, 16, 17, 47, 50, 51, 62, 75, 79, 80, 83], "difftransform": [0, 39, 40, 47, 62, 80], "featuretransform": [0, 41, 47, 80], "number": [0, 1, 2, 3, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 19, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 56, 57, 58, 62, 66, 69, 71, 80, 83], "featur": [0, 16, 17, 27, 28, 29, 30, 37, 41, 44, 47, 48, 50, 51, 54, 62, 66, 67, 75, 80, 81, 84], "hydratransform": [0, 40, 47, 62, 80, 81], "intervaltransform": [0, 8, 41, 47, 79, 80, 81], "emb": [0, 41, 47, 80], "per": [0, 8, 18, 22, 23, 24, 26, 30, 40, 41, 43, 47, 80], "matrixprofiletransform": [0, 42, 47, 80], "paa": [0, 45, 47, 80], "peicewis": [0, 45, 47, 80], "aggreg": [0, 22, 23, 45, 47, 80], "approxim": [0, 8, 45, 47, 80], "pivottransform": [0, 43, 47, 80, 81], "pivot": [0, 8, 16, 17, 43, 47, 49, 50, 51, 74, 80], "proximitytransform": [0, 43, 47, 80], "condit": [0, 43, 47, 80], "randomshapelettransform": [0, 46, 47, 80, 81], "tranform": [0, 46, 47, 80], "rockettransform": [0, 44, 47, 62, 80, 81, 83], "sax": [0, 18, 24, 32, 33, 45, 47, 80], "symbol": [0, 45, 47, 80], "convolv": [0, 26, 30, 38, 47, 80], "appli": [0, 7, 8, 38, 47, 48, 49, 50, 51, 62, 66, 80], "1d": [0, 38, 47, 56, 58, 69, 71, 80], "over": [0, 16, 17, 18, 24, 32, 33, 38, 43, 46, 47, 49, 50, 51, 70, 80, 81, 83], "piecewice_aggregate_approxim": [0, 45, 47, 80], "symbolic_aggregate_approxim": [0, 45, 47, 80], "extrashapelettreeclassifi": [0, 50, 51, 76, 80], "extra": [0, 4, 6, 7, 18, 20, 21, 22, 23, 24, 50, 51, 68, 71, 80], "extrashapelettreeregressor": [0, 50, 51, 76, 80, 81], "intervaltreeclassifi": [0, 50, 51, 80], "intervaltreeregressor": [0, 50, 51, 80], "pivottreeclassifi": [0, 50, 51, 80], "proximitytreeclassifi": [0, 49, 51, 80, 81], "branch": [0, 49, 51, 74, 80], "rockettreeclassifi": [0, 50, 51, 80, 81], "rockettreeregressor": [0, 50, 51, 80, 81], "shapelettreeclassifi": [0, 48, 49, 50, 51, 76, 80, 81], "shapelettreeregressor": [0, 16, 17, 50, 51, 76, 80, 81], "check_arrai": [0, 56, 58, 80], "input": [0, 4, 8, 10, 11, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 27, 28, 29, 30, 31, 33, 35, 36, 38, 39, 42, 43, 45, 47, 48, 49, 50, 51, 56, 57, 58, 59, 62, 69, 71, 80, 83], "check_x_i": [0, 56, 58, 80], "mp": [1, 3, 11, 15], "none": [1, 2, 3, 4, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 53, 54, 55, 56, 57, 58, 68, 71], "window": [1, 2, 3, 11, 13, 14, 15, 18, 24, 32, 33, 42, 45, 47, 68, 70, 84], "auto": [1, 3, 13, 15, 16, 17, 21, 23, 43, 47, 49, 51], "exclud": [1, 2, 3, 10, 11, 15, 42, 47], "0": [1, 2, 3, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 26, 27, 28, 29, 30, 34, 35, 36, 38, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 62, 65, 66, 67, 68, 70, 71, 79, 83, 84], "2": [1, 2, 3, 8, 11, 14, 15, 16, 17, 18, 19, 23, 24, 27, 28, 29, 30, 34, 35, 36, 38, 41, 42, 44, 47, 48, 49, 50, 51, 56, 58, 59, 62, 65, 66, 68, 69, 70, 71, 83], "max_dist": [1, 3], "best": [1, 3, 10, 15, 16, 17, 19, 21, 23, 27, 28, 29, 30, 46, 47, 48, 50, 51, 71], "max_neighbour": [1, 3], "10": [1, 3, 10, 15, 16, 17, 18, 24, 26, 27, 28, 29, 30, 41, 43, 44, 46, 47, 49, 50, 51, 57, 62, 71, 84], "min_neighbour": [1, 3], "max_motif": [1, 3], "return_dist": [1, 3, 10, 15], "fals": [1, 2, 3, 7, 10, 11, 14, 15, 16, 17, 18, 21, 22, 23, 24, 28, 30, 32, 33, 45, 47, 55, 56, 57, 58, 65, 66, 68, 83], "sourc": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 83], "paramet": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 62, 66, 67, 68, 70, 71, 79, 81, 83], "arrai": [1, 2, 3, 4, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 54, 56, 57, 58, 59, 65, 67, 68, 69, 71, 83], "like": [1, 2, 3, 4, 8, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 69], "n_sampl": [1, 2, 3, 4, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 65, 66, 67, 69, 71, 81, 83], "n_timestep": [1, 2, 3, 4, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 32, 33, 35, 36, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 65, 66, 67, 69, 71, 83], "ndarrai": [1, 2, 3, 4, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 54, 56, 58, 59, 67, 83], "profile_s": [1, 2, 3, 11, 15], "option": [1, 2, 3, 4, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 66, 68, 71, 79, 83, 84], "int": [1, 2, 3, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 26, 30, 31, 32, 33, 34, 35, 36, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 49, 50, 51, 52, 56, 57, 58, 66, 71, 79], "float": [1, 2, 3, 4, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 38, 41, 42, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 59, 65, 66, 70], "size": [1, 2, 3, 9, 10, 11, 13, 14, 15, 16, 17, 18, 22, 23, 24, 26, 30, 31, 32, 33, 34, 35, 36, 40, 41, 42, 44, 45, 46, 47, 66, 83], "math": [1, 3, 10, 15, 71], "ceil": [1, 3, 10, 15, 50, 51], "exact": [1, 2, 3, 10, 11, 13, 14, 15, 16, 17, 18, 24, 26, 30, 37, 40, 42, 44, 47], "exclus": [1, 2, 3, 10, 11, 15, 42, 47], "zone": [1, 3, 10, 11, 15, 42, 47], "str": [1, 3, 5, 6, 7, 8, 9, 10, 13, 15, 16, 17, 18, 19, 23, 24, 26, 30, 31, 32, 33, 41, 43, 45, 46, 47, 49, 50, 51, 54, 56, 57, 58, 66], "distanc": [1, 2, 3, 8, 16, 17, 18, 22, 23, 24, 25, 31, 32, 33, 43, 46, 47, 49, 50, 51, 70, 74, 76, 81], "neighbour": [1, 3], "return": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 54, 55, 56, 57, 58, 59, 66, 67, 68, 69, 71, 79, 81, 83], "bool": [1, 2, 3, 4, 7, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 34, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 53, 54, 55, 56, 57, 58, 59], "main": [1, 3, 66, 83], "motif_indici": [1, 3], "indici": [1, 3, 10, 15, 34, 36], "motif_dist": [1, 3], "refer": [1, 2, 3, 8, 11, 14, 15, 16, 17, 20, 21, 22, 23, 26, 30, 32, 33, 40, 41, 44, 46, 47, 49, 51, 71, 80], "yeh": [1, 3, 11, 15], "c": [1, 3, 11, 15, 16, 17, 56, 58, 70, 83, 84], "m": [1, 3, 11, 14, 15, 32, 33, 70, 71, 84], "2016": [1, 3, 11, 15], "similar": [1, 3, 11, 15, 19, 23, 42, 47, 67, 70, 71, 75, 83], "join": [1, 2, 3, 11, 15, 42, 47], "unifi": [1, 3, 11, 15], "view": [1, 3, 11, 15], "discord": [1, 3, 11, 15], "In": [1, 2, 3, 8, 11, 13, 14, 15, 16, 17, 22, 23, 26, 27, 28, 29, 30, 41, 47, 48, 49, 50, 51, 62, 65, 66, 67, 68, 70, 71, 73, 79, 81, 83], "ieee": [1, 3, 11, 15, 22, 23, 70], "16th": [1, 3, 11, 15], "intern": [1, 2, 3, 11, 14, 15, 16, 17, 22, 23, 50, 51, 70, 71], "confer": [1, 2, 3, 11, 14, 15, 22, 23, 70, 71], "data": [1, 2, 3, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 22, 23, 26, 27, 28, 29, 30, 31, 33, 35, 36, 39, 40, 41, 42, 43, 44, 45, 47, 48, 49, 50, 51, 56, 58, 66, 67, 68, 70, 71, 79], "mine": [1, 2, 3, 11, 15, 16, 17, 22, 23, 26, 30, 40, 41, 44, 47, 49, 51, 71], "icdm": [1, 3, 11, 15, 22, 23], "mpi": [2, 3, 11, 15], "n_segment": [2, 3], "boundri": [2, 3], "return_arc_curv": [2, 3], "If": [2, 3, 4, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 66, 68, 71, 79, 84], "index": [2, 3, 10, 11, 13, 14, 15, 16, 17, 18, 21, 24, 48, 49, 50, 51, 65, 69, 71], "must": [2, 3, 8, 14, 18, 24, 32, 33, 41, 44, 68, 70, 79, 84], "unless": [2, 3, 16, 17, 43, 46, 47, 48, 49, 50, 51, 56, 58, 68, 70], "identifi": [2, 3, 16, 17, 46, 47, 50, 51, 56, 58, 65, 68, 71, 83], "ignor": [2, 3, 10, 13, 14, 15, 16, 17, 18, 24, 32, 33, 34, 36, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 55, 65], "self": [2, 3, 4, 11, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 66], "region": [2, 3, 83], "around": [2, 3, 13, 15, 31, 33], "express": [2, 3, 8, 11, 15, 16, 17, 32, 33, 42, 47, 50, 51, 66, 68], "arc": [2, 3], "curv": [2, 3], "start": [2, 3, 10, 15, 18, 24], "arc_curv": [2, 3], "gharghabi": [2, 3], "shaghayegh": [2, 3], "2017": [2, 3], "viii": [2, 3], "domain": [2, 3, 57], "onlin": [2, 3], "semant": [2, 3], "superhuman": [2, 3], "perform": [2, 3, 13, 15, 16, 17, 32, 33, 41, 44, 47, 55, 56, 58, 62, 66, 67, 71, 75], "level": [2, 3], "proceed": [2, 3, 8, 70, 71, 79], "get_metadata_rout": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "metadata": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "rout": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "thi": [4, 6, 7, 8, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 55, 56, 58, 62, 66, 67, 71, 75, 80, 81, 83, 84], "object": [4, 8, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 34, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 55, 56, 57, 58, 66, 70, 71, 83], "pleas": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 62], "how": [4, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 83], "mechan": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "work": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 71, 81, 83, 84], "metadatarequest": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "encapsul": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "inform": [4, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 83], "get_param": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "deep": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "true": [4, 7, 10, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 34, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 54, 55, 56, 58, 59, 65, 66, 69, 70, 71], "default": [4, 7, 8, 10, 11, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 55, 56, 57, 58, 62, 66, 67, 68, 70, 71, 79, 81, 83], "contain": [4, 7, 8, 10, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 58, 59, 65, 68, 71], "subobject": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "ar": [4, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 34, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 53, 55, 56, 57, 58, 62, 65, 66, 67, 68, 70, 71, 73, 74, 76, 79, 81, 83, 84], "param": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "dict": [4, 5, 6, 7, 10, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 58, 66, 68], "map": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 73], "set_param": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "set": [4, 7, 8, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 34, 35, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 66, 68, 71, 81, 83, 84], "simpl": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 79, 84], "well": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 62], "nest": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "pipelin": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 62, 83], "latter": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "have": [4, 9, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 58, 65, 66, 67, 69, 70, 81, 83, 84], "form": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 83], "compon": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 68], "__": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "so": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 66, 83], "": [4, 8, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 58, 70, 71, 79, 83], "possibl": [4, 11, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 73, 84], "updat": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "instanc": [4, 8, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 55, 56, 58, 68], "counterfactu": [4, 24, 25, 32, 33, 83], "explain": [4, 25, 32, 33, 83], "term": [4, 16, 17, 20, 21, 22, 23, 44, 47, 69, 70], "close": [4, 20, 21, 22, 23, 56, 58], "desir": [4, 8, 19, 20, 21, 22, 23, 32, 33, 40, 47, 71, 79], "counterfact": [4, 20, 21, 22, 23], "closensess": [4, 20, 21, 22, 23], "fit_explain": [4, 18, 20, 21, 22, 23, 24], "kwarg": [4, 7, 18, 20, 21, 22, 23, 24], "argument": [4, 7, 16, 17, 18, 19, 20, 21, 22, 23, 24, 43, 46, 47, 49, 50, 51, 54, 68, 70, 71, 81, 83, 84], "ax": [4, 18, 20, 21, 22, 23, 24, 57, 67], "make_dict_filt": 5, "filter": [5, 7, 16, 17, 44, 47, 83], "make": [5, 56, 58, 62, 70], "new": [5, 7, 13, 15, 16, 17, 19, 21, 22, 23, 34, 36, 55, 62, 67, 83, 84], "subject": 5, "op": 5, "verb": 5, "callabl": [5, 7, 9, 10, 15, 18, 19, 22, 23, 24, 26, 30, 31, 32, 33, 54], "make_filt": 5, "creat": [5, 7, 8, 16, 17, 21, 48, 49, 50, 51, 62, 65, 68, 84], "make_list_filt": 5, "base": [5, 6, 7, 8, 14, 16, 17, 18, 19, 23, 25, 26, 29, 30, 32, 33, 37, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51, 53, 68, 70, 81, 84], "string": [5, 7, 16, 17, 26, 30, 43, 46, 47, 49, 50, 51, 66, 67, 68], "make_str_filt": 5, "version": [6, 7, 13, 15, 16, 17, 19, 22, 23, 27, 28, 29, 30, 39, 41, 42, 43, 45, 47, 48, 49, 50, 51, 68, 79, 83, 84], "tag": [6, 7, 55, 68], "descript": [6, 7, 8, 54, 68, 79], "uniqu": [6, 7, 32, 33, 68], "human": [6, 7], "readabl": [6, 7], "get_collect": [6, 7], "get_filenam": [6, 7], "ext": [6, 7], "extens": [6, 7, 68], "filenam": [6, 7], "archiv": [6, 7, 62], "zipfil": [6, 7], "sort": [6, 7, 16, 17], "zip": [6, 7, 66, 68], "n_training_sampl": [6, 7], "url": [6, 7, 68], "properti": [6, 7, 16, 17, 41, 44], "download_url": [6, 7], "templat": [6, 7], "download": [6, 7, 66, 68, 84], "wildboar_requir": [6, 7, 68], "requir": [6, 7, 8, 13, 14, 15, 16, 17, 26, 27, 28, 29, 30, 48, 49, 50, 51, 56, 58, 66, 68, 71, 79, 81, 84], "min": [6, 7, 9, 13, 14, 15, 50, 51, 57, 65, 71], "timeout": [6, 7, 68], "abstract": [6, 7, 21, 45], "util": [7, 8, 9, 16, 17, 25, 50, 51, 69, 71], "outlier": [7, 16, 17, 25, 32, 33, 34, 35, 36, 68], "preprocess": [7, 18, 24, 25, 45, 47, 62, 66, 67, 83], "cache_dir": [7, 68], "keep_last_vers": 7, "keep": [7, 16, 17, 27, 28, 29, 30, 48, 50, 51], "latest": [7, 68], "json": 7, "request": [7, 8, 66, 68, 71, 79, 84], "ucr": [7, 62, 66, 68, 71, 83], "tini": [7, 66, 68], "format": [7, 13, 15, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 68], "bake": [7, 83], "off": [7, 83], "create_cache_dir": 7, "progress": 7, "forc": [7, 56, 58, 66], "where": [7, 8, 10, 14, 15, 16, 17, 27, 28, 29, 30, 32, 33, 35, 36, 38, 41, 43, 46, 47, 48, 49, 50, 51, 57, 62, 65, 68, 70, 71, 81, 83, 84], "wildboar_cach": 7, "miss": [7, 65, 69], "show": [7, 14, 57, 62], "bar": 7, "while": [7, 16, 17, 48, 49, 50, 51, 66, 68, 83, 84], "re": [7, 13, 15, 16, 17, 66], "we": [7, 16, 17, 32, 33, 41, 43, 46, 47, 49, 50, 51, 55, 56, 57, 58, 62, 65, 66, 67, 68, 70, 71, 73, 79, 81, 83, 84], "can": [7, 8, 16, 17, 27, 28, 29, 30, 40, 47, 48, 49, 50, 51, 54, 57, 62, 65, 66, 67, 68, 69, 70, 71, 73, 79, 83, 84], "also": [7, 32, 33, 48, 49, 50, 51, 55, 62, 66, 69, 70, 71, 76, 79, 81, 83, 84], "ani": [7, 8, 48, 49, 50, 51, 68, 69, 70], "newli": 7, "ad": [7, 16, 17, 50, 51], "still": [7, 84], "pend": 7, "dtype": [7, 13, 15, 56, 57, 58, 65, 66], "contigu": [7, 56, 58, 83], "merge_train_test": [7, 66, 68, 83], "return_extra": 7, "read": [7, 10, 13, 15, 16, 17, 23, 31, 32, 33, 43, 46, 47, 49, 50, 51, 71, 83], "type": [7, 56, 57, 58, 76, 83], "_preprocess": 7, "take": [7, 41, 47, 48, 49, 50, 51, 68, 70], "np": [7, 8, 13, 14, 15, 16, 17, 18, 24, 32, 33, 41, 43, 46, 47, 49, 50, 51, 56, 57, 58, 59, 65, 67, 71], "ensur": [7, 19, 23, 34, 36, 56, 58, 68], "memori": [7, 16, 17, 56, 58, 71, 81, 83], "merg": [7, 49, 51, 68, 70], "exist": [7, 34, 36, 66, 81, 83], "partit": [7, 13, 15, 62, 83], "alreadi": [7, 66, 84], "4": [7, 8, 14, 16, 17, 18, 24, 40, 41, 44, 45, 47, 59, 62, 65, 70, 71, 79, 81], "x_train": [7, 16, 17, 35, 36, 62, 66, 68, 83], "x_test": [7, 16, 17, 35, 36, 62, 66, 68, 83], "y_train": [7, 16, 17, 35, 36, 62, 66, 68, 83], "y_test": [7, 16, 17, 35, 36, 62, 66, 68, 83], "syntheticcontrol": [7, 66, 68], "600": [7, 66], "origin": [7, 16, 17, 18, 19, 23, 24, 26, 30, 32, 33, 37, 44, 47, 56, 58, 62, 81, 83], "preserv": [7, 56, 57, 58, 83], "specif": [7, 16, 17, 43, 46, 47, 49, 50, 51, 55, 56, 58, 66, 67, 68, 81, 84], "doe": [7, 8, 34, 36, 40, 47, 71, 83], "shown": [7, 18, 24], "onli": [7, 11, 14, 15, 16, 17, 18, 19, 22, 23, 24, 48, 49, 50, 51, 56, 58, 62, 66, 67, 68, 70, 71, 81, 83, 84], "yield": [7, 34, 36, 55, 67], "those": 7, "which": [7, 8, 13, 14, 15, 16, 17, 21, 23, 26, 27, 28, 29, 30, 32, 33, 41, 47, 48, 49, 50, 51, 62, 66, 68, 69, 70, 71, 79, 81, 83, 84], "f": [7, 8, 16, 17, 26, 30, 40, 41, 47, 49, 51, 54, 56, 58, 67, 70, 79, 83], "attribut": [7, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 37, 40, 44, 46, 47, 48, 49, 50, 51, 53, 66, 68, 74, 83], "comparison": [7, 66], "spec": 7, "conjunct": 7, "part": [7, 62, 66, 67, 68, 69, 71], "depend": [7, 8, 10, 11, 15, 41, 47, 65, 71, 83, 84], "tupl": [7, 14, 16, 17, 43, 46, 47, 49, 50, 51, 55, 58, 81], "last": [7, 67, 68, 71, 83], "element": [7, 16, 17, 38, 43, 46, 47, 49, 50, 51, 54, 59], "print": [7, 13, 15, 22, 23, 66, 83], "beef": [7, 66, 68], "470": [7, 66], "coffe": [7, 66, 68], "56": [7, 66], "286": [7, 66], "150": [7, 41, 47, 66], "1162": [7, 66], "82": [7, 66], "than": [7, 8, 10, 15, 16, 17, 50, 51, 57, 66, 69, 70, 71, 83], "call": [7, 16, 17, 27, 28, 29, 30, 48, 50, 51, 55, 68], "without": [7, 54, 62, 65, 68, 70], "reset": [7, 68], "root": [7, 18, 24], "n_outlier": [8, 34, 36, 79], "05": [8, 14, 16, 17, 21, 23, 34, 35, 36, 41, 47, 70, 79], "dbscan": 8, "ep": 8, "min_sampl": 8, "5": [8, 11, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 27, 30, 32, 33, 41, 44, 47, 50, 51, 57, 62, 70, 71, 79], "metric": [8, 10, 13, 15, 16, 17, 18, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 43, 46, 47, 48, 49, 50, 51, 81], "euclidean": [8, 10, 13, 15, 16, 17, 18, 21, 22, 23, 24, 28, 30, 31, 32, 33, 46, 47, 50, 51, 70, 71], "max_ep": 8, "inf": [8, 56, 58], "random_st": [8, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 33, 34, 35, 36, 37, 40, 41, 43, 44, 46, 47, 49, 50, 51, 62], "densiti": 8, "fail": 8, "assign": [8, 13, 15, 79, 83], "By": [8, 16, 17, 18, 24, 26, 30, 40, 43, 45, 47, 49, 51, 56, 57, 58, 65, 68, 71, 79, 81, 83], "class": [8, 35, 68, 79, 83], "consid": [8, 10, 15, 16, 17, 32, 33, 35, 36, 49, 51, 83], "optic": 8, "when": [8, 11, 13, 15, 16, 17, 18, 22, 23, 24, 27, 28, 29, 30, 31, 33, 42, 45, 47, 48, 50, 51, 55, 56, 57, 58, 66, 68, 70, 71, 81, 83], "cluter": 8, "randomst": [8, 13, 14, 15, 16, 17, 18, 19, 22, 23, 24, 26, 30, 31, 33, 34, 35, 36, 37, 40, 41, 43, 44, 46, 47, 49, 50, 51], "seed": [8, 16, 17, 18, 24, 26, 30, 37, 40, 41, 44, 46, 47, 49, 50, 51, 83], "x_outlier": [8, 79], "n_inlier": [8, 34, 36], "y_outlier": [8, 79], "labl": 8, "confusion_estim": 8, "difficulty_estim": 8, "transform": [8, 9, 13, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 32, 33, 50, 51, 55, 79, 81], "simplest": [8, 66, 79], "variat": [8, 79], "tight": [8, 79], "emmott": [8, 78], "2013": [8, 70, 79], "reliabl": [8, 83], "multiclass": [8, 58, 79], "For": [8, 10, 15, 16, 17, 27, 28, 29, 30, 37, 40, 41, 43, 44, 46, 47, 48, 49, 50, 51, 62, 66, 67, 68, 69, 71, 74, 75, 76, 81, 83, 84], "maxim": 8, "confus": [8, 79], "measur": [8, 16, 17, 32, 33, 43, 46, 47, 49, 50, 51, 70, 81], "digit": 8, "rang": [8, 16, 17, 43, 46, 47, 48, 49, 50, 51, 67, 71, 79], "accord": [8, 10, 11, 15, 16, 17, 44, 45, 47, 50, 51, 57, 68, 79], "final": [8, 16, 17, 55, 62], "either": [8, 14, 35, 36, 46, 47, 48, 49, 50, 51, 58, 66, 68, 71, 79, 83], "dispers": [8, 79], "guarante": [8, 83], "error": [8, 16, 17, 56, 58], "rais": [8, 56, 58], "ha": [8, 16, 17, 32, 33, 41, 45, 47, 49, 50, 51, 54, 56, 57, 58, 62, 63, 65, 68, 70, 71, 81], "few": [8, 32, 33, 84], "n_class": [8, 13, 15, 16, 17, 48, 49, 50, 51], "predict_proba": [8, 13, 15, 16, 17, 48, 49, 50, 51], "logist": [8, 79], "rbf": [8, 79], "befor": [8, 13, 15, 26, 30, 81, 84], "otherwis": [8, 16, 17, 32, 33, 56, 58], "suppli": [8, 18, 19, 23, 24], "hardest": [8, 79], "point": [8, 14, 48, 50, 51, 66, 68, 70, 79, 83], "quantiz": [8, 79], "should": [8, 16, 32, 33, 35, 36, 67, 68, 70, 83], "len": [8, 10, 13, 15, 18, 24], "denot": [8, 35, 36, 67, 70, 71], "simpler": 8, "multipl": [8, 16, 17, 18, 24, 43, 46, 47, 50, 51, 65, 68, 71, 79, 81, 83], "e": [8, 14, 16, 17, 22, 23, 32, 33, 50, 51, 56, 58, 65, 66, 67, 68, 70, 71, 79, 83, 84], "g": [8, 13, 14, 15, 21, 23, 26, 30, 40, 46, 47, 66, 67, 70, 71, 79, 83, 84], "would": [8, 16, 17, 27, 28, 29, 30, 43, 46, 47, 48, 49, 50, 51, 67], "mix": 8, "easi": [8, 57, 66], "difficult": [8, 79], "16": [8, 79], "3": [8, 14, 16, 17, 41, 44, 47, 56, 58, 59, 62, 65, 67, 69, 70, 71, 79, 81], "percentil": [8, 16, 17, 79], "procedur": 8, "effect": [8, 16, 17, 45, 47, 49, 51, 56, 58, 81], "closest": [8, 13, 15, 21, 32, 33], "facil": 8, "locat": [8, 68, 71, 84], "thei": [8, 16, 17, 43, 47, 48, 49, 50, 51, 68, 71], "distribut": [8, 16, 17, 26, 30, 40, 44, 45, 47, 48, 49, 50, 51, 66, 84], "among": [8, 21], "avail": [8, 68, 76], "suffici": 8, "fewer": [8, 32, 33], "mai": [8, 16, 17, 27, 28, 29, 30, 48, 50, 51, 81], "note": [8, 11, 14, 15, 16, 17, 22, 23, 27, 28, 29, 30, 31, 32, 33, 34, 36, 40, 41, 47, 48, 50, 51, 57, 67, 71], "packag": [8, 66, 79, 84], "networkx": [8, 79], "da": [8, 70, 79], "dietterich": [8, 79], "t": [8, 13, 15, 16, 17, 26, 27, 28, 29, 30, 32, 33, 40, 41, 42, 44, 46, 47, 48, 49, 50, 51, 56, 58, 70, 71, 79, 81, 84], "fern": [8, 79], "wong": [8, 79], "w": [8, 13, 14, 15, 16, 17, 26, 27, 28, 29, 30, 48, 49, 50, 51, 66, 68, 79], "systemat": [8, 79], "anomali": [8, 35, 36, 79], "benchmark": [8, 66, 75, 78], "real": [8, 16, 17, 65, 70, 79], "acm": [8, 70, 71, 79], "sigkdd": [8, 71, 79], "workshop": [8, 79], "pp": [8, 71, 79], "21": [8, 79], "n_cluster": [8, 13, 15], "farther": 8, "other": [8, 13, 15, 34, 36, 62, 66, 68, 71, 79, 83], "satisfi": [8, 70], "constraint": [8, 53], "allow": [8, 41, 47, 48, 49, 50, 51, 55, 56, 58, 68, 79, 83], "n_dim": [9, 10, 11, 15, 32, 33, 35, 36, 42, 47, 48, 49, 50, 51, 65, 66, 67, 69, 71, 81, 83], "max": [9, 14, 50, 51, 57, 70, 71], "result": [9, 16, 17, 19, 21, 23, 35, 36, 38, 46, 47, 48, 49, 50, 51, 56, 57, 58, 59, 62, 67, 70, 79], "zero": [9, 16, 17, 26, 30, 40, 44, 47, 48, 49, 50, 51, 67, 70, 83], "unit": [9, 26, 30, 40, 47, 67, 70, 83], "deviat": [9, 14, 26, 30, 40, 41, 47, 79], "n_shortest": 9, "dim": [10, 11, 15, 67, 71, 81], "warn": [10, 15, 56, 58, 81], "metric_param": [10, 13, 15, 16, 17, 18, 23, 24, 28, 30, 31, 32, 33, 43, 46, 47, 49, 50, 51, 70, 71, 81], "n_job": [10, 11, 13, 15, 16, 17, 26, 27, 28, 29, 30, 37, 40, 41, 42, 43, 44, 46, 47, 52, 62], "broadcast": [10, 11, 15, 19, 23, 71], "full": [10, 15, 32, 33, 41, 47, 66, 71, 81, 83], "_metric": [10, 15, 23, 32, 33], "about": [10, 13, 15, 16, 17, 23, 31, 32, 33, 41, 43, 44, 46, 47, 49, 50, 51, 56, 58, 71, 83], "parallel": [10, 13, 15, 16, 17, 26, 30, 37, 40, 44, 46, 47, 52], "job": [10, 11, 13, 15, 16, 17, 26, 30, 37, 40, 42, 44, 46, 47, 52], "ndim": [10, 15, 56, 58, 83], "scalar": [10, 15, 54, 57, 71], "return_index": [10, 11, 14, 15, 71], "m_timestep": [10, 14, 15], "search": [10, 15, 48, 49, 50, 51, 70], "_subsequence_metr": [10, 15], "mani": [10, 15, 16, 17, 56, 58, 62, 67, 71], "equal": [10, 15, 16, 17, 43, 47, 48, 49, 50, 51, 65, 66, 70, 79], "good": [10, 15, 22, 23, 32, 33, 79], "first": [10, 11, 14, 15, 16, 17, 40, 43, 46, 47, 49, 50, 51, 56, 58, 68, 69, 71, 79, 84], "run": [10, 13, 15, 16, 17, 22, 23, 26, 30, 37, 40, 44, 46, 47, 55, 66, 67, 84], "dist": [10, 15, 50, 51, 71], "minumum": [10, 15, 57], "posit": [10, 13, 15, 16, 17, 18, 22, 23, 24, 26, 30, 37, 40, 44, 47, 62, 70], "threshold": [10, 15, 16, 17, 18, 21, 22, 23, 24, 45, 50, 51, 74, 76, 81], "max_match": [10, 15], "less": [10, 15, 16, 17, 50, 51, 66, 67, 83], "behaviour": [10, 15], "order": [10, 15, 16, 17, 26, 30, 32, 33, 39, 40, 47, 48, 49, 50, 51, 56, 57, 58, 65, 71, 83], "occurr": [10, 15], "top": [10, 15, 18, 24], "length": [10, 15, 16, 17, 50, 51, 54, 56, 58, 59, 67, 69, 70], "below": [10, 15, 68], "n_match": [10, 15], "x_sampl": [10, 15, 71], "y_sampl": [10, 15, 71], "n_subsequ": [10, 15, 71], "yn_timestep": [10, 11, 15], "closer": [10, 15, 21, 32, 33], "treshold": [10, 15], "trivial": [10, 11, 15], "vicin": [10, 15], "within": [10, 15, 71], "timestep": [10, 15, 32, 33, 44, 47, 56, 58, 65, 66, 67, 69, 71, 83], "anoth": [10, 15, 68, 79], "higher": [10, 15], "everi": [11, 15, 48, 49, 50, 51, 56, 58, 71], "subsequenec": [11, 15], "xn_timestep": [11, 15], "second": [11, 14, 15, 16, 17, 43, 46, 47, 49, 50, 51, 68, 71], "8": [13, 14, 15, 26, 30, 40, 41, 47, 57, 62, 81], "r": [13, 14, 15, 16, 17, 21, 23, 26, 27, 28, 29, 30, 41, 43, 46, 47, 48, 49, 50, 51, 70, 84], "init": [13, 14, 15], "n_init": [13, 15], "max_it": [13, 15, 21, 23], "300": [13, 15, 83], "tol": [13, 14, 15], "001": [13, 15, 70], "verbos": [13, 14, 15, 16, 17, 21, 22, 23, 84], "dtw": [13, 15, 21, 25, 46, 47, 49, 50, 51, 70, 71, 81], "softdtw": [13, 15], "penalti": [13, 14, 15, 70], "tradit": [13, 15, 62, 67, 70, 79, 81], "initi": [13, 14, 15, 21, 68], "randomli": [13, 15, 41, 46, 47, 76], "centroid": [13, 15], "iter": [13, 15, 26, 30, 34, 36, 66], "toler": [13, 15, 32, 33, 70], "declar": [13, 15, 68], "converg": [13, 15], "consecut": [13, 15], "diagnost": [13, 15], "messag": [13, 15, 56, 58], "dure": [13, 15, 22, 23], "determin": [13, 15, 16, 17, 19, 22, 23, 26, 27, 28, 29, 30, 31, 33, 34, 36, 41, 47, 48, 50, 51, 68, 79], "n_iter_": [13, 15], "cluster_centers_": [13, 15], "center": [13, 15], "labels_": [13, 15], "univari": [13, 15, 31, 33, 65, 69, 71, 83], "Not": [13, 15, 16, 17], "fit_predict": [13, 15, 16, 17], "n_featur": [13, 15, 16, 17, 26, 27, 28, 29, 30, 39, 42, 43, 45, 47, 48, 49, 50, 51], "present": [13, 15, 16, 17, 68], "api": [13, 15, 16, 17, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 65, 80, 81, 83], "consist": [13, 15, 16, 17, 22, 23, 27, 28, 29, 30, 48, 50, 51, 62, 71], "convent": [13, 15, 16, 17, 55, 56, 58, 66, 74, 83], "int64": [13, 15], "fit_transform": [13, 15, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47], "fit_param": [13, 15, 39, 42, 43, 45, 47], "n_output": [13, 15, 16, 17, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "target": [13, 15, 16, 17, 21, 23, 39, 42, 43, 45, 47, 48, 49, 50, 51, 58, 84], "unsupervis": [13, 15, 16, 17, 39, 42, 43, 45, 47], "addit": [13, 15, 39, 42, 43, 45, 47, 66, 69, 71, 83], "x_new": [13, 15, 39, 42, 43, 45, 47], "n_features_new": [13, 15, 39, 42, 43, 45, 47], "predict": [13, 15, 16, 17, 21, 22, 23, 26, 27, 28, 29, 30, 31, 32, 33, 48, 49, 50, 51, 62, 75], "belong": [13, 15, 83], "set_output": [13, 15, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47], "output": [13, 15, 16, 17, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 56, 58, 62, 71, 83], "introduc": [13, 15, 16, 17, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 50, 51, 62, 63, 81], "panda": [13, 15, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47], "configur": [13, 15, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 71, 75, 83, 84], "datafram": [13, 15, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47], "unchang": [13, 14, 15, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47], "space": [13, 15, 21, 38, 47, 57, 62, 71], "30": [13, 15, 70, 71, 83], "0001": [13, 15], "smallest": [13, 15], "pam": [13, 15], "medoid": [13, 15, 81], "core": [13, 15, 16, 17, 26, 30, 37, 40, 41, 43, 44, 47], "integ": [13, 15, 16, 17, 26, 30, 37, 40, 44, 47, 57, 79], "medoid_indices_": [13, 15], "n_neighbor": [13, 15], "classes_": [13, 15, 16, 17, 21, 23, 48, 49, 50, 51], "shapel": [13, 15], "known": [13, 15], "multivarait": [13, 15], "kneighborclassifi": [13, 15], "multivari": [13, 15, 22, 23, 31, 33, 65, 67, 69, 83], "sample_weight": [13, 14, 15, 16, 17, 26, 27, 28, 29, 30, 32, 33, 48, 49, 50, 51], "accuraci": [13, 15, 16, 17, 26, 27, 28, 29, 30, 32, 33, 48, 49, 50, 51], "multi": [13, 15, 16, 17, 26, 27, 28, 29, 30, 41, 47, 48, 49, 50, 51, 56, 58, 79], "subset": [13, 15, 16, 17, 26, 27, 28, 29, 30, 31, 33, 48, 49, 50, 51], "harsh": [13, 15, 16, 17, 26, 27, 28, 29, 30, 48, 49, 50, 51], "sinc": [13, 15, 16, 17, 19, 23, 26, 27, 28, 29, 30, 41, 47, 48, 49, 50, 51, 67, 71, 79, 83], "you": [13, 15, 16, 17, 26, 27, 28, 29, 30, 48, 49, 50, 51, 81, 83, 84], "correctli": [13, 15, 16, 17, 26, 27, 28, 29, 30, 48, 49, 50, 51, 81], "x_timestep": [14, 71], "y_timestep": [14, 71], "out": [14, 16, 17, 83], "vector": [14, 56, 58], "penal": 14, "store": [14, 16, 17, 66], "instead": [14, 16, 17, 27, 28, 29, 30, 34, 36, 48, 50, 51, 62, 71, 75, 83], "mm": 14, "max_stabl": 14, "learning_r": 14, "decai": 14, "9": [14, 26, 30, 40, 41, 47, 62, 68], "1e": [14, 32, 33], "max_epoch": 14, "50": [14, 66, 71], "return_cost": 14, "control": [14, 16, 17, 18, 22, 23, 24, 26, 30, 37, 40, 43, 44, 47, 84], "exp": [14, 16, 17, 50, 51], "influenc": [14, 16, 17, 27, 28, 29, 30, 48, 50, 51], "much": [14, 32, 33, 81], "contribut": 14, "ssg": 14, "minim": 14, "equival": 14, "stochast": 14, "subgradi": 14, "epoch": 14, "lowest": [14, 62], "cost": [14, 22, 23, 70, 71], "rate": 14, "minmum": 14, "runtim": 14, "pseudo": [14, 19, 22, 23], "dataset": [14, 16, 17, 18, 24, 25, 26, 30, 35, 36, 37, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 62, 65, 67, 68, 71, 79], "27442791e": 14, "01": [14, 41, 47], "19807473e": 14, "02": [14, 41, 47], "77490053e": 14, "60441308e": 14, "31930140e": 14, "17437783e": 14, "43925941e": 14, "60983434e": 14, "72118437e": 14, "7": [14, 16, 17, 41, 44, 47, 62, 71], "73352049e": 14, "56701557e": 14, "53269314e": 14, "33366128e": 14, "09010828e": 14, "97539989e": 14, "71443248e": 14, "42492836e": 14, "71408958e": 14, "82518334e": 14, "35671953e": 14, "26442901e": 14, "38342948e": 14, "11248815e": 14, "99355168e": 14, "00": [14, 41, 47], "08588712e": 14, "35954194e": 14, "78345146e": 14, "41023092e": 14, "99915956e": 14, "82717462e": 14, "71687181e": 14, "55819192e": 14, "28805337e": 14, "06653283e": 14, "25159669e": 14, "02389872e": 14, "39410523e": 14, "34687887e": 14, "03": 14, "98654485e": 14, "85832342e": 14, "6": [14, 41, 47, 62, 65, 70, 71, 83], "56436416e": 14, "25302660e": 14, "77697444e": 14, "24606299e": 14, "76357782e": 14, "27083874e": 14, "44590342e": 14, "64184026e": 14, "03608265e": 14, "13964118e": 14, "33595675e": 14, "09954847e": 14, "61924171e": 14, "47433305e": 14, "29583168e": 14, "00425122e": 14, "80524683e": 14, "70210329e": 14, "40259039e": 14, "59657389e": 14, "52170730e": 14, "54666287e": 14, "93690730e": 14, "23968406e": 14, "upper": [14, 16, 17, 34, 36, 43, 44, 46, 47, 49, 50, 51, 71], "keogh": [14, 71], "2002": 14, "28th": 14, "veri": [14, 62, 67, 70], "larg": [14, 57, 66, 70, 74], "same": [14, 16, 17, 18, 24, 32, 33, 48, 49, 50, 51, 57, 62, 67, 68, 70, 71, 81, 83], "min_dist": 14, "cumul": 14, "step": [14, 62, 66, 67, 83], "precomput": [14, 16, 17, 27, 28, 29, 30, 48, 50, 51], "x_indic": 14, "y_indic": 14, "provid": [14, 21, 41, 44, 68, 70, 83, 84], "n": [14, 71, 79, 83], "omitaomu": 14, "o": [14, 16, 17, 21, 49, 51, 71], "2021": [14, 32, 33], "pattern": [14, 70, 79], "recognit": 14, "44": 14, "2231": 14, "2240": 14, "diagon": 14, "raec1aca773": 14, "n_estim": [16, 17], "max_sampl": [16, 17], "bootstrap": [16, 17], "oob_scor": [16, 17], "class_weight": [16, 17, 26, 27, 28, 29, 30, 49, 50, 51], "warm_start": [16, 17], "base_estim": [16, 17, 81], "deprec": [16, 17, 19, 23, 41, 47, 49, 50, 51, 81], "meta": [16, 17], "draw": [16, 17], "drawn": [16, 17], "replac": [16, 17, 32, 33, 68, 84], "balanc": [16, 17, 26, 30, 49, 50, 51], "associ": [16, 17, 26, 30, 49, 50, 51], "invers": [16, 17, 49, 50, 51], "proport": [16, 17, 49, 50, 51], "frequenc": [16, 17, 49, 50, 51, 57], "reus": [16, 17, 67, 83], "solut": [16, 17], "previou": [16, 17, 67], "add": [16, 17, 22, 23, 55, 57, 81], "just": [16, 17, 65, 84], "whole": [16, 17], "resampl": [16, 17, 18, 24, 26, 30, 37, 44, 47], "been": [16, 17, 41, 47, 57, 70, 81], "remov": [16, 17, 19, 23, 50, 51, 54, 81], "base_estimator_": [16, 17], "grow": [16, 17], "estimators_samples_": [16, 17], "member": [16, 17], "reduc": [16, 17, 41, 47, 66], "footprint": [16, 17], "thu": [16, 17], "fetch": [16, 17, 84], "slower": [16, 17, 71], "expect": [16, 17, 27, 28, 29, 30, 42, 47, 48, 50, 51, 67, 79, 83], "decision_funct": [16, 17, 32, 33], "decis": [16, 17, 22, 23, 48, 49, 50, 51, 74], "function": [16, 17, 22, 40, 41, 62, 66, 67, 68, 70, 71, 83], "spars": [16, 17, 48, 49, 50, 51, 56, 58, 62], "matric": [16, 17], "accept": [16, 17, 26, 30, 40, 47, 56, 58, 66, 67, 68, 71, 83], "column": [16, 17, 56, 58, 68, 69], "correspond": [16, 17, 26, 30, 32, 33, 48, 49, 50, 51, 62], "appear": [16, 17], "special": [16, 17, 83], "case": [16, 17, 70], "build": [16, 17, 49, 51, 83], "highest": [16, 17, 62], "do": [16, 17, 48, 49, 50, 51, 70, 71, 81, 84], "resort": [16, 17], "vote": [16, 17], "predict_log_proba": [16, 17], "log": [16, 17, 41, 47, 81], "p": [16, 17, 20, 21, 22, 23, 32, 33, 70, 71], "repres": [16, 17, 65, 69, 70, 75], "100": [16, 17, 18, 21, 23, 24, 43, 47, 49, 51, 57, 66], "defin": [16, 17, 27, 28, 29, 30, 39, 43, 45, 46, 47, 48, 49, 50, 51, 68], "frac": [16, 17, 27, 28, 29, 30, 48, 50, 51], "u": [16, 17, 27, 28, 29, 30, 48, 50, 51], "v": [16, 17, 27, 28, 29, 30, 48, 50, 51, 68, 70], "residu": [16, 17, 27, 28, 29, 30, 48, 50, 51], "sum": [16, 17, 27, 28, 29, 30, 48, 50, 51], "squar": [16, 17, 18, 24, 27, 28, 29, 30, 48, 50, 51], "y_true": [16, 17, 27, 28, 29, 30, 48, 50, 51], "y_pred": [16, 17, 27, 28, 29, 30, 48, 50, 51], "total": [16, 17, 27, 28, 29, 30, 48, 50, 51], "neg": [16, 17, 27, 28, 29, 30, 48, 49, 50, 51], "becaus": [16, 17, 27, 28, 29, 30, 48, 50, 51], "arbitrarili": [16, 17, 27, 28, 29, 30, 48, 50, 51], "wors": [16, 17, 27, 28, 29, 30, 48, 50, 51], "constant": [16, 17, 27, 28, 29, 30, 48, 50, 51], "alwai": [16, 17, 27, 28, 29, 30, 34, 36, 48, 50, 51, 70], "disregard": [16, 17, 27, 28, 29, 30, 48, 50, 51], "some": [16, 17, 27, 28, 29, 30, 48, 50, 51, 55, 56, 58, 65, 66, 69, 84], "n_samples_fit": [16, 17, 27, 28, 29, 30, 48, 50, 51], "multioutput": [16, 17, 27, 28, 29, 30, 48, 50, 51], "uniform_averag": [16, 17, 27, 28, 29, 30, 48, 50, 51], "23": [16, 17, 27, 28, 29, 30, 48, 50, 51], "r2_score": [16, 17, 27, 28, 29, 30, 48, 50, 51], "except": [16, 17, 27, 28, 29, 30, 48, 50, 51, 68, 79], "multioutputregressor": [16, 17, 27, 28, 29, 30, 48, 50, 51], "baseforestclassifi": 16, "estimator_param": 16, "max_depth": [16, 17, 48, 49, 50, 51], "min_samples_split": [16, 17, 48, 49, 50, 51], "min_samples_leaf": [16, 17, 48, 49, 50, 51, 81], "min_impurity_decreas": [16, 17, 48, 49, 50, 51], "criterion": [16, 17, 49, 50, 51, 81], "entropi": [16, 17, 49, 50, 51], "tree": [16, 17, 25, 74, 81], "baseforestregressor": 16, "squared_error": [16, 17, 50, 51], "baseshapeletforestclassifi": 16, "n_shapelet": [16, 17, 18, 24, 28, 30, 46, 47, 50, 51, 81], "log2": [16, 17, 18, 24, 32, 33, 41, 45, 47, 50, 51, 81], "min_shapelet_s": [16, 17, 18, 21, 23, 24, 28, 30, 46, 47, 50, 51], "max_shapelet_s": [16, 17, 18, 21, 23, 24, 28, 30, 46, 47, 50, 51], "directli": [16, 62, 68], "baseshapeletforestregressor": 16, "depth": [16, 17, 49, 50, 51, 84], "expand": [16, 17, 50, 51], "until": [16, 17, 50, 51], "leav": [16, 17, 48, 49, 50, 51], "pure": [16, 17, 50, 51], "node": [16, 17, 44, 47, 48, 49, 50, 51], "leaf": [16, 17, 48, 49, 50, 51], "impur": [16, 17, 49, 50, 51], "decreas": [16, 17, 49, 50, 51], "larger": [16, 17, 32, 33, 50, 51, 57, 69, 83], "grid": [16, 17, 43, 46, 47, 49, 50, 51], "mandatori": [16, 17, 43, 46, 47, 49, 50, 51], "one": [16, 17, 18, 24, 40, 43, 46, 47, 49, 50, 51, 54, 62, 66, 71, 74, 83], "specifii": [16, 17, 43, 46, 47, 49, 50, 51], "give": [16, 17, 18, 24, 43, 46, 47, 49, 50, 51, 75], "follow": [16, 17, 39, 41, 43, 44, 46, 47, 49, 50, 51, 66, 67, 68, 70, 71, 83, 84], "min_r": [16, 17, 43, 46, 47, 49, 50, 51], "max_r": [16, 17, 43, 46, 47, 49, 50, 51], "num_r": [16, 17, 43, 46, 47, 49, 50, 51], "gini": [16, 17, 49, 50, 51], "scaled_euclidean": [16, 17, 50, 51, 70, 71], "y_hat": [16, 17], "mse": [16, 17, 50, 51, 81], "wa": [16, 17, 19, 23, 50, 51, 81], "v1": [16, 17, 50, 51, 66, 68], "forestmixin": 16, "n_interv": [16, 17, 18, 24, 32, 33, 41, 45, 47, 50, 51, 81], "sqrt": [16, 17, 18, 24, 32, 33, 41, 45, 47, 50, 51], "fix": [16, 17, 41, 47, 50, 51, 81], "summar": [16, 17, 41, 47, 50, 51], "mean_var_std": [16, 17], "sample_s": [16, 17, 31, 33, 41, 47, 50, 51], "min_siz": [16, 17, 41, 44, 47, 50, 51, 81], "max_siz": [16, 17, 41, 44, 47, 50, 51, 81], "contamin": [16, 17, 35, 36], "strategi": [16, 17, 26, 30, 34, 36, 40, 44, 45, 47], "offset": [16, 17], "offset_": [16, 17], "model_select": [16, 17, 25, 62, 83], "sklearn": [16, 17, 31, 33, 40, 47, 56, 58, 62, 79, 83], "balanced_accuracy_scor": [16, 17], "test_siz": [16, 17, 34, 35, 36, 83], "anomalies_train_s": [16, 17, 35, 36], "8674": [16, 17], "n_pivot": [16, 17, 43, 47, 49, 50, 51], "pivot_sampl": [16, 17, 49, 51], "metric_sampl": [16, 17, 43, 47, 49, 51], "metric_factori": [16, 17, 49, 51, 81], "uniform": [16, 17, 43, 44, 45, 47, 49, 51, 67, 71], "parameter": [16, 17, 49, 51], "suggest": [16, 17, 49, 51, 62], "luca": [16, 17, 49, 51], "2019": [16, 17, 41, 47, 49, 51, 84], "2020": [16, 17, 20, 21, 22, 23, 32, 33, 44, 47, 49, 51, 62], "custom": [16, 17, 41, 47, 49, 51], "combin": [16, 17, 21, 41, 47, 49, 51, 62], "sub": [16, 17, 49, 51], "benjamin": [16, 17, 49, 51], "ahm": [16, 17, 49, 51], "shifaz": [16, 17, 49, 51], "charlott": [16, 17, 49, 51], "pelleti": [16, 17, 49, 51], "lachlan": [16, 17, 49, 51], "neill": [16, 17, 49, 51], "nayyar": [16, 17, 49, 51], "zaidi": [16, 17, 49, 51], "bart": [16, 17, 49, 51], "goethal": [16, 17, 49, 51], "fran\u00e7oi": [16, 17, 44, 47, 49, 51], "petitjean": [16, 17, 44, 47, 49, 51], "geoffrei": [16, 17, 44, 47, 49, 51], "webb": [16, 17, 26, 30, 40, 44, 47, 49, 51], "scalabl": [16, 17, 49, 51], "knowledg": [16, 17, 20, 22, 23, 26, 30, 32, 33, 40, 41, 44, 47, 49, 51, 70, 71], "discoveri": [16, 17, 26, 30, 40, 41, 44, 47, 49, 51, 71], "n_kernel": [16, 17, 26, 27, 30, 40, 44, 47, 50, 51, 62], "normal": [16, 17, 18, 24, 26, 27, 28, 29, 30, 35, 36, 40, 44, 45, 47, 50, 51, 57, 62, 67, 70, 81], "sampling_param": [16, 17, 26, 27, 30, 40, 44, 47, 50, 51], "kernel_s": [16, 17, 26, 27, 30, 38, 40, 44, 47, 50, 51, 81], "bias_prob": [16, 17, 27, 30, 44, 47, 50, 51], "normalize_prob": [16, 17, 27, 30, 44, 47, 50, 51], "padding_prob": [16, 17, 27, 30, 44, 47, 50, 51], "11": [16, 17, 44, 47, 62], "13": [16, 17, 44, 47, 62], "bia": [16, 17, 38, 44, 47], "pad": [16, 17, 38, 44, 47, 62], "processor": [16, 17, 46, 47, 84], "alpha": [16, 17, 26, 27, 28, 29, 30, 50, 51, 57], "current": [16, 17, 21, 50, 51, 66, 67, 68, 81, 84], "ab": [16, 17, 50, 51], "toward": [16, 17, 21, 50, 51, 55], "increas": [16, 17, 50, 51], "independeth": [16, 17, 50, 51], "sparse_output": [16, 17], "high": [16, 17], "dimension": [16, 17], "fall": [16, 17, 70, 83], "lead": [16, 17, 81], "code": [16, 17, 67, 71, 81], "ones": [16, 17], "csr": [16, 17], "bin": [18, 24, 45, 47, 57, 79, 84], "n_bin": [18, 24, 32, 33, 45, 47], "n_repeat": [18, 24], "discret": [18, 24, 26, 30, 57, 79], "permut": [18, 24], "show_bin": [18, 24], "show_grid": [18, 24], "scorer": [18, 24, 26, 30], "were": [18, 24, 69], "annot": [18, 24, 25], "axi": [18, 24, 48, 49, 50, 51, 54, 56, 58, 67, 71], "mappabl": [18, 24], "scalarmapp": [18, 24], "colorbar": [18, 24], "specici": [18, 24], "least": [18, 24, 56, 58], "importances_": [18, 24], "components_": [18, 24], "permuteimport": 18, "kernel_scal": [18, 24], "25": [18, 24, 49, 51, 70, 79], "train_x": [19, 23], "train_i": [19, 23], "valid_scor": [19, 23], "method_arg": [19, 23], "basecounterfactu": [19, 23], "infer": [19, 23], "most": [19, 23, 65, 69, 79, 84], "appropri": [19, 23, 69], "_counterfactu": [19, 23], "renam": [19, 23, 41, 47, 81], "success": [19, 23], "stabl": [19, 23, 35, 36, 65], "x_counterfactu": [19, 23, 32, 33], "karlsson": [20, 22, 23, 32, 33], "reban": [20, 22, 23, 32, 33], "j": [20, 22, 23, 32, 33, 71], "papapetr": [20, 22, 23, 32, 33], "gioni": [20, 22, 23, 32, 33], "local": [20, 22, 23, 32, 33], "tweak": [20, 22, 23, 32, 33], "system": [20, 22, 23, 32, 33, 66, 68, 84], "62": [20, 22, 23, 32, 33], "1671": [20, 22, 23, 32, 33], "1700": [20, 22, 23, 32, 33], "explainer_": [20, 23], "dynamictimewarptransform": 21, "gamma": 21, "move": [21, 49, 51, 70], "euclideantransform": 21, "knearestprototypesampl": 21, "prototype_indici": 21, "metric_transform": 21, "prototyp": 21, "new_counterfactu": 21, "nearest_index": 21, "sample_mov": 21, "sampla": 21, "knearestshapeletprototypesampl": 21, "shapeletprototypesampl": 21, "metrictransform": 21, "predictevalu": 21, "probabilityevalu": 21, "step_siz": [21, 23], "n_prototyp": [21, 23], "samsten": [21, 23], "isak": [21, 23], "estimator_": [21, 23], "partitions_": [21, 23], "prototypesampl": [21, 23], "target_": [21, 23], "targetevalu": [21, 23], "prototype_indic": 21, "helper": 21, "wai": [21, 67], "abc": 21, "inherit": 21, "_o": 21, "sample_shapelet": 21, "uniformprototypesampl": 21, "uniformli": [21, 45, 47, 50, 51], "weighteddynamictimewarptransform": 21, "epsilon": [22, 23, 70, 81], "batch_siz": [22, 23], "max_path": [22, 23], "cosin": [22, 23, 70, 71], "manhattan": [22, 23, 70, 71], "degre": [22, 23], "batch": [22, 23, 52], "candid": [22, 23, 32, 33], "subsampl": [22, 23], "stdout": [22, 23], "execut": [22, 23, 52], "differ": [22, 23, 26, 30, 32, 33, 34, 36, 40, 47, 68, 69, 70, 71, 83], "revers": [22, 23], "2018": [22, 23], "via": [22, 23], "irrevers": [22, 23], "paths_": [22, 23], "x_true": 23, "normalized_euclidean": [23, 32, 33, 70, 71], "ensembl": [25, 62, 79, 81, 83], "linear_model": [25, 62, 75, 81, 83], "variable_len": [25, 56, 58, 69], "n_group": [26, 30, 40, 47, 62], "64": [26, 30, 40, 47, 62, 66, 84], "fit_intercept": [26, 27, 28, 29, 30], "cv": [26, 27, 28, 29, 30], "group": [26, 30, 34, 36, 40, 47, 62, 75], "sampler": [26, 30, 40, 47], "half": [26, 30, 62, 71], "n_alpha": [26, 30], "try": [26, 30, 54, 62, 84], "whether": [26, 30, 56, 57, 58], "calcul": [26, 30, 31, 33, 45], "intercept": [26, 30], "signatur": [26, 30], "class_label": [26, 30], "dempster": [26, 30, 40, 44, 47, 81], "schmidt": [26, 30, 40, 46, 47], "d": [26, 30, 32, 33, 40, 41, 47, 66, 68, 70, 71], "2023": [26, 30, 40, 47, 62, 81], "hydra": [26, 30, 40, 47], "compet": [26, 30, 40, 47], "accur": [26, 30, 40, 44, 47, 73], "10000": [27, 30, 62], "gcv_mode": [27, 28, 29, 30], "1000": [28, 30, 44, 46, 47], "basetransformclassifi": 29, "basetransformestim": 29, "basetransformregressor": 29, "transformridgecv": 29, "transformridgeclassifiercv": 29, "conveni": [31, 33, 83], "wrapper": [31, 33, 54], "nativ": [31, 32, 33, 40, 47, 81], "x_factual": [32, 33], "atol": [32, 33], "08": [32, 33], "n_timetep": [32, 33], "overlap": [32, 33, 41, 47], "counterfacut": [32, 33], "factual": [32, 33], "x_plausibl": [32, 33], "y_plausibl": [32, 33], "y_counterfactu": [32, 33], "typic": [32, 33, 71, 83], "m_sampl": [32, 33], "localoutlierfactor": [32, 33], "individu": [32, 33, 67], "plausabl": [32, 33], "incic": [32, 33], "better": [32, 33], "delanei": [32, 33], "green": [32, 33], "kean": [32, 33], "arxiv": [32, 33, 46, 47], "2009": [32, 33], "13211v2": [32, 33], "redund": [32, 33], "impact": [32, 33], "non": [32, 33, 41, 47, 56, 58, 71], "x_nativ": [32, 33], "y_nativ": [32, 33], "captur": [32, 33, 83], "n_nativ": [32, 33], "n_counterfactu": [32, 33], "avareg": [32, 33], "smyth": [32, 33], "b": [32, 33, 71], "interpret": [32, 33, 41, 47], "divers": [32, 33], "2101": [32, 33], "09056v1": [32, 33], "y_predict": [32, 33], "correct": [32, 33, 53, 73], "n_split": [34, 36], "shuffl": [34, 36, 83], "total_n_outli": [34, 36], "psudo": [34, 35, 36], "contrari": [34, 36], "fold": [34, 36], "insert": [34, 36], "repeatedli": [34, 36, 66, 83], "get_n_split": [34, 36], "compat": [34, 36, 37, 40, 41, 43, 44, 46, 47], "train_idx": [34, 36], "test_idx": [34, 36], "normal_class": [35, 36], "state": [35, 36, 43, 47, 67, 75], "anomal": [35, 36], "train_test_split": [35, 36, 62, 83], "baseattributetransform": [37, 40, 41, 43, 44, 46, 47], "engin": [37, 70], "embedding_": [37, 40, 44, 46, 47], "embed": [37, 40, 41, 43, 44, 46, 47, 75], "underli": [37, 40, 44, 46, 47], "n_dimens": [37, 40, 41, 43, 44, 46, 47, 56, 58], "dilat": [38, 47, 62], "stride": [38, 47], "implicit": [38, 47], "side": [38, 47], "output_s": [38, 47], "floor": [38, 47], "get_feature_names_out": [39, 47], "automat": [39, 47, 84], "wrap": [39, 47, 54], "develop": [39, 47, 81, 84], "onetoonefeaturemixin": [39, 47], "classnameprefixfeaturesoutmixin": [39, 47], "help": [39, 47], "descret": [40, 47], "make_pipelin": [40, 47, 62, 83], "make_union": [40, 47, 62], "dempster_hydra": [40, 47], "32": [40, 47, 62, 66], "catch22": [41, 47], "_summar": [41, 47], "x_t": [41, 47], "19633603e": [41, 47], "51047206e": [41, 47], "90000000e": [41, 47], "80000000e": [41, 47], "48441896e": [41, 47], "73293560e": [41, 47], "21476510e": [41, 47], "70000000e": [41, 47], "00000000e": [41, 47], "70502518e": [41, 47], "60000000e": [41, 47], "42857143e": [41, 47], "26666667e": [41, 47], "89974643e": [41, 47], "31570726e": [41, 47], "50000000e": [41, 47], "90873852e": [41, 47], "47311800e": [41, 47], "intervalmixin": 41, "It": [41, 83], "_get_gener": [41, 44], "mean_var_slop": [41, 47, 50, 51], "possibli": [41, 47], "slope": [41, 47], "paralel": [41, 47], "releas": [41, 47], "lock": [41, 47], "gil": [41, 47], "As": [41, 47, 66, 68, 70, 71, 83], "varianc": [41, 47, 67, 70, 83], "suit": [41, 47, 55, 71, 81], "futur": [41, 47, 66, 81], "downstream": [41, 47], "project": [41, 47, 84], "own": [41, 47], "cython": [41, 47, 71], "lubba": [41, 47], "carl": [41, 47], "h": [41, 47], "sarab": [41, 47], "sethi": [41, 47], "philip": [41, 47], "knaut": [41, 47], "simon": [41, 47], "schultz": [41, 47], "ben": [41, 47], "fulcher": [41, 47], "nick": [41, 47], "jone": [41, 47], "canon": [41, 47], "characterist": [41, 47], "33": [41, 47], "1821": [41, 47], "1852": [41, 47], "15": [41, 47], "timepoint": [41, 47], "std": [41, 47, 70], "12": [41, 47, 62, 71, 84], "matrixprofil": [42, 47], "pivotmixin": 43, "rocketmixin": 44, "angu": [44, 47], "exception": [44, 47], "34": [44, 47, 71, 83], "1454": [44, 47], "1495": [44, 47], "51333333": [44, 47], "11526939": [44, 47], "47333333": [44, 47], "04712544": [44, 47], "24": [44, 47], "82912261": [44, 47], "52666667": [44, 47], "26611524": [44, 47], "54": [44, 47, 71], "98047216": [44, 47], "81260641": [44, 47], "54666667": [44, 47], "71210092": [44, 47], "35333333": [44, 47], "28841158": [44, 47], "25333333": [44, 47], "82203705": [44, 47], "72938203": [44, 47], "45333333": [44, 47], "53756324": [44, 47], "24666667": [44, 47], "8380654": [44, 47], "68666667": [44, 47], "80533684": [44, 47], "26": [44, 47, 67], "41709413": [44, 47], "65634235": [44, 47], "66": [44, 47], "94724793": [44, 47], "32666667": [44, 47], "85575661": [44, 47], "67630249": [44, 47], "piecewic": 45, "get_threshold": 45, "suitabl": 45, "normalbin": 45, "assum": [45, 47, 57, 65, 67, 68, 69], "uniformbin": 45, "wistuba": [46, 47], "martin": [46, 47], "josif": [46, 47], "grabocka": [46, 47], "lar": [46, 47], "thiem": [46, 47], "ultra": [46, 47], "preprint": [46, 47], "1503": [46, 47], "05018": [46, 47], "2015": [46, 47], "load_gunpoint": [46, 47], "erp": [46, 47, 70, 71, 81], "min_g": [46, 47], "max_g": [46, 47], "shapeletmixin": [46, 81], "estiom": 46, "basetre": 48, "check_input": [48, 49, 50, 51], "bypass": [48, 49, 50, 51], "sure": [48, 49, 50, 51, 56, 58], "your": [48, 49, 50, 51, 81, 84], "up": [48, 49, 50, 51, 84], "node_count": [48, 49, 50, 51], "tree_": [48, 49, 50, 51], "equvival": [48, 49, 50, 51], "decision_path": [48, 49, 50, 51], "n_node": [48, 49, 50, 51], "nonzero": [48, 49, 50, 51, 65], "travers": [48, 49, 50, 51], "basetreeclassifi": 48, "child": [48, 49, 50, 51], "net": [48, 49, 50, 51], "carri": [48, 49, 50, 51], "don": [48, 49, 50, 51, 84], "know": [48, 49, 50, 51], "what": [48, 49, 50, 51, 79], "basetreeregressor": 48, "msm": [49, 51, 70, 71, 81], "min_c": [49, 51], "max_c": [49, 51], "num_c": [49, 51], "20": [49, 51, 71], "basefeaturetreeclassifi": 50, "basefeaturetreeregressor": 50, "scaled_dtw": [50, 51, 70, 71], "structur": [50, 51], "n_classes_": [50, 51], "run_in_parallel": 52, "parallel_arg": 52, "assert_exhaustive_parameter_check": 53, "assert": 53, "ok": 53, "assert_parameter_check": 53, "skip": [53, 55], "extend": 53, "array_or_scalar": 54, "optional_f": 54, "squeez": 54, "item": 54, "singleton": 54, "recursivlei": 54, "unwrap": 54, "Such": 54, "unstabl": 54, "stabil": 54, "beta": 54, "unsat": 54, "check_estim": 55, "generate_onli": 55, "skip_scikit": 55, "adher": 55, "deleg": [55, 56, 58], "monkei": 55, "patch": 55, "relat": [55, 70], "silent": 55, "tailor": 55, "copi": [56, 58, 71], "ensure_2d": [56, 58], "ensure_ts_arrai": [56, 58], "allow_3d": [56, 58], "allow_nd": [56, 58], "force_all_finit": [56, 58], "multi_output": [56, 58], "ensure_min_sampl": [56, 58], "ensure_min_timestep": [56, 58], "ensure_min_dim": [56, 58], "allow_eo": [56, 58], "y_numer": [56, 58], "y_contigu": [56, 58], "2d": [56, 58, 69, 71, 83], "3d": [56, 58, 69, 71, 83], "finit": [56, 58], "varial": [56, 58], "report": [56, 58, 71], "ravel_1d": [56, 58], "input_nam": [56, 58], "convert": [56, 57, 58, 66, 79], "never": [56, 58, 62, 70], "empti": [56, 58], "attempt": [56, 58], "failur": [56, 58], "convers": [56, 58], "fortran": [56, 58], "style": [56, 58], "noth": [56, 58], "layout": [56, 58], "kept": [56, 58], "trigger": [56, 58], "might": [56, 58], "ravel": [56, 58], "neither": [56, 58], "eo": [56, 58, 59, 65, 67, 69], "nan": [56, 58, 65, 69, 81], "pd": [56, 58], "na": [56, 58], "cannot": [56, 58], "infinit": [56, 58], "row": [56, 58, 69], "disabl": [56, 58, 83], "reject": [56, 58], "enforc": [56, 58], "pass": [56, 58, 71, 79, 81], "midpointnorm": 57, "vmin": 57, "vmax": 57, "midpoint": 57, "normalis": 57, "autoscal": 57, "autoscale_non": 57, "static": 57, "process_valu": 57, "homogen": 57, "effici": [57, 81], "mask": 57, "is_scalar": 57, "byte": 57, "smaller": 57, "float32": 57, "float64": 57, "place": 57, "oper": [57, 66, 67, 68, 83, 84], "greatli": 57, "improv": [57, 66], "speed": 57, "plot_frequency_domain": 57, "jitter": 57, "sample_spac": 57, "cmap": 57, "dark2": 57, "freqenc": 57, "matplotlib": [57, 67], "line": [57, 84], "colormap": 57, "plot_time_domain": 57, "linewidth": 57, "zorder": 57, "show_legend": 57, "opac": 57, "width": 57, "color": 57, "legend": 57, "check_classification_target": 58, "valueerror": 58, "check_opt": 58, "option_valu": 58, "check_typ": 58, "target_typ": 58, "variabl": [59, 69, 84], "get_variable_length": 59, "lenght": 59, "is_end_of_seri": [59, 69], "wise": [59, 67, 83], "is_variable_length": 59, "wildboar": [62, 63, 65, 66, 67, 68, 69, 70, 71, 76, 79, 81, 83], "dempsar": 62, "emploi": 62, "sligtli": 62, "manner": 62, "activ": [62, 84], "record": 62, "exponenti": 62, "Then": [62, 83], "had": 62, "stackingclassifi": 62, "ridgeclassifiercv": 62, "standardscal": 62, "sparsescal": 62, "purpos": [62, 71, 83], "motestrain": 62, "heavi": 62, "here": [62, 68, 84], "impos": 62, "account": 62, "sparsiti": 62, "rememb": 62, "count": 62, "cases": 62, "ridg": [62, 75], "x27": 62, "jupyt": 62, "environ": [62, 84], "rerun": 62, "cell": 62, "html": 62, "trust": [62, 83], "notebook": 62, "On": [62, 70], "github": [62, 84], "unabl": 62, "render": 62, "page": 62, "nbviewer": 62, "org": [62, 68, 84], "pipelinepipelin": 62, "hydratransformhydratransform": 62, "sparsescalersparsescal": 62, "ridgeclassifiercvridgeclassifiercv": 62, "9937106918238994": 62, "similarli": [62, 71], "scaler": 62, "rockettransformrockettransform": 62, "standardscalerstandardscal": 62, "paper": 62, "To": [62, 66, 67, 68, 69, 79, 84], "inflat": 62, "author": 62, "alloc": 62, "concaten": 62, "nth": 62, "hydra_diff": 62, "featureunion": 62, "transformer_list": 62, "featureunionfeatureunion": 62, "hydratransformhydratransformhydratransform": 62, "pipelinedifftransformdifftransform": 62, "9905660377358491": 62, "again": 62, "substitut": 62, "rocket_diff": 62, "5000": 62, "rockettransformrockettransformrockettransform": 62, "14": [62, 71], "limit": 62, "signific": 62, "intend": 63, "offer": [63, 66], "wherea": [65, 74], "context": 65, "multivaret": 65, "howev": [65, 66, 68, 71], "unequ": [65, 67, 70], "ieee754": 65, "treat": 65, "isnan": [65, 69], "wb": 65, "t1": 65, "t2": 65, "t3": 65, "vstack": 65, "pip": [66, 79, 84], "conda": 66, "advanc": 66, "previous": [66, 73, 81, 83], "entri": 66, "hope": 66, "One": [66, 67, 83], "drawback": 66, "asset": 66, "demand": [66, 68], "small": [66, 79], "experi": 66, "brows": 66, "688": 66, "43": 66, "kb": 66, "668": 66, "python": [66, 68, 71, 81, 83, 84], "bit": [66, 84], "conform": 66, "common": [66, 67, 69, 70, 84], "workflow": [66, 71], "comparis": 66, "explanatori": 66, "n_label": 66, "greater": 66, "exactli": [66, 69], "respect": [66, 68, 74], "chain": 66, "large_multivari": 66, "large_multiclass": 66, "0x7f262ce95d00": 66, "predefin": 67, "contrast": 67, "our": 67, "simplifi": [67, 83], "applic": 67, "enumer": [67, 84], "abov": [67, 70, 83], "snippet": [67, 83], "could": 67, "rewritten": 67, "crude": 67, "deal": 67, "longer": 67, "accomplish": [67, 71], "argmax": 67, "pyplot": 67, "plt": 67, "fig": 67, "subplot": 67, "nrow": 67, "scatter": 67, "arang": 67, "marker": 67, "set_ylabel": 67, "spokenarabicdigit": 67, "ucrmt": 67, "figur": 67, "loss": 67, "togeth": 68, "compos": 68, "written": 68, "letter": 68, "regular": 68, "alphanumer": 68, "charact": 68, "za": 68, "z0": 68, "revis": 68, "z": [68, 70], "exemplifi": 68, "hard": 68, "interfac": [68, 83], "endpoint": 68, "http": [68, 84], "www": 68, "repo": 68, "addition": 68, "offlin": 68, "disk": [68, 83], "localappdata": 68, "gnu": [68, 84], "linux": [68, 84], "xdg_cache_hom": 68, "unset": 68, "maco": [68, 84], "librarycach": 68, "fallback": 68, "long": 68, "session": 68, "func": [68, 71], "bundle_url": 68, "example1": 68, "altern": [68, 84], "remot": 68, "sha": 68, "sha1": 68, "hash": 68, "npy": 68, "npz": 68, "save": 68, "savez": 68, "dataset_nam": 68, "_train": 68, "_test": 68, "That": 68, "separ": [68, 79], "embrac": 69, "asarrai": 69, "produc": [69, 73], "rank": 69, "arr": 69, "shorter": [69, 70], "These": 70, "loos": 70, "obei": 70, "inequ": 70, "itself": 70, "distinct": 70, "gt": 70, "ne": 70, "symmetr": 70, "sai": 70, "triangl": [70, 71], "hold": [70, 83], "lt": 70, "shortcut": 70, "through": [70, 84], "three": [70, 71], "categori": [70, 83], "lp": 70, "norm": 70, "shift": 70, "distinguish": 70, "min_": 70, "notat": 70, "_elastic_": 70, "slide": 70, "need": [70, 71, 81, 84], "moreov": 70, "comment": 70, "undefin": 70, "mass": [70, 71], "minkowski": [70, 71], "chebyshev": [70, 71], "angular": [70, 71, 81], "wdtw": [70, 71, 81], "phase": 70, "ddtw": [70, 71], "wddtw": [70, 71], "longest": 70, "lcss": [70, 71, 81], "edit": [70, 84], "gap": 70, "edr": [70, 71, 81], "twe": [70, 71, 81], "edit_penalti": 70, "stiff": [70, 71], "lambda": 70, "nu": 70, "hirschberg": 70, "1977": 70, "problem": [70, 79, 83], "journal": 70, "jacm": 70, "chen": 70, "l": 70, "ng": 70, "2004": 70, "marriag": 70, "thirtieth": 70, "\u00f6zsu": 70, "oria": 70, "2005": 70, "robust": [70, 83], "trajectori": 70, "manag": 70, "stefan": 70, "athitso": 70, "transact": 70, "1425": 70, "1438": 70, "marteau": 70, "2008": 70, "adjust": 70, "analysi": 70, "intellig": 70, "31": [70, 83], "306": 70, "318": 70, "involv": [71, 83], "_euclidean": 71, "51158857": 71, "11514381": 71, "35905618": 71, "mirror": 71, "imag": 71, "halv": 71, "advis": 71, "tri": 71, "smart": 71, "85497117": 71, "96086309": 71, "18777928": 71, "00606825": 71, "23060212": 71, "27419835": 71, "64445581": 71, "38965963": 71, "79102936": 71, "59756098": 71, "47560976": 71, "64634146": 71, "08536585": 71, "03658537": 71, "13414634": 71, "09756098": 71, "25609756": 71, "12195122": 71, "76": 71, "20881199": 71, "73": 71, "62554784": 71, "88": 71, "5536877": 71, "27": 71, "49142159": 71, "56024904": 71, "24551102": 71, "45513015": 71, "81": 71, "60658533": 71, "06099416": 71, "multitud": 71, "reshap": 71, "48683192": 71, "60301954": 71, "34083722": 71, "35954558": 71, "sometim": 71, "_pairs_": 71, "elast": [71, 81], "50816474": 71, "3299048": 71, "55193242": 71, "interdimension": 71, "50507001": 71, "90920635": 71, "27646127": 71, "60041068": 71, "60786006": 71, "75645164": 71, "26677146": 71, "24823344": 71, "interest": 71, "slice": 71, "want": [71, 84], "avoid": [71, 84], "unwant": 71, "limits_": 71, "queri": 71, "le": 71, "counterpart": 71, "_threshold_": 71, "jag": 71, "66371456": 71, "11914265": 71, "13076667": 71, "99043671": 71, "73408875": 71, "84227457": 71, "2028058": 71, "85972633": 71, "85367621": 71, "86957415": 71, "64041732": 71, "33156061": 71, "56698045": 71, "99489626": 71, "6790517": 71, "16754772": 71, "10973127": 71, "50583639": 71, "def": 71, "pairwise_sd_ful": 71, "stack": 71, "21688671": 71, "83210644": 71, "50884094": 71, "18507116": 71, "11177626": 71, "15611733": 71, "21780536": 71, "13350353": 71, "09710811": 71, "75114125": 71, "13489775": 71, "09806374": 71, "idx": 71, "28": 71, "third": 71, "continu": [71, 83], "investig": 71, "particular": [71, 83], "task": [71, 74, 75, 79, 83], "cpu": 71, "inspect": 71, "theoret": 71, "complex": 71, "magnitud": 71, "97686": 71, "87686": 71, "98368": 71, "98282": 71, "11131": 71, "98268": 71, "95506": 71, "14157": 71, "96041": 71, "94631": 71, "83231": 71, "92207": 71, "55527": 71, "73285": 71, "55538": 71, "41892": 71, "40887": 71, "42778": 71, "00061": 71, "00104": 71, "00064": 71, "wlcss": 71, "00054": 71, "00091": 71, "00056": 71, "00030": 71, "00052": 71, "00032": 71, "00028": 71, "00048": 71, "00029": 71, "00021": 71, "00035": 71, "00022": 71, "00019": 71, "82372": 71, "49048": 71, "79202": 71, "66394": 71, "75967": 71, "67113": 71, "56287": 71, "61275": 71, "56196": 71, "text": 71, "49453": 71, "59627": 71, "49988": 71, "42765": 71, "58025": 71, "43553": 71, "42761": 71, "58982": 71, "43474": 71, "21051": 71, "33659": 71, "21757": 71, "06851": 71, "10321": 71, "07092": 71, "00216": 71, "00413": 71, "00226": 71, "00146": 71, "00278": 71, "00153": 71, "00102": 71, "00195": 71, "00107": 71, "00194": 71, "00106": 71, "00099": 71, "00190": 71, "00189": 71, "00103": 71, "00097": 71, "00185": 71, "00101": 71, "00096": 71, "00182": 71, "00100": 71, "00095": 71, "00181": 71, "00071": 71, "00136": 71, "00074": 71, "rakthanmanon": 71, "campana": 71, "mueen": 71, "batista": 71, "westov": 71, "zhu": 71, "q": 71, "zakaria": 71, "2012": 71, "august": 71, "trillion": 71, "under": [71, 84], "18th": 71, "262": 71, "270": 71, "goal": [73, 83], "unseen": [73, 83], "varieti": 74, "excel": 74, "baselin": 74, "highli": 74, "often": [75, 83], "art": 75, "emmott_label": 79, "primari": 79, "focu": [79, 83], "oppos": 79, "perhap": 79, "minority_label": 79, "majority_label": 79, "sophist": 79, "publish": 79, "randomforestclassifi": 79, "four": 79, "75": 79, "quantil": 79, "manual": [80, 84], "enhanc": 81, "someth": 81, "couldn": 81, "now": 81, "miscellan": 81, "didn": 81, "document": [81, 83, 84], "17": 81, "scipi": 81, "compar": 81, "3darrai": 81, "issu": [81, 84], "bug": 81, "incorrect": 81, "_distanc": 81, "distancemeasur": 81, "subsequencedistancemeasur": 81, "subsequencemetr": 81, "affect": 81, "cimport": 81, "constructor": 81, "incorrectli": 81, "drop": 81, "undeprec": 81, "old": 81, "migrat": 81, "framework": [81, 83], "forecast": 83, "unfamiliar": 83, "chronolog": 83, "logic": 83, "solv": 83, "concern": 83, "supervis": 83, "nomin": 83, "unlabel": 83, "essenti": [83, 84], "acquir": 83, "commun": 83, "access": [83, 84], "achiev": 83, "opt": 83, "prefer": 83, "irrespect": 83, "floodmodeling1": 83, "uea": 83, "extrins": 83, "tsereg": 83, "clf": 83, "experiment": 83, "clone": [83, 84], "screen": 83, "despit": 83, "even": 83, "tabluar_x": 83, "design": 83, "interoper": 83, "logisticregress": 83, "bad": 83, "practic": 83, "proper": 83, "reason": 83, "respons": 83, "break": 83, "reevalu": 83, "relianc": 83, "visual": [83, 84], "importance_": 83, "pickl": 83, "repr": 83, "dump": 83, "earlier": 83, "clf_": 83, "older": 83, "newer": 83, "vice": 83, "versa": 83, "secur": 83, "unpickl": 83, "There": 84, "offici": 84, "pypi": 84, "recommend": 84, "fastest": 84, "platform": 84, "built": 84, "write": 84, "due": 84, "mistak": 84, "incompat": 84, "19": 84, "conflict": 84, "strongli": 84, "virtual": 84, "venv": 84, "python3": 84, "folder": 84, "ceavet": 84, "outsid": 84, "scope": 84, "debian": 84, "apt": 84, "homebrew": 84, "brew": 84, "anaconda": 84, "miniconda": 84, "pull": 84, "process": 84, "git": 84, "com": 84, "isaksamsten": 84, "tool": 84, "studio": 84, "command": 84, "cmd": 84, "consol": 84, "distutils_use_sdk": 84, "program": 84, "x86": 84, "microsoft": 84, "buildtool": 84, "vc": 84, "auxiliari": 84, "vcvarsal": 84, "bat": 84, "x64": 84, "xcode": 84, "ubuntu": 84, "dev": 84, "txt": 84, "mode": 84, "eas": 84, "wildboar_build": 84, "architectur": 84}, "objects": {"": [[25, 0, 0, "-", "wildboar"]], "wildboar": [[3, 0, 0, "-", "annotate"], [4, 0, 0, "-", "base"], [7, 0, 0, "-", "datasets"], [15, 0, 0, "-", "distance"], [17, 0, 0, "-", "ensemble"], [24, 0, 0, "-", "explain"], [25, 1, 1, "", "iseos"], [30, 0, 0, "-", "linear_model"], [33, 0, 0, "-", "metrics"], [36, 0, 0, "-", "model_selection"], [47, 0, 0, "-", "transform"], [51, 0, 0, "-", "tree"], [56, 0, 0, "-", "utils"], [60, 0, 0, "-", "version"]], "wildboar.annotate": [[1, 0, 0, "-", "_motifs"], [2, 0, 0, "-", "_segment"], [3, 1, 1, "", "motifs"], [3, 1, 1, "", "segment"]], "wildboar.annotate._motifs": [[1, 1, 1, "", "motifs"]], "wildboar.annotate._segment": [[2, 1, 1, "", "segment"]], "wildboar.base": [[4, 2, 1, "", "BaseEstimator"], [4, 2, 1, "", "CounterfactualMixin"], [4, 2, 1, "", "ExplainerMixin"], [4, 1, 1, "", "is_counterfactual"], [4, 1, 1, "", "is_explainer"]], "wildboar.base.BaseEstimator": [[4, 3, 1, "", "get_metadata_routing"], [4, 3, 1, "", "get_params"], [4, 3, 1, "", "set_params"]], "wildboar.base.CounterfactualMixin": [[4, 3, 1, "", "score"]], "wildboar.base.ExplainerMixin": [[4, 3, 1, "", "fit_explain"], [4, 3, 1, "", "plot"]], "wildboar.datasets": [[7, 2, 1, "", "Bundle"], [7, 2, 1, "", "JSONRepository"], [7, 2, 1, "", "NpBundle"], [7, 2, 1, "", "Repository"], [5, 0, 0, "-", "_filter"], [6, 0, 0, "-", "_repository"], [7, 1, 1, "", "clear_cache"], [7, 1, 1, "", "get_bundles"], [7, 1, 1, "", "get_repository"], [7, 1, 1, "", "install_repository"], [7, 1, 1, "", "list_bundles"], [7, 1, 1, "", "list_collections"], [7, 1, 1, "", "list_datasets"], [7, 1, 1, "", "list_repositories"], [7, 1, 1, "", "load_dataset"], [7, 1, 1, "", "load_datasets"], [7, 1, 1, "", "load_gun_point"], [7, 1, 1, "", "load_synthetic_control"], [7, 1, 1, "", "load_two_lead_ecg"], [8, 0, 0, "-", "outlier"], [9, 0, 0, "-", "preprocess"], [7, 1, 1, "", "refresh_repositories"], [7, 1, 1, "", "set_cache_dir"]], "wildboar.datasets.Bundle": [[7, 3, 1, "", "get_collection"], [7, 3, 1, "", "get_filename"], [7, 3, 1, "", "list"], [7, 3, 1, "", "load"]], "wildboar.datasets.JSONRepository": [[7, 4, 1, "", "download_url"], [7, 3, 1, "", "get_bundle"], [7, 3, 1, "", "get_bundles"], [7, 4, 1, "", "name"], [7, 3, 1, "", "refresh"], [7, 4, 1, "", "version"], [7, 4, 1, "", "wildboar_requires"]], "wildboar.datasets.NpBundle": [[7, 3, 1, "", "get_collection"], [7, 3, 1, "", "get_filename"], [7, 3, 1, "", "list"], [7, 3, 1, "", "load"]], "wildboar.datasets.Repository": [[7, 4, 1, "", "download_url"], [7, 3, 1, "", "get_bundle"], [7, 3, 1, "", "get_bundles"], [7, 4, 1, "", "name"], [7, 3, 1, "", "refresh"], [7, 4, 1, "", "version"], [7, 4, 1, "", "wildboar_requires"]], "wildboar.datasets._filter": [[5, 1, 1, "", "make_dict_filter"], [5, 1, 1, "", "make_filter"], [5, 1, 1, "", "make_list_filter"], [5, 1, 1, "", "make_str_filter"]], "wildboar.datasets._repository": [[6, 2, 1, "", "Bundle"], [6, 2, 1, "", "JSONRepository"], [6, 2, 1, "", "NpBundle"], [6, 2, 1, "", "Repository"]], "wildboar.datasets._repository.Bundle": [[6, 3, 1, "", "get_collection"], [6, 3, 1, "", "get_filename"], [6, 3, 1, "", "list"], [6, 3, 1, "", "load"]], "wildboar.datasets._repository.JSONRepository": [[6, 4, 1, "", "download_url"], [6, 3, 1, "", "get_bundle"], [6, 3, 1, "", "get_bundles"], [6, 4, 1, "", "name"], [6, 3, 1, "", "refresh"], [6, 4, 1, "", "version"], [6, 4, 1, "", "wildboar_requires"]], "wildboar.datasets._repository.NpBundle": [[6, 3, 1, "", "get_collection"], [6, 3, 1, "", "get_filename"], [6, 3, 1, "", "list"], [6, 3, 1, "", "load"]], "wildboar.datasets._repository.Repository": [[6, 4, 1, "", "download_url"], [6, 3, 1, "", "get_bundle"], [6, 3, 1, "", "get_bundles"], [6, 4, 1, "", "name"], [6, 3, 1, "", "refresh"], [6, 4, 1, "", "version"], [6, 4, 1, "", "wildboar_requires"]], "wildboar.datasets.outlier": [[8, 1, 1, "", "density_outliers"], [8, 1, 1, "", "emmott_outliers"], [8, 1, 1, "", "kmeans_outliers"], [8, 1, 1, "", "majority_outliers"], [8, 1, 1, "", "minority_outliers"]], "wildboar.datasets.preprocess": [[9, 1, 1, "", "maxabs_scale"], [9, 1, 1, "", "minmax_scale"], [9, 1, 1, "", "named_preprocess"], [9, 1, 1, "", "standardize"], [9, 1, 1, "", "truncate"]], "wildboar.distance": [[15, 2, 1, "", "KMeans"], [15, 2, 1, "", "KMedoids"], [15, 2, 1, "", "KNeighborsClassifier"], [10, 0, 0, "-", "_distance"], [11, 0, 0, "-", "_matrix_profile"], [12, 0, 0, "-", "_multi_metric"], [13, 0, 0, "-", "_neighbors"], [14, 0, 0, "-", "dtw"], [15, 1, 1, "", "matrix_profile"], [15, 1, 1, "", "paired_distance"], [15, 1, 1, "", "paired_subsequence_distance"], [15, 1, 1, "", "paired_subsequence_match"], [15, 1, 1, "", "pairwise_distance"], [15, 1, 1, "", "pairwise_subsequence_distance"], [15, 1, 1, "", "subsequence_match"]], "wildboar.distance.KMeans": [[15, 3, 1, "", "fit"], [15, 3, 1, "", "fit_predict"], [15, 3, 1, "", "fit_transform"], [15, 3, 1, "", "get_metadata_routing"], [15, 3, 1, "", "get_params"], [15, 3, 1, "", "predict"], [15, 3, 1, "", "set_output"], [15, 3, 1, "", "set_params"], [15, 3, 1, "", "transform"]], "wildboar.distance.KMedoids": [[15, 3, 1, "", "fit"], [15, 3, 1, "", "fit_predict"], [15, 3, 1, "", "fit_transform"], [15, 3, 1, "", "get_metadata_routing"], [15, 3, 1, "", "get_params"], [15, 3, 1, "", "predict"], [15, 3, 1, "", "set_output"], [15, 3, 1, "", "set_params"], [15, 3, 1, "", "transform"]], "wildboar.distance.KNeighborsClassifier": [[15, 3, 1, "", "fit"], [15, 3, 1, "", "get_metadata_routing"], [15, 3, 1, "", "get_params"], [15, 3, 1, "", "predict"], [15, 3, 1, "", "predict_proba"], [15, 3, 1, "", "score"], [15, 3, 1, "", "set_params"]], "wildboar.distance._distance": [[10, 1, 1, "", "paired_distance"], [10, 1, 1, "", "paired_subsequence_distance"], [10, 1, 1, "", "paired_subsequence_match"], [10, 1, 1, "", "pairwise_distance"], [10, 1, 1, "", "pairwise_subsequence_distance"], [10, 1, 1, "", "subsequence_match"]], "wildboar.distance._matrix_profile": [[11, 1, 1, "", "matrix_profile"]], "wildboar.distance._neighbors": [[13, 2, 1, "", "KMeans"], [13, 2, 1, "", "KMedoids"], [13, 2, 1, "", "KNeighborsClassifier"]], "wildboar.distance._neighbors.KMeans": [[13, 3, 1, "", "fit"], [13, 3, 1, "", "fit_predict"], [13, 3, 1, "", "fit_transform"], [13, 3, 1, "", "get_metadata_routing"], [13, 3, 1, "", "get_params"], [13, 3, 1, "", "predict"], [13, 3, 1, "", "set_output"], [13, 3, 1, "", "set_params"], [13, 3, 1, "", "transform"]], "wildboar.distance._neighbors.KMedoids": [[13, 3, 1, "", "fit"], [13, 3, 1, "", "fit_predict"], [13, 3, 1, "", "fit_transform"], [13, 3, 1, "", "get_metadata_routing"], [13, 3, 1, "", "get_params"], [13, 3, 1, "", "predict"], [13, 3, 1, "", "set_output"], [13, 3, 1, "", "set_params"], [13, 3, 1, "", "transform"]], "wildboar.distance._neighbors.KNeighborsClassifier": [[13, 3, 1, "", "fit"], [13, 3, 1, "", "get_metadata_routing"], [13, 3, 1, "", "get_params"], [13, 3, 1, "", "predict"], [13, 3, 1, "", "predict_proba"], [13, 3, 1, "", "score"], [13, 3, 1, "", "set_params"]], "wildboar.distance.dtw": [[14, 1, 1, "", "ddtw_distance"], [14, 1, 1, "", "dtw_alignment"], [14, 1, 1, "", "dtw_average"], [14, 1, 1, "", "dtw_distance"], [14, 1, 1, "", "dtw_envelop"], [14, 1, 1, "", "dtw_lb_keogh"], [14, 1, 1, "", "dtw_mapping"], [14, 1, 1, "", "jeong_weight"], [14, 1, 1, "", "wddtw_distance"], [14, 1, 1, "", "wdtw_alignment"], [14, 1, 1, "", "wdtw_distance"]], "wildboar.ensemble": [[17, 2, 1, "", "BaggingClassifier"], [17, 2, 1, "", "BaggingRegressor"], [17, 2, 1, "", "BaseBagging"], [17, 2, 1, "", "ExtraShapeletTreesClassifier"], [17, 2, 1, "", "ExtraShapeletTreesRegressor"], [17, 2, 1, "", "IntervalForestClassifier"], [17, 2, 1, "", "IntervalForestRegressor"], [17, 2, 1, "", "IsolationShapeletForest"], [17, 2, 1, "", "PivotForestClassifier"], [17, 2, 1, "", "ProximityForestClassifier"], [17, 2, 1, "", "RocketForestClassifier"], [17, 2, 1, "", "RocketForestRegressor"], [17, 2, 1, "", "ShapeletForestClassifier"], [17, 2, 1, "", "ShapeletForestEmbedding"], [17, 2, 1, "", "ShapeletForestRegressor"], [16, 0, 0, "-", "_ensemble"]], "wildboar.ensemble.BaggingClassifier": [[17, 4, 1, "", "base_estimator_"], [17, 3, 1, "", "decision_function"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "predict_log_proba"], [17, 3, 1, "", "predict_proba"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.BaggingRegressor": [[17, 4, 1, "", "base_estimator_"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.BaseBagging": [[17, 4, 1, "", "base_estimator_"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.ExtraShapeletTreesClassifier": [[17, 4, 1, "", "base_estimator_"], [17, 3, 1, "", "decision_function"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "predict_log_proba"], [17, 3, 1, "", "predict_proba"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.ExtraShapeletTreesRegressor": [[17, 4, 1, "", "base_estimator_"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.IntervalForestClassifier": [[17, 4, 1, "", "base_estimator_"], [17, 3, 1, "", "decision_function"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "predict_log_proba"], [17, 3, 1, "", "predict_proba"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.IntervalForestRegressor": [[17, 4, 1, "", "base_estimator_"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.IsolationShapeletForest": [[17, 4, 1, "", "base_estimator_"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "fit_predict"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.PivotForestClassifier": [[17, 4, 1, "", "base_estimator_"], [17, 3, 1, "", "decision_function"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "predict_log_proba"], [17, 3, 1, "", "predict_proba"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.ProximityForestClassifier": [[17, 4, 1, "", "base_estimator_"], [17, 3, 1, "", "decision_function"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "predict_log_proba"], [17, 3, 1, "", "predict_proba"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.RocketForestClassifier": [[17, 4, 1, "", "base_estimator_"], [17, 3, 1, "", "decision_function"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "predict_log_proba"], [17, 3, 1, "", "predict_proba"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.RocketForestRegressor": [[17, 4, 1, "", "base_estimator_"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.ShapeletForestClassifier": [[17, 4, 1, "", "base_estimator_"], [17, 3, 1, "", "decision_function"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "predict_log_proba"], [17, 3, 1, "", "predict_proba"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.ShapeletForestEmbedding": [[17, 4, 1, "", "base_estimator_"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.ShapeletForestRegressor": [[17, 4, 1, "", "base_estimator_"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble": [[16, 2, 1, "", "BaggingClassifier"], [16, 2, 1, "", "BaggingRegressor"], [16, 2, 1, "", "BaseBagging"], [16, 2, 1, "", "BaseForestClassifier"], [16, 2, 1, "", "BaseForestRegressor"], [16, 2, 1, "", "BaseShapeletForestClassifier"], [16, 2, 1, "", "BaseShapeletForestRegressor"], [16, 2, 1, "", "ExtraShapeletTreesClassifier"], [16, 2, 1, "", "ExtraShapeletTreesRegressor"], [16, 2, 1, "", "ForestMixin"], [16, 2, 1, "", "IntervalForestClassifier"], [16, 2, 1, "", "IntervalForestRegressor"], [16, 2, 1, "", "IsolationShapeletForest"], [16, 2, 1, "", "PivotForestClassifier"], [16, 2, 1, "", "ProximityForestClassifier"], [16, 2, 1, "", "RocketForestClassifier"], [16, 2, 1, "", "RocketForestRegressor"], [16, 2, 1, "", "ShapeletForestClassifier"], [16, 2, 1, "", "ShapeletForestEmbedding"], [16, 2, 1, "", "ShapeletForestRegressor"]], "wildboar.ensemble._ensemble.BaggingClassifier": [[16, 4, 1, "", "base_estimator_"], [16, 3, 1, "", "decision_function"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "predict_log_proba"], [16, 3, 1, "", "predict_proba"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.BaggingRegressor": [[16, 4, 1, "", "base_estimator_"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.BaseBagging": [[16, 4, 1, "", "base_estimator_"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.BaseForestClassifier": [[16, 4, 1, "", "base_estimator_"], [16, 3, 1, "", "decision_function"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "predict_log_proba"], [16, 3, 1, "", "predict_proba"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.BaseForestRegressor": [[16, 4, 1, "", "base_estimator_"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.BaseShapeletForestClassifier": [[16, 4, 1, "", "base_estimator_"], [16, 3, 1, "", "decision_function"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "predict_log_proba"], [16, 3, 1, "", "predict_proba"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.BaseShapeletForestRegressor": [[16, 4, 1, "", "base_estimator_"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier": [[16, 4, 1, "", "base_estimator_"], [16, 3, 1, "", "decision_function"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "predict_log_proba"], [16, 3, 1, "", "predict_proba"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.ExtraShapeletTreesRegressor": [[16, 4, 1, "", "base_estimator_"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.IntervalForestClassifier": [[16, 4, 1, "", "base_estimator_"], [16, 3, 1, "", "decision_function"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "predict_log_proba"], [16, 3, 1, "", "predict_proba"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.IntervalForestRegressor": [[16, 4, 1, "", "base_estimator_"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.IsolationShapeletForest": [[16, 4, 1, "", "base_estimator_"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "fit_predict"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.PivotForestClassifier": [[16, 4, 1, "", "base_estimator_"], [16, 3, 1, "", "decision_function"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "predict_log_proba"], [16, 3, 1, "", "predict_proba"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.ProximityForestClassifier": [[16, 4, 1, "", "base_estimator_"], [16, 3, 1, "", "decision_function"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "predict_log_proba"], [16, 3, 1, "", "predict_proba"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.RocketForestClassifier": [[16, 4, 1, "", "base_estimator_"], [16, 3, 1, "", "decision_function"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "predict_log_proba"], [16, 3, 1, "", "predict_proba"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.RocketForestRegressor": [[16, 4, 1, "", "base_estimator_"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.ShapeletForestClassifier": [[16, 4, 1, "", "base_estimator_"], [16, 3, 1, "", "decision_function"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "predict_log_proba"], [16, 3, 1, "", "predict_proba"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.ShapeletForestEmbedding": [[16, 4, 1, "", "base_estimator_"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.ShapeletForestRegressor": [[16, 4, 1, "", "base_estimator_"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.explain": [[24, 2, 1, "", "AmplitudeImportance"], [24, 2, 1, "", "IntervalImportance"], [24, 2, 1, "", "ShapeletImportance"], [18, 0, 0, "-", "_importance"], [23, 0, 0, "-", "counterfactual"], [24, 1, 1, "", "plot_importances"]], "wildboar.explain.AmplitudeImportance": [[24, 3, 1, "", "fit_explain"], [24, 3, 1, "", "get_metadata_routing"], [24, 3, 1, "", "get_params"], [24, 3, 1, "", "plot"], [24, 3, 1, "", "set_params"]], "wildboar.explain.IntervalImportance": [[24, 3, 1, "", "fit_explain"], [24, 3, 1, "", "get_metadata_routing"], [24, 3, 1, "", "get_params"], [24, 3, 1, "", "plot"], [24, 3, 1, "", "set_params"]], "wildboar.explain.ShapeletImportance": [[24, 3, 1, "", "fit_explain"], [24, 3, 1, "", "get_metadata_routing"], [24, 3, 1, "", "get_params"], [24, 3, 1, "", "plot"], [24, 3, 1, "", "set_params"]], "wildboar.explain._importance": [[18, 2, 1, "", "AmplitudeImportance"], [18, 2, 1, "", "IntervalImportance"], [18, 2, 1, "", "PermuteImportance"], [18, 2, 1, "", "ShapeletImportance"], [18, 1, 1, "", "plot_importances"]], "wildboar.explain._importance.AmplitudeImportance": [[18, 3, 1, "", "fit_explain"], [18, 3, 1, "", "get_metadata_routing"], [18, 3, 1, "", "get_params"], [18, 3, 1, "", "plot"], [18, 3, 1, "", "set_params"]], "wildboar.explain._importance.IntervalImportance": [[18, 3, 1, "", "fit_explain"], [18, 3, 1, "", "get_metadata_routing"], [18, 3, 1, "", "get_params"], [18, 3, 1, "", "plot"], [18, 3, 1, "", "set_params"]], "wildboar.explain._importance.PermuteImportance": [[18, 3, 1, "", "get_metadata_routing"], [18, 3, 1, "", "get_params"], [18, 3, 1, "", "set_params"]], "wildboar.explain._importance.ShapeletImportance": [[18, 3, 1, "", "fit_explain"], [18, 3, 1, "", "get_metadata_routing"], [18, 3, 1, "", "get_params"], [18, 3, 1, "", "plot"], [18, 3, 1, "", "set_params"]], "wildboar.explain.counterfactual": [[23, 2, 1, "", "KNeighborsCounterfactual"], [23, 2, 1, "", "PrototypeCounterfactual"], [23, 2, 1, "", "ShapeletForestCounterfactual"], [19, 0, 0, "-", "_helper"], [20, 0, 0, "-", "_nn"], [21, 0, 0, "-", "_proto"], [22, 0, 0, "-", "_sf"], [23, 1, 1, "", "counterfactuals"], [23, 1, 1, "", "proximity"]], "wildboar.explain.counterfactual.KNeighborsCounterfactual": [[23, 3, 1, "", "fit_explain"], [23, 3, 1, "", "get_metadata_routing"], [23, 3, 1, "", "get_params"], [23, 3, 1, "", "plot"], [23, 3, 1, "", "score"], [23, 3, 1, "", "set_params"]], "wildboar.explain.counterfactual.PrototypeCounterfactual": [[23, 3, 1, "", "fit_explain"], [23, 3, 1, "", "get_metadata_routing"], [23, 3, 1, "", "get_params"], [23, 3, 1, "", "plot"], [23, 3, 1, "", "score"], [23, 3, 1, "", "set_params"]], "wildboar.explain.counterfactual.ShapeletForestCounterfactual": [[23, 3, 1, "", "fit_explain"], [23, 3, 1, "", "get_metadata_routing"], [23, 3, 1, "", "get_params"], [23, 3, 1, "", "plot"], [23, 3, 1, "", "score"], [23, 3, 1, "", "set_params"]], "wildboar.explain.counterfactual._helper": [[19, 1, 1, "", "counterfactuals"]], "wildboar.explain.counterfactual._nn": [[20, 2, 1, "", "KNeighborsCounterfactual"]], "wildboar.explain.counterfactual._nn.KNeighborsCounterfactual": [[20, 3, 1, "", "fit_explain"], [20, 3, 1, "", "get_metadata_routing"], [20, 3, 1, "", "get_params"], [20, 3, 1, "", "plot"], [20, 3, 1, "", "score"], [20, 3, 1, "", "set_params"]], "wildboar.explain.counterfactual._proto": [[21, 2, 1, "", "DynamicTimeWarpTransform"], [21, 2, 1, "", "EuclideanTransform"], [21, 2, 1, "", "KNearestPrototypeSampler"], [21, 2, 1, "", "KNearestShapeletPrototypeSampler"], [21, 2, 1, "", "MetricTransform"], [21, 2, 1, "", "PredictEvaluator"], [21, 2, 1, "", "ProbabilityEvaluator"], [21, 2, 1, "", "PrototypeCounterfactual"], [21, 2, 1, "", "PrototypeSampler"], [21, 2, 1, "", "ShapeletPrototypeSampler"], [21, 2, 1, "", "TargetEvaluator"], [21, 2, 1, "", "UniformPrototypeSampler"], [21, 2, 1, "", "WeightedDynamicTimeWarpTransform"]], "wildboar.explain.counterfactual._proto.DynamicTimeWarpTransform": [[21, 3, 1, "", "move"]], "wildboar.explain.counterfactual._proto.EuclideanTransform": [[21, 3, 1, "", "move"]], "wildboar.explain.counterfactual._proto.KNearestPrototypeSampler": [[21, 3, 1, "", "move"], [21, 3, 1, "", "nearest_index"], [21, 3, 1, "", "sample"], [21, 3, 1, "", "sample_move"]], "wildboar.explain.counterfactual._proto.KNearestShapeletPrototypeSampler": [[21, 3, 1, "", "move"], [21, 3, 1, "", "sample"], [21, 3, 1, "", "sample_move"]], "wildboar.explain.counterfactual._proto.MetricTransform": [[21, 3, 1, "", "move"]], "wildboar.explain.counterfactual._proto.PredictEvaluator": [[21, 3, 1, "", "is_counterfactual"]], "wildboar.explain.counterfactual._proto.ProbabilityEvaluator": [[21, 3, 1, "", "is_counterfactual"]], "wildboar.explain.counterfactual._proto.PrototypeCounterfactual": [[21, 3, 1, "", "fit_explain"], [21, 3, 1, "", "get_metadata_routing"], [21, 3, 1, "", "get_params"], [21, 3, 1, "", "plot"], [21, 3, 1, "", "score"], [21, 3, 1, "", "set_params"]], "wildboar.explain.counterfactual._proto.PrototypeSampler": [[21, 3, 1, "", "move"], [21, 3, 1, "", "sample"], [21, 3, 1, "", "sample_move"]], "wildboar.explain.counterfactual._proto.ShapeletPrototypeSampler": [[21, 3, 1, "", "move"], [21, 3, 1, "", "sample"], [21, 3, 1, "", "sample_move"], [21, 3, 1, "", "sample_shapelet"]], "wildboar.explain.counterfactual._proto.TargetEvaluator": [[21, 3, 1, "", "is_counterfactual"]], "wildboar.explain.counterfactual._proto.UniformPrototypeSampler": [[21, 3, 1, "", "move"], [21, 3, 1, "", "sample"], [21, 3, 1, "", "sample_move"]], "wildboar.explain.counterfactual._proto.WeightedDynamicTimeWarpTransform": [[21, 3, 1, "", "move"]], "wildboar.explain.counterfactual._sf": [[22, 2, 1, "", "ShapeletForestCounterfactual"]], "wildboar.explain.counterfactual._sf.ShapeletForestCounterfactual": [[22, 3, 1, "", "fit_explain"], [22, 3, 1, "", "get_metadata_routing"], [22, 3, 1, "", "get_params"], [22, 3, 1, "", "plot"], [22, 3, 1, "", "score"], [22, 3, 1, "", "set_params"]], "wildboar.linear_model": [[30, 2, 1, "", "HydraClassifier"], [30, 2, 1, "", "RandomShapeletClassifier"], [30, 2, 1, "", "RandomShapeletRegressor"], [30, 2, 1, "", "RocketClassifier"], [30, 2, 1, "", "RocketRegressor"], [26, 0, 0, "-", "_hydra"], [27, 0, 0, "-", "_rocket"], [28, 0, 0, "-", "_shapelet"], [29, 0, 0, "-", "_transform"]], "wildboar.linear_model.HydraClassifier": [[30, 3, 1, "", "get_metadata_routing"], [30, 3, 1, "", "get_params"], [30, 3, 1, "", "score"], [30, 3, 1, "", "set_params"]], "wildboar.linear_model.RandomShapeletClassifier": [[30, 3, 1, "", "get_metadata_routing"], [30, 3, 1, "", "get_params"], [30, 3, 1, "", "score"], [30, 3, 1, "", "set_params"]], "wildboar.linear_model.RandomShapeletRegressor": [[30, 3, 1, "", "get_metadata_routing"], [30, 3, 1, "", "get_params"], [30, 3, 1, "", "score"], [30, 3, 1, "", "set_params"]], "wildboar.linear_model.RocketClassifier": [[30, 3, 1, "", "get_metadata_routing"], [30, 3, 1, "", "get_params"], [30, 3, 1, "", "score"], [30, 3, 1, "", "set_params"]], "wildboar.linear_model.RocketRegressor": [[30, 3, 1, "", "get_metadata_routing"], [30, 3, 1, "", "get_params"], [30, 3, 1, "", "score"], [30, 3, 1, "", "set_params"]], "wildboar.linear_model._hydra": [[26, 2, 1, "", "HydraClassifier"]], "wildboar.linear_model._hydra.HydraClassifier": [[26, 3, 1, "", "get_metadata_routing"], [26, 3, 1, "", "get_params"], [26, 3, 1, "", "score"], [26, 3, 1, "", "set_params"]], "wildboar.linear_model._rocket": [[27, 2, 1, "", "RocketClassifier"], [27, 2, 1, "", "RocketRegressor"]], "wildboar.linear_model._rocket.RocketClassifier": [[27, 3, 1, "", "get_metadata_routing"], [27, 3, 1, "", "get_params"], [27, 3, 1, "", "score"], [27, 3, 1, "", "set_params"]], "wildboar.linear_model._rocket.RocketRegressor": [[27, 3, 1, "", "get_metadata_routing"], [27, 3, 1, "", "get_params"], [27, 3, 1, "", "score"], [27, 3, 1, "", "set_params"]], "wildboar.linear_model._shapelet": [[28, 2, 1, "", "RandomShapeletClassifier"], [28, 2, 1, "", "RandomShapeletRegressor"]], "wildboar.linear_model._shapelet.RandomShapeletClassifier": [[28, 3, 1, "", "get_metadata_routing"], [28, 3, 1, "", "get_params"], [28, 3, 1, "", "score"], [28, 3, 1, "", "set_params"]], "wildboar.linear_model._shapelet.RandomShapeletRegressor": [[28, 3, 1, "", "get_metadata_routing"], [28, 3, 1, "", "get_params"], [28, 3, 1, "", "score"], [28, 3, 1, "", "set_params"]], "wildboar.linear_model._transform": [[29, 2, 1, "", "BaseTransformClassifier"], [29, 2, 1, "", "BaseTransformEstimator"], [29, 2, 1, "", "BaseTransformRegressor"], [29, 2, 1, "", "TransformRidgeCV"], [29, 2, 1, "", "TransformRidgeClassifierCV"]], "wildboar.linear_model._transform.BaseTransformClassifier": [[29, 3, 1, "", "get_metadata_routing"], [29, 3, 1, "", "get_params"], [29, 3, 1, "", "score"], [29, 3, 1, "", "set_params"]], "wildboar.linear_model._transform.BaseTransformEstimator": [[29, 3, 1, "", "get_metadata_routing"], [29, 3, 1, "", "get_params"], [29, 3, 1, "", "set_params"]], "wildboar.linear_model._transform.BaseTransformRegressor": [[29, 3, 1, "", "get_metadata_routing"], [29, 3, 1, "", "get_params"], [29, 3, 1, "", "score"], [29, 3, 1, "", "set_params"]], "wildboar.linear_model._transform.TransformRidgeCV": [[29, 3, 1, "", "get_metadata_routing"], [29, 3, 1, "", "get_params"], [29, 3, 1, "", "score"], [29, 3, 1, "", "set_params"]], "wildboar.linear_model._transform.TransformRidgeClassifierCV": [[29, 3, 1, "", "get_metadata_routing"], [29, 3, 1, "", "get_params"], [29, 3, 1, "", "score"], [29, 3, 1, "", "set_params"]], "wildboar.metrics": [[31, 0, 0, "-", "_cluster"], [32, 0, 0, "-", "_counterfactual"], [33, 1, 1, "", "compactness_score"], [33, 1, 1, "", "plausability_score"], [33, 1, 1, "", "proximity_score"], [33, 1, 1, "", "redudancy_score"], [33, 1, 1, "", "relative_proximity_score"], [33, 1, 1, "", "silhouette_samples"], [33, 1, 1, "", "silhouette_score"], [33, 1, 1, "", "validity_score"]], "wildboar.metrics._cluster": [[31, 1, 1, "", "silhouette_samples"], [31, 1, 1, "", "silhouette_score"]], "wildboar.metrics._counterfactual": [[32, 1, 1, "", "compactness_score"], [32, 1, 1, "", "plausability_score"], [32, 1, 1, "", "proximity_score"], [32, 1, 1, "", "redudancy_score"], [32, 1, 1, "", "relative_proximity_score"], [32, 1, 1, "", "validity_score"]], "wildboar.model_selection": [[36, 2, 1, "", "RepeatedOutlierSplit"], [34, 0, 0, "-", "_cv"], [35, 0, 0, "-", "_outlier"], [36, 1, 1, "", "outlier_train_test_split"]], "wildboar.model_selection.RepeatedOutlierSplit": [[36, 3, 1, "", "get_n_splits"], [36, 3, 1, "", "split"]], "wildboar.model_selection._cv": [[34, 2, 1, "", "RepeatedOutlierSplit"]], "wildboar.model_selection._cv.RepeatedOutlierSplit": [[34, 3, 1, "", "get_n_splits"], [34, 3, 1, "", "split"]], "wildboar.model_selection._outlier": [[35, 1, 1, "", "outlier_train_test_split"]], "wildboar.transform": [[47, 2, 1, "", "DiffTransform"], [47, 2, 1, "", "FeatureTransform"], [47, 2, 1, "", "HydraTransform"], [47, 2, 1, "", "IntervalTransform"], [47, 2, 1, "", "MatrixProfileTransform"], [47, 2, 1, "", "PAA"], [47, 2, 1, "", "PivotTransform"], [47, 2, 1, "", "ProximityTransform"], [47, 2, 1, "", "RandomShapeletTransform"], [47, 2, 1, "", "RocketTransform"], [47, 2, 1, "", "SAX"], [37, 0, 0, "-", "_base"], [38, 0, 0, "-", "_conv"], [39, 0, 0, "-", "_diff"], [40, 0, 0, "-", "_hydra"], [41, 0, 0, "-", "_interval"], [42, 0, 0, "-", "_matrix_profile"], [43, 0, 0, "-", "_pivot"], [44, 0, 0, "-", "_rocket"], [45, 0, 0, "-", "_sax"], [46, 0, 0, "-", "_shapelet"], [47, 1, 1, "", "convolve"], [47, 1, 1, "", "piecewice_aggregate_approximation"], [47, 1, 1, "", "symbolic_aggregate_approximation"]], "wildboar.transform.DiffTransform": [[47, 3, 1, "", "fit_transform"], [47, 3, 1, "", "get_metadata_routing"], [47, 3, 1, "", "get_params"], [47, 3, 1, "", "set_output"], [47, 3, 1, "", "set_params"]], "wildboar.transform.FeatureTransform": [[47, 3, 1, "", "fit"], [47, 3, 1, "", "fit_transform"], [47, 3, 1, "", "get_metadata_routing"], [47, 3, 1, "", "get_params"], [47, 3, 1, "", "set_output"], [47, 3, 1, "", "set_params"], [47, 3, 1, "", "transform"]], "wildboar.transform.HydraTransform": [[47, 3, 1, "", "fit"], [47, 3, 1, "", "fit_transform"], [47, 3, 1, "", "get_metadata_routing"], [47, 3, 1, "", "get_params"], [47, 3, 1, "", "set_output"], [47, 3, 1, "", "set_params"], [47, 3, 1, "", "transform"]], "wildboar.transform.IntervalTransform": [[47, 3, 1, "", "fit"], [47, 3, 1, "", "fit_transform"], [47, 3, 1, "", "get_metadata_routing"], [47, 3, 1, "", "get_params"], [47, 3, 1, "", "set_output"], [47, 3, 1, "", "set_params"], [47, 3, 1, "", "transform"]], "wildboar.transform.MatrixProfileTransform": [[47, 3, 1, "", "fit"], [47, 3, 1, "", "fit_transform"], [47, 3, 1, "", "get_metadata_routing"], [47, 3, 1, "", "get_params"], [47, 3, 1, "", "set_output"], [47, 3, 1, "", "set_params"], [47, 3, 1, "", "transform"]], "wildboar.transform.PAA": [[47, 3, 1, "", "fit_transform"], [47, 3, 1, "", "get_metadata_routing"], [47, 3, 1, "", "get_params"], [47, 3, 1, "", "set_output"], [47, 3, 1, "", "set_params"]], "wildboar.transform.PivotTransform": [[47, 3, 1, "", "fit"], [47, 3, 1, "", "fit_transform"], [47, 3, 1, "", "get_metadata_routing"], [47, 3, 1, "", "get_params"], [47, 3, 1, "", "set_output"], [47, 3, 1, "", "set_params"], [47, 3, 1, "", "transform"]], "wildboar.transform.ProximityTransform": [[47, 3, 1, "", "fit_transform"], [47, 3, 1, "", "get_metadata_routing"], [47, 3, 1, "", "get_params"], [47, 3, 1, "", "set_output"], [47, 3, 1, "", "set_params"]], "wildboar.transform.RandomShapeletTransform": [[47, 3, 1, "", "fit"], [47, 3, 1, "", "fit_transform"], [47, 3, 1, "", "get_metadata_routing"], [47, 3, 1, "", "get_params"], [47, 3, 1, "", "set_output"], [47, 3, 1, "", "set_params"], [47, 3, 1, "", "transform"]], "wildboar.transform.RocketTransform": [[47, 3, 1, "", "fit"], [47, 3, 1, "", "fit_transform"], [47, 3, 1, "", "get_metadata_routing"], [47, 3, 1, "", "get_params"], [47, 3, 1, "", "set_output"], [47, 3, 1, "", "set_params"], [47, 3, 1, "", "transform"]], "wildboar.transform.SAX": [[47, 3, 1, "", "fit_transform"], [47, 3, 1, "", "get_metadata_routing"], [47, 3, 1, "", "get_params"], [47, 3, 1, "", "set_output"], [47, 3, 1, "", "set_params"]], "wildboar.transform._base": [[37, 2, 1, "", "BaseAttributeTransform"]], "wildboar.transform._base.BaseAttributeTransform": [[37, 3, 1, "", "fit"], [37, 3, 1, "", "fit_transform"], [37, 3, 1, "", "get_metadata_routing"], [37, 3, 1, "", "get_params"], [37, 3, 1, "", "set_output"], [37, 3, 1, "", "set_params"], [37, 3, 1, "", "transform"]], "wildboar.transform._conv": [[38, 1, 1, "", "convolve"]], "wildboar.transform._diff": [[39, 2, 1, "", "DiffTransform"]], "wildboar.transform._diff.DiffTransform": [[39, 3, 1, "", "fit_transform"], [39, 3, 1, "", "get_metadata_routing"], [39, 3, 1, "", "get_params"], [39, 3, 1, "", "set_output"], [39, 3, 1, "", "set_params"]], "wildboar.transform._hydra": [[40, 2, 1, "", "HydraTransform"]], "wildboar.transform._hydra.HydraTransform": [[40, 3, 1, "", "fit"], [40, 3, 1, "", "fit_transform"], [40, 3, 1, "", "get_metadata_routing"], [40, 3, 1, "", "get_params"], [40, 3, 1, "", "set_output"], [40, 3, 1, "", "set_params"], [40, 3, 1, "", "transform"]], "wildboar.transform._interval": [[41, 2, 1, "", "FeatureTransform"], [41, 2, 1, "", "IntervalMixin"], [41, 2, 1, "", "IntervalTransform"]], "wildboar.transform._interval.FeatureTransform": [[41, 3, 1, "", "fit"], [41, 3, 1, "", "fit_transform"], [41, 3, 1, "", "get_metadata_routing"], [41, 3, 1, "", "get_params"], [41, 3, 1, "", "set_output"], [41, 3, 1, "", "set_params"], [41, 3, 1, "", "transform"]], "wildboar.transform._interval.IntervalTransform": [[41, 3, 1, "", "fit"], [41, 3, 1, "", "fit_transform"], [41, 3, 1, "", "get_metadata_routing"], [41, 3, 1, "", "get_params"], [41, 3, 1, "", "set_output"], [41, 3, 1, "", "set_params"], [41, 3, 1, "", "transform"]], "wildboar.transform._matrix_profile": [[42, 2, 1, "", "MatrixProfileTransform"]], "wildboar.transform._matrix_profile.MatrixProfileTransform": [[42, 3, 1, "", "fit"], [42, 3, 1, "", "fit_transform"], [42, 3, 1, "", "get_metadata_routing"], [42, 3, 1, "", "get_params"], [42, 3, 1, "", "set_output"], [42, 3, 1, "", "set_params"], [42, 3, 1, "", "transform"]], "wildboar.transform._pivot": [[43, 2, 1, "", "PivotMixin"], [43, 2, 1, "", "PivotTransform"], [43, 2, 1, "", "ProximityTransform"]], "wildboar.transform._pivot.PivotTransform": [[43, 3, 1, "", "fit"], [43, 3, 1, "", "fit_transform"], [43, 3, 1, "", "get_metadata_routing"], [43, 3, 1, "", "get_params"], [43, 3, 1, "", "set_output"], [43, 3, 1, "", "set_params"], [43, 3, 1, "", "transform"]], "wildboar.transform._pivot.ProximityTransform": [[43, 3, 1, "", "fit_transform"], [43, 3, 1, "", "get_metadata_routing"], [43, 3, 1, "", "get_params"], [43, 3, 1, "", "set_output"], [43, 3, 1, "", "set_params"]], "wildboar.transform._rocket": [[44, 2, 1, "", "RocketMixin"], [44, 2, 1, "", "RocketTransform"]], "wildboar.transform._rocket.RocketTransform": [[44, 3, 1, "", "fit"], [44, 3, 1, "", "fit_transform"], [44, 3, 1, "", "get_metadata_routing"], [44, 3, 1, "", "get_params"], [44, 3, 1, "", "set_output"], [44, 3, 1, "", "set_params"], [44, 3, 1, "", "transform"]], "wildboar.transform._sax": [[45, 2, 1, "", "Binning"], [45, 2, 1, "", "NormalBinning"], [45, 2, 1, "", "PAA"], [45, 2, 1, "", "SAX"], [45, 2, 1, "", "UniformBinning"], [45, 1, 1, "", "piecewice_aggregate_approximation"], [45, 1, 1, "", "symbolic_aggregate_approximation"]], "wildboar.transform._sax.Binning": [[45, 3, 1, "", "get_thresholds"], [45, 3, 1, "", "scale"]], "wildboar.transform._sax.NormalBinning": [[45, 3, 1, "", "get_thresholds"], [45, 3, 1, "", "scale"]], "wildboar.transform._sax.PAA": [[45, 3, 1, "", "fit_transform"], [45, 3, 1, "", "get_metadata_routing"], [45, 3, 1, "", "get_params"], [45, 3, 1, "", "set_output"], [45, 3, 1, "", "set_params"]], "wildboar.transform._sax.SAX": [[45, 3, 1, "", "fit_transform"], [45, 3, 1, "", "get_metadata_routing"], [45, 3, 1, "", "get_params"], [45, 3, 1, "", "set_output"], [45, 3, 1, "", "set_params"]], "wildboar.transform._sax.UniformBinning": [[45, 3, 1, "", "get_thresholds"], [45, 3, 1, "", "scale"]], "wildboar.transform._shapelet": [[46, 2, 1, "", "RandomShapeletTransform"], [46, 2, 1, "", "ShapeletMixin"]], "wildboar.transform._shapelet.RandomShapeletTransform": [[46, 3, 1, "", "fit"], [46, 3, 1, "", "fit_transform"], [46, 3, 1, "", "get_metadata_routing"], [46, 3, 1, "", "get_params"], [46, 3, 1, "", "set_output"], [46, 3, 1, "", "set_params"], [46, 3, 1, "", "transform"]], "wildboar.tree": [[51, 2, 1, "", "ExtraShapeletTreeClassifier"], [51, 2, 1, "", "ExtraShapeletTreeRegressor"], [51, 2, 1, "", "IntervalTreeClassifier"], [51, 2, 1, "", "IntervalTreeRegressor"], [51, 2, 1, "", "PivotTreeClassifier"], [51, 2, 1, "", "ProximityTreeClassifier"], [51, 2, 1, "", "RocketTreeClassifier"], [51, 2, 1, "", "RocketTreeRegressor"], [51, 2, 1, "", "ShapeletTreeClassifier"], [51, 2, 1, "", "ShapeletTreeRegressor"], [48, 0, 0, "-", "_base"], [49, 0, 0, "-", "_ptree"], [50, 0, 0, "-", "_tree"]], "wildboar.tree.ExtraShapeletTreeClassifier": [[51, 3, 1, "", "apply"], [51, 3, 1, "", "decision_path"], [51, 3, 1, "", "fit"], [51, 3, 1, "", "get_metadata_routing"], [51, 3, 1, "", "get_params"], [51, 3, 1, "", "predict"], [51, 3, 1, "", "predict_proba"], [51, 3, 1, "", "score"], [51, 3, 1, "", "set_params"]], "wildboar.tree.ExtraShapeletTreeRegressor": [[51, 3, 1, "", "apply"], [51, 3, 1, "", "decision_path"], [51, 3, 1, "", "fit"], [51, 3, 1, "", "get_metadata_routing"], [51, 3, 1, "", "get_params"], [51, 3, 1, "", "predict"], [51, 3, 1, "", "score"], [51, 3, 1, "", "set_params"]], "wildboar.tree.IntervalTreeClassifier": [[51, 3, 1, "", "apply"], [51, 3, 1, "", "decision_path"], [51, 3, 1, "", "fit"], [51, 3, 1, "", "get_metadata_routing"], [51, 3, 1, "", "get_params"], [51, 3, 1, "", "predict"], [51, 3, 1, "", "predict_proba"], [51, 3, 1, "", "score"], [51, 3, 1, "", "set_params"]], "wildboar.tree.IntervalTreeRegressor": [[51, 3, 1, "", "apply"], [51, 3, 1, "", "decision_path"], [51, 3, 1, "", "fit"], [51, 3, 1, "", "get_metadata_routing"], [51, 3, 1, "", "get_params"], [51, 3, 1, "", "predict"], [51, 3, 1, "", "score"], [51, 3, 1, "", "set_params"]], "wildboar.tree.PivotTreeClassifier": [[51, 3, 1, "", "apply"], [51, 3, 1, "", "decision_path"], [51, 3, 1, "", "fit"], [51, 3, 1, "", "get_metadata_routing"], [51, 3, 1, "", "get_params"], [51, 3, 1, "", "predict"], [51, 3, 1, "", "predict_proba"], [51, 3, 1, "", "score"], [51, 3, 1, "", "set_params"]], "wildboar.tree.ProximityTreeClassifier": [[51, 3, 1, "", "apply"], [51, 3, 1, "", "decision_path"], [51, 3, 1, "", "fit"], [51, 3, 1, "", "get_metadata_routing"], [51, 3, 1, "", "get_params"], [51, 3, 1, "", "predict"], [51, 3, 1, "", "predict_proba"], [51, 3, 1, "", "score"], [51, 3, 1, "", "set_params"]], "wildboar.tree.RocketTreeClassifier": [[51, 3, 1, "", "apply"], [51, 3, 1, "", "decision_path"], [51, 3, 1, "", "fit"], [51, 3, 1, "", "get_metadata_routing"], [51, 3, 1, "", "get_params"], [51, 3, 1, "", "predict"], [51, 3, 1, "", "predict_proba"], [51, 3, 1, "", "score"], [51, 3, 1, "", "set_params"]], "wildboar.tree.RocketTreeRegressor": [[51, 3, 1, "", "apply"], [51, 3, 1, "", "decision_path"], [51, 3, 1, "", "fit"], [51, 3, 1, "", "get_metadata_routing"], [51, 3, 1, "", "get_params"], [51, 3, 1, "", "predict"], [51, 3, 1, "", "score"], [51, 3, 1, "", "set_params"]], "wildboar.tree.ShapeletTreeClassifier": [[51, 3, 1, "", "apply"], [51, 3, 1, "", "decision_path"], [51, 3, 1, "", "fit"], [51, 3, 1, "", "get_metadata_routing"], [51, 3, 1, "", "get_params"], [51, 3, 1, "", "predict"], [51, 3, 1, "", "predict_proba"], [51, 3, 1, "", "score"], [51, 3, 1, "", "set_params"]], "wildboar.tree.ShapeletTreeRegressor": [[51, 3, 1, "", "apply"], [51, 3, 1, "", "decision_path"], [51, 3, 1, "", "fit"], [51, 3, 1, "", "get_metadata_routing"], [51, 3, 1, "", "get_params"], [51, 3, 1, "", "predict"], [51, 3, 1, "", "score"], [51, 3, 1, "", "set_params"]], "wildboar.tree._base": [[48, 2, 1, "", "BaseTree"], [48, 2, 1, "", "BaseTreeClassifier"], [48, 2, 1, "", "BaseTreeRegressor"]], "wildboar.tree._base.BaseTree": [[48, 3, 1, "", "apply"], [48, 3, 1, "", "decision_path"], [48, 3, 1, "", "get_metadata_routing"], [48, 3, 1, "", "get_params"], [48, 3, 1, "", "set_params"]], "wildboar.tree._base.BaseTreeClassifier": [[48, 3, 1, "", "apply"], [48, 3, 1, "", "decision_path"], [48, 3, 1, "", "fit"], [48, 3, 1, "", "get_metadata_routing"], [48, 3, 1, "", "get_params"], [48, 3, 1, "", "predict"], [48, 3, 1, "", "predict_proba"], [48, 3, 1, "", "score"], [48, 3, 1, "", "set_params"]], "wildboar.tree._base.BaseTreeRegressor": [[48, 3, 1, "", "apply"], [48, 3, 1, "", "decision_path"], [48, 3, 1, "", "fit"], [48, 3, 1, "", "get_metadata_routing"], [48, 3, 1, "", "get_params"], [48, 3, 1, "", "predict"], [48, 3, 1, "", "score"], [48, 3, 1, "", "set_params"]], "wildboar.tree._ptree": [[49, 2, 1, "", "ProximityTreeClassifier"]], "wildboar.tree._ptree.ProximityTreeClassifier": [[49, 3, 1, "", "apply"], [49, 3, 1, "", "decision_path"], [49, 3, 1, "", "fit"], [49, 3, 1, "", "get_metadata_routing"], [49, 3, 1, "", "get_params"], [49, 3, 1, "", "predict"], [49, 3, 1, "", "predict_proba"], [49, 3, 1, "", "score"], [49, 3, 1, "", "set_params"]], "wildboar.tree._tree": [[50, 2, 1, "", "BaseFeatureTreeClassifier"], [50, 2, 1, "", "BaseFeatureTreeRegressor"], [50, 2, 1, "", "ExtraShapeletTreeClassifier"], [50, 2, 1, "", "ExtraShapeletTreeRegressor"], [50, 2, 1, "", "IntervalTreeClassifier"], [50, 2, 1, "", "IntervalTreeRegressor"], [50, 2, 1, "", "PivotTreeClassifier"], [50, 2, 1, "", "RocketTreeClassifier"], [50, 2, 1, "", "RocketTreeRegressor"], [50, 2, 1, "", "ShapeletTreeClassifier"], [50, 2, 1, "", "ShapeletTreeRegressor"]], "wildboar.tree._tree.BaseFeatureTreeClassifier": [[50, 3, 1, "", "apply"], [50, 3, 1, "", "decision_path"], [50, 3, 1, "", "fit"], [50, 3, 1, "", "get_metadata_routing"], [50, 3, 1, "", "get_params"], [50, 3, 1, "", "predict"], [50, 3, 1, "", "predict_proba"], [50, 3, 1, "", "score"], [50, 3, 1, "", "set_params"]], "wildboar.tree._tree.BaseFeatureTreeRegressor": [[50, 3, 1, "", "apply"], [50, 3, 1, "", "decision_path"], [50, 3, 1, "", "fit"], [50, 3, 1, "", "get_metadata_routing"], [50, 3, 1, "", "get_params"], [50, 3, 1, "", "predict"], [50, 3, 1, "", "score"], [50, 3, 1, "", "set_params"]], "wildboar.tree._tree.ExtraShapeletTreeClassifier": [[50, 3, 1, "", "apply"], [50, 3, 1, "", "decision_path"], [50, 3, 1, "", "fit"], [50, 3, 1, "", "get_metadata_routing"], [50, 3, 1, "", "get_params"], [50, 3, 1, "", "predict"], [50, 3, 1, "", "predict_proba"], [50, 3, 1, "", "score"], [50, 3, 1, "", "set_params"]], "wildboar.tree._tree.ExtraShapeletTreeRegressor": [[50, 3, 1, "", "apply"], [50, 3, 1, "", "decision_path"], [50, 3, 1, "", "fit"], [50, 3, 1, "", "get_metadata_routing"], [50, 3, 1, "", "get_params"], [50, 3, 1, "", "predict"], [50, 3, 1, "", "score"], [50, 3, 1, "", "set_params"]], "wildboar.tree._tree.IntervalTreeClassifier": [[50, 3, 1, "", "apply"], [50, 3, 1, "", "decision_path"], [50, 3, 1, "", "fit"], [50, 3, 1, "", "get_metadata_routing"], [50, 3, 1, "", "get_params"], [50, 3, 1, "", "predict"], [50, 3, 1, "", "predict_proba"], [50, 3, 1, "", "score"], [50, 3, 1, "", "set_params"]], "wildboar.tree._tree.IntervalTreeRegressor": [[50, 3, 1, "", "apply"], [50, 3, 1, "", "decision_path"], [50, 3, 1, "", "fit"], [50, 3, 1, "", "get_metadata_routing"], [50, 3, 1, "", "get_params"], [50, 3, 1, "", "predict"], [50, 3, 1, "", "score"], [50, 3, 1, "", "set_params"]], "wildboar.tree._tree.PivotTreeClassifier": [[50, 3, 1, "", "apply"], [50, 3, 1, "", "decision_path"], [50, 3, 1, "", "fit"], [50, 3, 1, "", "get_metadata_routing"], [50, 3, 1, "", "get_params"], [50, 3, 1, "", "predict"], [50, 3, 1, "", "predict_proba"], [50, 3, 1, "", "score"], [50, 3, 1, "", "set_params"]], "wildboar.tree._tree.RocketTreeClassifier": [[50, 3, 1, "", "apply"], [50, 3, 1, "", "decision_path"], [50, 3, 1, "", "fit"], [50, 3, 1, "", "get_metadata_routing"], [50, 3, 1, "", "get_params"], [50, 3, 1, "", "predict"], [50, 3, 1, "", "predict_proba"], [50, 3, 1, "", "score"], [50, 3, 1, "", "set_params"]], "wildboar.tree._tree.RocketTreeRegressor": [[50, 3, 1, "", "apply"], [50, 3, 1, "", "decision_path"], [50, 3, 1, "", "fit"], [50, 3, 1, "", "get_metadata_routing"], [50, 3, 1, "", "get_params"], [50, 3, 1, "", "predict"], [50, 3, 1, "", "score"], [50, 3, 1, "", "set_params"]], "wildboar.tree._tree.ShapeletTreeClassifier": [[50, 3, 1, "", "apply"], [50, 3, 1, "", "decision_path"], [50, 3, 1, "", "fit"], [50, 3, 1, "", "get_metadata_routing"], [50, 3, 1, "", "get_params"], [50, 3, 1, "", "predict"], [50, 3, 1, "", "predict_proba"], [50, 3, 1, "", "score"], [50, 3, 1, "", "set_params"]], "wildboar.tree._tree.ShapeletTreeRegressor": [[50, 3, 1, "", "apply"], [50, 3, 1, "", "decision_path"], [50, 3, 1, "", "fit"], [50, 3, 1, "", "get_metadata_routing"], [50, 3, 1, "", "get_params"], [50, 3, 1, "", "predict"], [50, 3, 1, "", "score"], [50, 3, 1, "", "set_params"]], "wildboar.utils": [[52, 0, 0, "-", "_parallel"], [53, 0, 0, "-", "_testing"], [56, 1, 1, "", "check_X_y"], [56, 1, 1, "", "check_array"], [54, 0, 0, "-", "decorators"], [55, 0, 0, "-", "estimator_checks"], [57, 0, 0, "-", "plot"], [58, 0, 0, "-", "validation"], [59, 0, 0, "-", "variable_len"]], "wildboar.utils._parallel": [[52, 1, 1, "", "run_in_parallel"]], "wildboar.utils._testing": [[53, 1, 1, "", "assert_exhaustive_parameter_checks"], [53, 1, 1, "", "assert_parameter_checks"]], "wildboar.utils.decorators": [[54, 1, 1, "", "array_or_scalar"], [54, 1, 1, "", "singleton"], [54, 1, 1, "", "unstable"]], "wildboar.utils.estimator_checks": [[55, 1, 1, "", "check_estimator"]], "wildboar.utils.plot": [[57, 2, 1, "", "MidpointNormalize"], [57, 1, 1, "", "plot_frequency_domain"], [57, 1, 1, "", "plot_time_domain"]], "wildboar.utils.plot.MidpointNormalize": [[57, 3, 1, "", "autoscale"], [57, 3, 1, "", "autoscale_None"], [57, 3, 1, "", "process_value"], [57, 3, 1, "", "scaled"]], "wildboar.utils.validation": [[58, 1, 1, "", "check_X_y"], [58, 1, 1, "", "check_array"], [58, 1, 1, "", "check_classification_targets"], [58, 1, 1, "", "check_option"], [58, 1, 1, "", "check_type"]], "wildboar.utils.variable_len": [[59, 1, 1, "", "get_variable_length"], [59, 1, 1, "", "is_end_of_series"], [59, 1, 1, "", "is_variable_length"]]}, "objtypes": {"0": "py:module", "1": "py:function", "2": "py:class", "3": "py:method", "4": "py:property"}, "objnames": {"0": ["py", "module", "Python module"], "1": ["py", "function", "Python function"], "2": ["py", "class", "Python class"], "3": ["py", "method", "Python method"], "4": ["py", "property", "Python property"]}, "titleterms": {"wildboar": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 80, 84], "function": [0, 1, 2, 3, 4, 5, 7, 8, 9, 10, 11, 14, 15, 18, 19, 23, 24, 25, 31, 32, 33, 35, 36, 38, 45, 47, 52, 53, 54, 55, 56, 57, 58, 59, 80], "annot": [0, 1, 2, 3, 64, 80], "base": [0, 4, 75, 76, 80], "class": [0, 4, 6, 7, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 34, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 57, 80], "dataset": [0, 5, 6, 7, 8, 9, 66, 80, 83], "outlier": [0, 8, 78, 79, 80], "preprocess": [0, 9, 80], "distanc": [0, 10, 11, 12, 13, 14, 15, 71, 72, 80], "dtw": [0, 14, 80], "ensembl": [0, 16, 17, 74, 80], "explain": [0, 18, 19, 20, 21, 22, 23, 24, 80], "counterfactu": [0, 19, 20, 21, 22, 23, 80], "linear_model": [0, 26, 27, 28, 29, 30, 80], "metric": [0, 31, 32, 33, 70, 71, 72, 80], "model_select": [0, 34, 35, 36, 80], "transform": [0, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 62, 75, 80, 83], "tree": [0, 48, 49, 50, 51, 76, 80], "util": [0, 52, 53, 54, 55, 56, 57, 58, 59, 80], "_motif": 1, "modul": [1, 2, 4, 5, 6, 8, 9, 10, 11, 13, 14, 16, 18, 19, 20, 21, 22, 26, 27, 28, 29, 31, 32, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 48, 49, 50, 52, 53, 54, 55, 57, 58, 59], "content": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59], "_segment": 2, "packag": [3, 7, 15, 17, 23, 24, 25, 30, 33, 36, 47, 51, 56], "_filter": 5, "_repositori": 6, "submodul": [7, 15, 25, 56], "_distanc": 10, "_matrix_profil": [11, 42], "_multi_metr": 12, "_neighbor": 13, "_ensembl": 16, "_import": 18, "_helper": 19, "_nn": 20, "_proto": 21, "_sf": 22, "subpackag": [24, 25], "attribut": 25, "_hydra": [26, 40], "_rocket": [27, 44], "_shapelet": [28, 46], "_transform": 29, "_cluster": 31, "_counterfactu": 32, "_cv": 34, "_outlier": 35, "_base": [37, 48], "_conv": 38, "_diff": 39, "_interv": 41, "_pivot": 43, "_sax": 45, "_ptree": 49, "_tree": 50, "_parallel": 52, "_test": 53, "decor": 54, "estimator_check": 55, "plot": 57, "valid": 58, "variable_len": 59, "version": [60, 81], "exampl": [61, 83], "convolut": 62, "hydra": 62, "rocket": 62, "first": 62, "order": 62, "differ": 62, "user": 63, "guid": 63, "time": [65, 72, 83], "seri": [65, 83], "variabl": 65, "length": 65, "load": [66, 83], "singl": 66, "multipl": 66, "filter": 66, "pre": 67, "process": 67, "repositori": 68, "definit": 68, "instal": [68, 84], "local": 68, "cach": 68, "json": 68, "glossari": 69, "subsequ": [70, 71, 72], "elast": [70, 72], "non": 70, "pairwis": 71, "pair": 71, "multivari": 71, "support": 71, "search": 71, "benchmark": [71, 79], "dynam": 72, "warp": 72, "longest": 72, "common": 72, "edit": 72, "real": 72, "penalti": 72, "sequenc": 72, "move": 72, "split": 72, "merg": 72, "supervis": 73, "learn": [73, 77, 83], "estim": [74, 75, 76], "shapelet": 74, "forest": 74, "proxim": 74, "unsupervis": 77, "detect": [78, 79], "minor": 79, "label": 79, "major": 79, "emmott": 79, "what": 81, "": 81, "new": 81, "depend": 81, "1": 81, "2": 81, "0": 81, "chang": 81, "model": [81, 83], "changelog": 81, "other": 81, "improv": 81, "quickstart": 82, "get": 83, "start": 83, "machin": 83, "an": 83, "predict": 83, "tabular": 83, "data": 83, "explor": 83, "perform": 83, "persist": 83, "latest": 84, "releas": 84, "build": 84, "compil": 84, "from": 84, "sourc": 84}, "envversion": {"sphinx.domains.c": 2, "sphinx.domains.changeset": 1, "sphinx.domains.citation": 1, "sphinx.domains.cpp": 8, "sphinx.domains.index": 1, "sphinx.domains.javascript": 2, "sphinx.domains.math": 2, "sphinx.domains.python": 3, "sphinx.domains.rst": 2, "sphinx.domains.std": 2, "nbsphinx": 4, "sphinx.ext.intersphinx": 1, "sphinx": 57}, "alltitles": {"wildboar": [[0, "wildboar"], [25, "module-wildboar"], [80, "id1"]], "Functions": [[0, "id1"], [0, "id2"], [0, "id4"], [0, "id6"], [0, "id7"], [0, "id8"], [0, "id10"], [0, "id11"], [0, "id14"], [0, "id16"], [0, "id18"], [0, "id20"], [0, "id22"], [0, "id24"], [1, "functions"], [2, "functions"], [3, "functions"], [4, "functions"], [5, "functions"], [7, "functions"], [8, "functions"], [9, "functions"], [10, "functions"], [11, "functions"], [14, "functions"], [15, "functions"], [18, "functions"], [19, "functions"], [23, "functions"], [24, "functions"], [25, "functions"], [31, "functions"], [32, "functions"], [33, "functions"], [35, "functions"], [36, "functions"], [38, "functions"], [45, "functions"], [47, "functions"], [52, "functions"], [53, "functions"], [54, "functions"], [55, "functions"], [56, "functions"], [57, "functions"], [58, "functions"], [59, "functions"], [80, "id2"], [80, "id3"], [80, "id5"], [80, "id7"], [80, "id8"], [80, "id9"], [80, "id11"], [80, "id12"], [80, "id15"], [80, "id17"], [80, "id19"], [80, "id21"], [80, "id23"], [80, "id25"]], "wildboar.annotate": [[0, "wildboar-annotate"], [3, "module-wildboar.annotate"], [80, "wildboar-annotate"]], "wildboar.base": [[0, "wildboar-base"], [4, "module-wildboar.base"], [80, "wildboar-base"]], "Classes": [[0, "id3"], [0, "id5"], [0, "id9"], [0, "id12"], [0, "id13"], [0, "id15"], [0, "id17"], [0, "id19"], [0, "id21"], [0, "id23"], [4, "classes"], [6, "classes"], [7, "classes"], [13, "classes"], [15, "classes"], [16, "classes"], [17, "classes"], [18, "classes"], [20, "classes"], [21, "classes"], [22, "classes"], [23, "classes"], [24, "classes"], [26, "classes"], [27, "classes"], [28, "classes"], [29, "classes"], [30, "classes"], [34, "classes"], [36, "classes"], [37, "classes"], [39, "classes"], [40, "classes"], [41, "classes"], [42, "classes"], [43, "classes"], [44, "classes"], [45, "classes"], [46, "classes"], [47, "classes"], [48, "classes"], [49, "classes"], [50, "classes"], [51, "classes"], [57, "classes"], [80, "id4"], [80, "id6"], [80, "id10"], [80, "id13"], [80, "id14"], [80, "id16"], [80, "id18"], [80, "id20"], [80, "id22"], [80, "id24"]], "wildboar.datasets": [[0, "wildboar-datasets"], [7, "module-wildboar.datasets"], [80, "wildboar-datasets"]], "wildboar.datasets.outlier": [[0, "wildboar-datasets-outlier"], [8, "module-wildboar.datasets.outlier"], [80, "wildboar-datasets-outlier"]], "wildboar.datasets.preprocess": [[0, "wildboar-datasets-preprocess"], [9, "module-wildboar.datasets.preprocess"], [80, "wildboar-datasets-preprocess"]], "wildboar.distance": [[0, "wildboar-distance"], [15, "module-wildboar.distance"], [80, "wildboar-distance"]], "wildboar.distance.dtw": [[0, "wildboar-distance-dtw"], [14, "module-wildboar.distance.dtw"], [80, "wildboar-distance-dtw"]], "wildboar.ensemble": [[0, "wildboar-ensemble"], [17, "module-wildboar.ensemble"], [80, "wildboar-ensemble"]], "wildboar.explain": [[0, "wildboar-explain"], [24, "module-wildboar.explain"], [80, "wildboar-explain"]], "wildboar.explain.counterfactual": [[0, "wildboar-explain-counterfactual"], [23, "module-wildboar.explain.counterfactual"], [80, "wildboar-explain-counterfactual"]], "wildboar.linear_model": [[0, "wildboar-linear-model"], [30, "module-wildboar.linear_model"], [80, "wildboar-linear-model"]], "wildboar.metrics": [[0, "wildboar-metrics"], [33, "module-wildboar.metrics"], [80, "wildboar-metrics"]], "wildboar.model_selection": [[0, "wildboar-model-selection"], [36, "module-wildboar.model_selection"], [80, "wildboar-model-selection"]], "wildboar.transform": [[0, "wildboar-transform"], [47, "module-wildboar.transform"], [80, "wildboar-transform"]], "wildboar.tree": [[0, "wildboar-tree"], [51, "module-wildboar.tree"], [80, "wildboar-tree"]], "wildboar.utils": [[0, "wildboar-utils"], [56, "module-wildboar.utils"], [80, "wildboar-utils"]], "wildboar.annotate._motifs": [[1, "module-wildboar.annotate._motifs"]], "Module Contents": [[1, "module-contents"], [2, "module-contents"], [4, "module-contents"], [5, "module-contents"], [6, "module-contents"], [8, "module-contents"], [9, "module-contents"], [10, "module-contents"], [11, "module-contents"], [13, "module-contents"], [14, "module-contents"], [16, "module-contents"], [18, "module-contents"], [19, "module-contents"], [20, "module-contents"], [21, "module-contents"], [22, "module-contents"], [26, "module-contents"], [27, "module-contents"], [28, "module-contents"], [29, "module-contents"], [31, "module-contents"], [32, "module-contents"], [34, "module-contents"], [35, "module-contents"], [37, "module-contents"], [38, "module-contents"], [39, "module-contents"], [40, "module-contents"], [41, "module-contents"], [42, "module-contents"], [43, "module-contents"], [44, "module-contents"], [45, "module-contents"], [46, "module-contents"], [48, "module-contents"], [49, "module-contents"], [50, "module-contents"], [52, "module-contents"], [53, "module-contents"], [54, "module-contents"], [55, "module-contents"], [57, "module-contents"], [58, "module-contents"], [59, "module-contents"]], "wildboar.annotate._segment": [[2, "module-wildboar.annotate._segment"]], "Package Contents": [[3, "package-contents"], [7, "package-contents"], [15, "package-contents"], [17, "package-contents"], [23, "package-contents"], [24, "package-contents"], [25, "package-contents"], [30, "package-contents"], [33, "package-contents"], [36, "package-contents"], [47, "package-contents"], [51, "package-contents"], [56, "package-contents"]], "wildboar.datasets._filter": [[5, "module-wildboar.datasets._filter"]], "wildboar.datasets._repository": [[6, "module-wildboar.datasets._repository"]], "Submodules": [[7, "submodules"], [15, "submodules"], [25, "submodules"], [56, "submodules"]], "wildboar.distance._distance": [[10, "module-wildboar.distance._distance"]], "wildboar.distance._matrix_profile": [[11, "module-wildboar.distance._matrix_profile"]], "wildboar.distance._multi_metric": [[12, "module-wildboar.distance._multi_metric"]], "wildboar.distance._neighbors": [[13, "module-wildboar.distance._neighbors"]], "wildboar.ensemble._ensemble": [[16, "module-wildboar.ensemble._ensemble"]], "wildboar.explain._importance": [[18, "module-wildboar.explain._importance"]], "wildboar.explain.counterfactual._helper": [[19, "module-wildboar.explain.counterfactual._helper"]], "wildboar.explain.counterfactual._nn": [[20, "module-wildboar.explain.counterfactual._nn"]], "wildboar.explain.counterfactual._proto": [[21, "module-wildboar.explain.counterfactual._proto"]], "wildboar.explain.counterfactual._sf": [[22, "module-wildboar.explain.counterfactual._sf"]], "Subpackages": [[24, "subpackages"], [25, "subpackages"]], "Attributes": [[25, "attributes"]], "wildboar.linear_model._hydra": [[26, "module-wildboar.linear_model._hydra"]], "wildboar.linear_model._rocket": [[27, "module-wildboar.linear_model._rocket"]], "wildboar.linear_model._shapelet": [[28, "module-wildboar.linear_model._shapelet"]], "wildboar.linear_model._transform": [[29, "module-wildboar.linear_model._transform"]], "wildboar.metrics._cluster": [[31, "module-wildboar.metrics._cluster"]], "wildboar.metrics._counterfactual": [[32, "module-wildboar.metrics._counterfactual"]], "wildboar.model_selection._cv": [[34, "module-wildboar.model_selection._cv"]], "wildboar.model_selection._outlier": [[35, "module-wildboar.model_selection._outlier"]], "wildboar.transform._base": [[37, "module-wildboar.transform._base"]], "wildboar.transform._conv": [[38, "module-wildboar.transform._conv"]], "wildboar.transform._diff": [[39, "module-wildboar.transform._diff"]], "wildboar.transform._hydra": [[40, "module-wildboar.transform._hydra"]], "wildboar.transform._interval": [[41, "module-wildboar.transform._interval"]], "wildboar.transform._matrix_profile": [[42, "module-wildboar.transform._matrix_profile"]], "wildboar.transform._pivot": [[43, "module-wildboar.transform._pivot"]], "wildboar.transform._rocket": [[44, "module-wildboar.transform._rocket"]], "wildboar.transform._sax": [[45, "module-wildboar.transform._sax"]], "wildboar.transform._shapelet": [[46, "module-wildboar.transform._shapelet"]], "wildboar.tree._base": [[48, "module-wildboar.tree._base"]], "wildboar.tree._ptree": [[49, "module-wildboar.tree._ptree"]], "wildboar.tree._tree": [[50, "module-wildboar.tree._tree"]], "wildboar.utils._parallel": [[52, "module-wildboar.utils._parallel"]], "wildboar.utils._testing": [[53, "module-wildboar.utils._testing"]], "wildboar.utils.decorators": [[54, "module-wildboar.utils.decorators"]], "wildboar.utils.estimator_checks": [[55, "module-wildboar.utils.estimator_checks"]], "wildboar.utils.plot": [[57, "module-wildboar.utils.plot"]], "wildboar.utils.validation": [[58, "module-wildboar.utils.validation"]], "wildboar.utils.variable_len": [[59, "module-wildboar.utils.variable_len"]], "wildboar.version": [[60, "module-wildboar.version"]], "Examples": [[61, "examples"]], "Convolution transforms": [[62, "Convolution-transforms"]], "Hydra transform": [[62, "Hydra-transform"]], "Rocket transform": [[62, "Rocket-transform"]], "Hydra transform with first order differences": [[62, "Hydra-transform-with-first-order-differences"]], "Rocket transform with first order differences": [[62, "Rocket-transform-with-first-order-differences"]], "User guide": [[63, "user-guide"]], "Annotate": [[64, "annotate"]], "Time series": [[65, "time-series"]], "Variable length time series": [[65, "variable-length-time-series"]], "Datasets": [[66, "datasets"]], "Loading datasets": [[66, "loading-datasets"]], "Loading a single dataset": [[66, "loading-a-single-dataset"]], "Loading multiple datasets": [[66, "loading-multiple-datasets"]], "Filters": [[66, "filters"]], "Pre-processing": [[67, "pre-processing"]], "Repositories": [[68, "repositories"]], "Repository definitions": [[68, "repository-definitions"]], "Installing repositories": [[68, "installing-repositories"]], "Local cache": [[68, "local-cache"]], "JSON repositories": [[68, "json-repositories"]], "Glossary": [[69, "glossary"]], "Metrics": [[70, "metrics"], [71, "metrics"]], "Subsequence metrics": [[70, "subsequence-metrics"], [71, "subsequence-metrics"]], "Elastic and non-elastic metrics": [[70, "elastic-and-non-elastic-metrics"]], "Distance": [[71, "distance"]], "Pairwise distance": [[71, "pairwise-distance"]], "Paired distance": [[71, "paired-distance"]], "Multivariate support": [[71, "multivariate-support"]], "Subsequence search": [[71, "subsequence-search"]], "Pairwise subsequence distance": [[71, "pairwise-subsequence-distance"]], "Benchmark": [[71, "benchmark"]], "Elastic metrics": [[72, "elastic-metrics"]], "Dynamic time warping": [[72, "dynamic-time-warping"]], "Longest common subsequence": [[72, "longest-common-subsequence"]], "Edit-distance with real penalty": [[72, "edit-distance-with-real-penalty"]], "Edit-distance for real sequence": [[72, "edit-distance-for-real-sequence"]], "Time-warp edit distance": [[72, "time-warp-edit-distance"]], "Move-split-merge": [[72, "move-split-merge"]], "Supervised learning": [[73, "supervised-learning"]], "Ensemble estimators": [[74, "ensemble-estimators"]], "Shapelet forests": [[74, "shapelet-forests"]], "Proximity forests": [[74, "proximity-forests"]], "Transform-based estimators": [[75, "transform-based-estimators"]], "Tree-based estimators": [[76, "tree-based-estimators"]], "Unsupervised learning": [[77, "unsupervised-learning"]], "Outlier detection": [[78, "outlier-detection"]], "Outlier detection benchmarks": [[79, "outlier-detection-benchmarks"]], "Minority labeler": [[79, "minority-labeler"]], "Majority labeler": [[79, "majority-labeler"]], "Emmott labeler": [[79, "emmott-labeler"]], "Wildboar": [[80, "wildboar"]], "What\u2019s new": [[81, "what-s-new"]], "Dependencies": [[81, "dependencies"]], "Version 1.2.0": [[81, "version-1-2-0"]], "New and changed models": [[81, "new-and-changed-models"]], "Changelog": [[81, "changelog"]], "Other improvements": [[81, "other-improvements"]], "Quickstart": [[82, "quickstart"]], "Getting started": [[83, "getting-started"]], "Machine learning": [[83, "machine-learning"]], "Loading an example dataset": [[83, "loading-an-example-dataset"]], "Learning and predicting": [[83, "learning-and-predicting"]], "Transforming time series to tabular data": [[83, "transforming-time-series-to-tabular-data"]], "Exploring model performance": [[83, "exploring-model-performance"]], "Model persistence": [[83, "model-persistence"]], "Install wildboar": [[84, "install-wildboar"]], "Install the latest release": [[84, "install-the-latest-release"]], "Build and compile from source": [[84, "build-and-compile-from-source"]]}, "indexentries": {"module": [[1, "module-wildboar.annotate._motifs"], [2, "module-wildboar.annotate._segment"], [3, "module-wildboar.annotate"], [4, "module-wildboar.base"], [5, "module-wildboar.datasets._filter"], [6, "module-wildboar.datasets._repository"], [7, "module-wildboar.datasets"], [8, "module-wildboar.datasets.outlier"], [9, "module-wildboar.datasets.preprocess"], [10, "module-wildboar.distance._distance"], [11, "module-wildboar.distance._matrix_profile"], [12, "module-wildboar.distance._multi_metric"], [13, "module-wildboar.distance._neighbors"], [14, "module-wildboar.distance.dtw"], [15, "module-wildboar.distance"], [16, "module-wildboar.ensemble._ensemble"], [17, "module-wildboar.ensemble"], [18, "module-wildboar.explain._importance"], [19, "module-wildboar.explain.counterfactual._helper"], [20, "module-wildboar.explain.counterfactual._nn"], [21, "module-wildboar.explain.counterfactual._proto"], [22, "module-wildboar.explain.counterfactual._sf"], [23, "module-wildboar.explain.counterfactual"], [24, "module-wildboar.explain"], [25, "module-wildboar"], [26, "module-wildboar.linear_model._hydra"], [27, "module-wildboar.linear_model._rocket"], [28, "module-wildboar.linear_model._shapelet"], [29, "module-wildboar.linear_model._transform"], [30, "module-wildboar.linear_model"], [31, "module-wildboar.metrics._cluster"], [32, "module-wildboar.metrics._counterfactual"], [33, "module-wildboar.metrics"], [34, "module-wildboar.model_selection._cv"], [35, "module-wildboar.model_selection._outlier"], [36, "module-wildboar.model_selection"], [37, "module-wildboar.transform._base"], [38, "module-wildboar.transform._conv"], [39, "module-wildboar.transform._diff"], [40, "module-wildboar.transform._hydra"], [41, "module-wildboar.transform._interval"], [42, "module-wildboar.transform._matrix_profile"], [43, "module-wildboar.transform._pivot"], [44, "module-wildboar.transform._rocket"], [45, "module-wildboar.transform._sax"], [46, "module-wildboar.transform._shapelet"], [47, "module-wildboar.transform"], [48, "module-wildboar.tree._base"], [49, "module-wildboar.tree._ptree"], [50, "module-wildboar.tree._tree"], [51, "module-wildboar.tree"], [52, "module-wildboar.utils._parallel"], [53, "module-wildboar.utils._testing"], [54, "module-wildboar.utils.decorators"], [55, "module-wildboar.utils.estimator_checks"], [56, "module-wildboar.utils"], [57, "module-wildboar.utils.plot"], [58, "module-wildboar.utils.validation"], [59, "module-wildboar.utils.variable_len"], [60, "module-wildboar.version"]], "motifs() (in module wildboar.annotate._motifs)": [[1, "wildboar.annotate._motifs.motifs"]], "wildboar.annotate._motifs": [[1, "module-wildboar.annotate._motifs"]], "segment() (in module wildboar.annotate._segment)": [[2, "wildboar.annotate._segment.segment"]], "wildboar.annotate._segment": [[2, "module-wildboar.annotate._segment"]], "motifs() (in module wildboar.annotate)": [[3, "wildboar.annotate.motifs"]], "segment() (in module wildboar.annotate)": [[3, "wildboar.annotate.segment"]], "wildboar.annotate": [[3, "module-wildboar.annotate"]], "baseestimator (class in wildboar.base)": [[4, "wildboar.base.BaseEstimator"]], "counterfactualmixin (class in wildboar.base)": [[4, "wildboar.base.CounterfactualMixin"]], "explainermixin (class in wildboar.base)": [[4, "wildboar.base.ExplainerMixin"]], "fit_explain() (wildboar.base.explainermixin method)": [[4, "wildboar.base.ExplainerMixin.fit_explain"]], "get_metadata_routing() (wildboar.base.baseestimator method)": [[4, "wildboar.base.BaseEstimator.get_metadata_routing"]], "get_params() (wildboar.base.baseestimator method)": [[4, "wildboar.base.BaseEstimator.get_params"]], "is_counterfactual() (in module wildboar.base)": [[4, "wildboar.base.is_counterfactual"]], "is_explainer() (in module wildboar.base)": [[4, "wildboar.base.is_explainer"]], "plot() (wildboar.base.explainermixin method)": [[4, "wildboar.base.ExplainerMixin.plot"]], "score() (wildboar.base.counterfactualmixin method)": [[4, "wildboar.base.CounterfactualMixin.score"]], "set_params() (wildboar.base.baseestimator method)": [[4, "wildboar.base.BaseEstimator.set_params"]], "wildboar.base": [[4, "module-wildboar.base"]], "make_dict_filter() (in module wildboar.datasets._filter)": [[5, "wildboar.datasets._filter.make_dict_filter"]], "make_filter() (in module wildboar.datasets._filter)": [[5, "wildboar.datasets._filter.make_filter"]], "make_list_filter() (in module wildboar.datasets._filter)": [[5, "wildboar.datasets._filter.make_list_filter"]], "make_str_filter() (in module wildboar.datasets._filter)": [[5, "wildboar.datasets._filter.make_str_filter"]], "wildboar.datasets._filter": [[5, "module-wildboar.datasets._filter"]], "bundle (class in wildboar.datasets._repository)": [[6, "wildboar.datasets._repository.Bundle"]], "jsonrepository (class in wildboar.datasets._repository)": [[6, "wildboar.datasets._repository.JSONRepository"]], "npbundle (class in wildboar.datasets._repository)": [[6, "wildboar.datasets._repository.NpBundle"]], "repository (class in wildboar.datasets._repository)": [[6, "wildboar.datasets._repository.Repository"]], "download_url (wildboar.datasets._repository.jsonrepository property)": [[6, "wildboar.datasets._repository.JSONRepository.download_url"]], "download_url (wildboar.datasets._repository.repository property)": [[6, "wildboar.datasets._repository.Repository.download_url"]], "get_bundle() (wildboar.datasets._repository.jsonrepository method)": [[6, "wildboar.datasets._repository.JSONRepository.get_bundle"]], "get_bundle() (wildboar.datasets._repository.repository method)": [[6, "wildboar.datasets._repository.Repository.get_bundle"]], "get_bundles() (wildboar.datasets._repository.jsonrepository method)": [[6, "wildboar.datasets._repository.JSONRepository.get_bundles"]], "get_bundles() (wildboar.datasets._repository.repository method)": [[6, "wildboar.datasets._repository.Repository.get_bundles"]], "get_collection() (wildboar.datasets._repository.bundle method)": [[6, "wildboar.datasets._repository.Bundle.get_collection"]], "get_collection() (wildboar.datasets._repository.npbundle method)": [[6, "wildboar.datasets._repository.NpBundle.get_collection"]], "get_filename() (wildboar.datasets._repository.bundle method)": [[6, "wildboar.datasets._repository.Bundle.get_filename"]], "get_filename() (wildboar.datasets._repository.npbundle method)": [[6, "wildboar.datasets._repository.NpBundle.get_filename"]], "list() (wildboar.datasets._repository.bundle method)": [[6, "wildboar.datasets._repository.Bundle.list"]], "list() (wildboar.datasets._repository.npbundle method)": [[6, "wildboar.datasets._repository.NpBundle.list"]], "load() (wildboar.datasets._repository.bundle method)": [[6, "wildboar.datasets._repository.Bundle.load"]], "load() (wildboar.datasets._repository.npbundle method)": [[6, "wildboar.datasets._repository.NpBundle.load"]], "name (wildboar.datasets._repository.jsonrepository property)": [[6, "wildboar.datasets._repository.JSONRepository.name"]], "name (wildboar.datasets._repository.repository property)": [[6, "wildboar.datasets._repository.Repository.name"]], "refresh() (wildboar.datasets._repository.jsonrepository method)": [[6, "wildboar.datasets._repository.JSONRepository.refresh"]], "refresh() (wildboar.datasets._repository.repository method)": [[6, "wildboar.datasets._repository.Repository.refresh"]], "version (wildboar.datasets._repository.jsonrepository property)": [[6, "wildboar.datasets._repository.JSONRepository.version"]], "version (wildboar.datasets._repository.repository property)": [[6, "wildboar.datasets._repository.Repository.version"]], "wildboar.datasets._repository": [[6, "module-wildboar.datasets._repository"]], "wildboar_requires (wildboar.datasets._repository.jsonrepository property)": [[6, "wildboar.datasets._repository.JSONRepository.wildboar_requires"]], "wildboar_requires (wildboar.datasets._repository.repository property)": [[6, "wildboar.datasets._repository.Repository.wildboar_requires"]], "bundle (class in wildboar.datasets)": [[7, "wildboar.datasets.Bundle"]], "jsonrepository (class in wildboar.datasets)": [[7, "wildboar.datasets.JSONRepository"]], "npbundle (class in wildboar.datasets)": [[7, "wildboar.datasets.NpBundle"]], "repository (class in wildboar.datasets)": [[7, "wildboar.datasets.Repository"]], "clear_cache() (in module wildboar.datasets)": [[7, "wildboar.datasets.clear_cache"]], "download_url (wildboar.datasets.jsonrepository property)": [[7, "wildboar.datasets.JSONRepository.download_url"]], "download_url (wildboar.datasets.repository property)": [[7, "wildboar.datasets.Repository.download_url"]], "get_bundle() (wildboar.datasets.jsonrepository method)": [[7, "wildboar.datasets.JSONRepository.get_bundle"]], "get_bundle() (wildboar.datasets.repository method)": [[7, "wildboar.datasets.Repository.get_bundle"]], "get_bundles() (in module wildboar.datasets)": [[7, "wildboar.datasets.get_bundles"]], "get_bundles() (wildboar.datasets.jsonrepository method)": [[7, "wildboar.datasets.JSONRepository.get_bundles"]], "get_bundles() (wildboar.datasets.repository method)": [[7, "wildboar.datasets.Repository.get_bundles"]], "get_collection() (wildboar.datasets.bundle method)": [[7, "wildboar.datasets.Bundle.get_collection"]], "get_collection() (wildboar.datasets.npbundle method)": [[7, "wildboar.datasets.NpBundle.get_collection"]], "get_filename() (wildboar.datasets.bundle method)": [[7, "wildboar.datasets.Bundle.get_filename"]], "get_filename() (wildboar.datasets.npbundle method)": [[7, "wildboar.datasets.NpBundle.get_filename"]], "get_repository() (in module wildboar.datasets)": [[7, "wildboar.datasets.get_repository"]], "install_repository() (in module wildboar.datasets)": [[7, "wildboar.datasets.install_repository"]], "list() (wildboar.datasets.bundle method)": [[7, "wildboar.datasets.Bundle.list"]], "list() (wildboar.datasets.npbundle method)": [[7, "wildboar.datasets.NpBundle.list"]], "list_bundles() (in module wildboar.datasets)": [[7, "wildboar.datasets.list_bundles"]], "list_collections() (in module wildboar.datasets)": [[7, "wildboar.datasets.list_collections"]], "list_datasets() (in module wildboar.datasets)": [[7, "wildboar.datasets.list_datasets"]], "list_repositories() (in module wildboar.datasets)": [[7, "wildboar.datasets.list_repositories"]], "load() (wildboar.datasets.bundle method)": [[7, "wildboar.datasets.Bundle.load"]], "load() (wildboar.datasets.npbundle method)": [[7, "wildboar.datasets.NpBundle.load"]], "load_dataset() (in module wildboar.datasets)": [[7, "wildboar.datasets.load_dataset"]], "load_datasets() (in module wildboar.datasets)": [[7, "wildboar.datasets.load_datasets"]], "load_gun_point() (in module wildboar.datasets)": [[7, "wildboar.datasets.load_gun_point"]], "load_synthetic_control() (in module wildboar.datasets)": [[7, "wildboar.datasets.load_synthetic_control"]], "load_two_lead_ecg() (in module wildboar.datasets)": [[7, "wildboar.datasets.load_two_lead_ecg"]], "name (wildboar.datasets.jsonrepository property)": [[7, "wildboar.datasets.JSONRepository.name"]], "name (wildboar.datasets.repository property)": [[7, "wildboar.datasets.Repository.name"]], "refresh() (wildboar.datasets.jsonrepository method)": [[7, "wildboar.datasets.JSONRepository.refresh"]], "refresh() (wildboar.datasets.repository method)": [[7, "wildboar.datasets.Repository.refresh"]], "refresh_repositories() (in module wildboar.datasets)": [[7, "wildboar.datasets.refresh_repositories"]], "set_cache_dir() (in module wildboar.datasets)": [[7, "wildboar.datasets.set_cache_dir"]], "version (wildboar.datasets.jsonrepository property)": [[7, "wildboar.datasets.JSONRepository.version"]], "version (wildboar.datasets.repository property)": [[7, "wildboar.datasets.Repository.version"]], "wildboar.datasets": [[7, "module-wildboar.datasets"]], "wildboar_requires (wildboar.datasets.jsonrepository property)": [[7, "wildboar.datasets.JSONRepository.wildboar_requires"]], "wildboar_requires (wildboar.datasets.repository property)": [[7, "wildboar.datasets.Repository.wildboar_requires"]], "density_outliers() (in module wildboar.datasets.outlier)": [[8, "wildboar.datasets.outlier.density_outliers"]], "emmott_outliers() (in module wildboar.datasets.outlier)": [[8, "wildboar.datasets.outlier.emmott_outliers"]], "kmeans_outliers() (in module wildboar.datasets.outlier)": [[8, "wildboar.datasets.outlier.kmeans_outliers"]], "majority_outliers() (in module wildboar.datasets.outlier)": [[8, "wildboar.datasets.outlier.majority_outliers"]], "minority_outliers() (in module wildboar.datasets.outlier)": [[8, "wildboar.datasets.outlier.minority_outliers"]], "wildboar.datasets.outlier": [[8, "module-wildboar.datasets.outlier"]], "maxabs_scale() (in module wildboar.datasets.preprocess)": [[9, "wildboar.datasets.preprocess.maxabs_scale"]], "minmax_scale() (in module wildboar.datasets.preprocess)": [[9, "wildboar.datasets.preprocess.minmax_scale"]], "named_preprocess() (in module wildboar.datasets.preprocess)": [[9, "wildboar.datasets.preprocess.named_preprocess"]], "standardize() (in module wildboar.datasets.preprocess)": [[9, "wildboar.datasets.preprocess.standardize"]], "truncate() (in module wildboar.datasets.preprocess)": [[9, "wildboar.datasets.preprocess.truncate"]], "wildboar.datasets.preprocess": [[9, "module-wildboar.datasets.preprocess"]], "paired_distance() (in module wildboar.distance._distance)": [[10, "wildboar.distance._distance.paired_distance"]], "paired_subsequence_distance() (in module wildboar.distance._distance)": [[10, "wildboar.distance._distance.paired_subsequence_distance"]], "paired_subsequence_match() (in module wildboar.distance._distance)": [[10, "wildboar.distance._distance.paired_subsequence_match"]], "pairwise_distance() (in module wildboar.distance._distance)": [[10, "wildboar.distance._distance.pairwise_distance"]], "pairwise_subsequence_distance() (in module wildboar.distance._distance)": [[10, "wildboar.distance._distance.pairwise_subsequence_distance"]], "subsequence_match() (in module wildboar.distance._distance)": [[10, "wildboar.distance._distance.subsequence_match"]], "wildboar.distance._distance": [[10, "module-wildboar.distance._distance"]], "matrix_profile() (in module wildboar.distance._matrix_profile)": [[11, "wildboar.distance._matrix_profile.matrix_profile"]], "wildboar.distance._matrix_profile": [[11, "module-wildboar.distance._matrix_profile"]], "wildboar.distance._multi_metric": [[12, "module-wildboar.distance._multi_metric"]], "kmeans (class in wildboar.distance._neighbors)": [[13, "wildboar.distance._neighbors.KMeans"]], "kmedoids (class in wildboar.distance._neighbors)": [[13, "wildboar.distance._neighbors.KMedoids"]], "kneighborsclassifier (class in wildboar.distance._neighbors)": [[13, "wildboar.distance._neighbors.KNeighborsClassifier"]], "fit() (wildboar.distance._neighbors.kmeans method)": [[13, "wildboar.distance._neighbors.KMeans.fit"]], "fit() (wildboar.distance._neighbors.kmedoids method)": [[13, "wildboar.distance._neighbors.KMedoids.fit"]], "fit() (wildboar.distance._neighbors.kneighborsclassifier method)": [[13, "wildboar.distance._neighbors.KNeighborsClassifier.fit"]], "fit_predict() (wildboar.distance._neighbors.kmeans method)": [[13, "wildboar.distance._neighbors.KMeans.fit_predict"]], "fit_predict() (wildboar.distance._neighbors.kmedoids method)": [[13, "wildboar.distance._neighbors.KMedoids.fit_predict"]], "fit_transform() (wildboar.distance._neighbors.kmeans method)": [[13, "wildboar.distance._neighbors.KMeans.fit_transform"]], "fit_transform() (wildboar.distance._neighbors.kmedoids method)": [[13, "wildboar.distance._neighbors.KMedoids.fit_transform"]], "get_metadata_routing() (wildboar.distance._neighbors.kmeans method)": [[13, "wildboar.distance._neighbors.KMeans.get_metadata_routing"]], "get_metadata_routing() (wildboar.distance._neighbors.kmedoids method)": [[13, "wildboar.distance._neighbors.KMedoids.get_metadata_routing"]], "get_metadata_routing() (wildboar.distance._neighbors.kneighborsclassifier method)": [[13, "wildboar.distance._neighbors.KNeighborsClassifier.get_metadata_routing"]], "get_params() (wildboar.distance._neighbors.kmeans method)": [[13, "wildboar.distance._neighbors.KMeans.get_params"]], "get_params() (wildboar.distance._neighbors.kmedoids method)": [[13, "wildboar.distance._neighbors.KMedoids.get_params"]], "get_params() (wildboar.distance._neighbors.kneighborsclassifier method)": [[13, "wildboar.distance._neighbors.KNeighborsClassifier.get_params"]], "predict() (wildboar.distance._neighbors.kmeans method)": [[13, "wildboar.distance._neighbors.KMeans.predict"]], "predict() (wildboar.distance._neighbors.kmedoids method)": [[13, "wildboar.distance._neighbors.KMedoids.predict"]], "predict() (wildboar.distance._neighbors.kneighborsclassifier method)": [[13, "wildboar.distance._neighbors.KNeighborsClassifier.predict"]], "predict_proba() (wildboar.distance._neighbors.kneighborsclassifier method)": [[13, "wildboar.distance._neighbors.KNeighborsClassifier.predict_proba"]], "score() (wildboar.distance._neighbors.kneighborsclassifier method)": [[13, "wildboar.distance._neighbors.KNeighborsClassifier.score"]], "set_output() (wildboar.distance._neighbors.kmeans method)": [[13, "wildboar.distance._neighbors.KMeans.set_output"]], "set_output() (wildboar.distance._neighbors.kmedoids method)": [[13, "wildboar.distance._neighbors.KMedoids.set_output"]], "set_params() (wildboar.distance._neighbors.kmeans method)": [[13, "wildboar.distance._neighbors.KMeans.set_params"]], "set_params() (wildboar.distance._neighbors.kmedoids method)": [[13, "wildboar.distance._neighbors.KMedoids.set_params"]], "set_params() (wildboar.distance._neighbors.kneighborsclassifier method)": [[13, "wildboar.distance._neighbors.KNeighborsClassifier.set_params"]], "transform() (wildboar.distance._neighbors.kmeans method)": [[13, "wildboar.distance._neighbors.KMeans.transform"]], "transform() (wildboar.distance._neighbors.kmedoids method)": [[13, "wildboar.distance._neighbors.KMedoids.transform"]], "wildboar.distance._neighbors": [[13, "module-wildboar.distance._neighbors"]], "ddtw_distance() (in module wildboar.distance.dtw)": [[14, "wildboar.distance.dtw.ddtw_distance"]], "dtw_alignment() (in module wildboar.distance.dtw)": [[14, "wildboar.distance.dtw.dtw_alignment"]], "dtw_average() (in module wildboar.distance.dtw)": [[14, "wildboar.distance.dtw.dtw_average"]], "dtw_distance() (in module wildboar.distance.dtw)": [[14, "wildboar.distance.dtw.dtw_distance"]], "dtw_envelop() (in module wildboar.distance.dtw)": [[14, "wildboar.distance.dtw.dtw_envelop"]], "dtw_lb_keogh() (in module wildboar.distance.dtw)": [[14, "wildboar.distance.dtw.dtw_lb_keogh"]], "dtw_mapping() (in module wildboar.distance.dtw)": [[14, "wildboar.distance.dtw.dtw_mapping"]], "jeong_weight() (in module wildboar.distance.dtw)": [[14, "wildboar.distance.dtw.jeong_weight"]], "wddtw_distance() (in module wildboar.distance.dtw)": [[14, "wildboar.distance.dtw.wddtw_distance"]], "wdtw_alignment() (in module wildboar.distance.dtw)": [[14, "wildboar.distance.dtw.wdtw_alignment"]], "wdtw_distance() (in module wildboar.distance.dtw)": [[14, "wildboar.distance.dtw.wdtw_distance"]], "wildboar.distance.dtw": [[14, "module-wildboar.distance.dtw"]], "kmeans (class in wildboar.distance)": [[15, "wildboar.distance.KMeans"]], "kmedoids (class in wildboar.distance)": [[15, "wildboar.distance.KMedoids"]], "kneighborsclassifier (class in wildboar.distance)": [[15, "wildboar.distance.KNeighborsClassifier"]], "fit() (wildboar.distance.kmeans method)": [[15, "wildboar.distance.KMeans.fit"]], "fit() (wildboar.distance.kmedoids method)": [[15, "wildboar.distance.KMedoids.fit"]], "fit() (wildboar.distance.kneighborsclassifier method)": [[15, "wildboar.distance.KNeighborsClassifier.fit"]], "fit_predict() (wildboar.distance.kmeans method)": [[15, "wildboar.distance.KMeans.fit_predict"]], "fit_predict() (wildboar.distance.kmedoids method)": [[15, "wildboar.distance.KMedoids.fit_predict"]], "fit_transform() (wildboar.distance.kmeans method)": [[15, "wildboar.distance.KMeans.fit_transform"]], "fit_transform() (wildboar.distance.kmedoids method)": [[15, "wildboar.distance.KMedoids.fit_transform"]], "get_metadata_routing() (wildboar.distance.kmeans method)": [[15, "wildboar.distance.KMeans.get_metadata_routing"]], "get_metadata_routing() (wildboar.distance.kmedoids method)": [[15, "wildboar.distance.KMedoids.get_metadata_routing"]], "get_metadata_routing() (wildboar.distance.kneighborsclassifier method)": [[15, "wildboar.distance.KNeighborsClassifier.get_metadata_routing"]], "get_params() (wildboar.distance.kmeans method)": [[15, "wildboar.distance.KMeans.get_params"]], "get_params() (wildboar.distance.kmedoids method)": [[15, "wildboar.distance.KMedoids.get_params"]], "get_params() (wildboar.distance.kneighborsclassifier method)": [[15, "wildboar.distance.KNeighborsClassifier.get_params"]], "matrix_profile() (in module wildboar.distance)": [[15, "wildboar.distance.matrix_profile"]], "paired_distance() (in module wildboar.distance)": [[15, "wildboar.distance.paired_distance"]], "paired_subsequence_distance() (in module wildboar.distance)": [[15, "wildboar.distance.paired_subsequence_distance"]], "paired_subsequence_match() (in module wildboar.distance)": [[15, "wildboar.distance.paired_subsequence_match"]], "pairwise_distance() (in module wildboar.distance)": [[15, "wildboar.distance.pairwise_distance"]], "pairwise_subsequence_distance() (in module wildboar.distance)": [[15, "wildboar.distance.pairwise_subsequence_distance"]], "predict() (wildboar.distance.kmeans method)": [[15, "wildboar.distance.KMeans.predict"]], "predict() (wildboar.distance.kmedoids method)": [[15, "wildboar.distance.KMedoids.predict"]], "predict() (wildboar.distance.kneighborsclassifier method)": [[15, "wildboar.distance.KNeighborsClassifier.predict"]], "predict_proba() (wildboar.distance.kneighborsclassifier method)": [[15, "wildboar.distance.KNeighborsClassifier.predict_proba"]], "score() (wildboar.distance.kneighborsclassifier method)": [[15, "wildboar.distance.KNeighborsClassifier.score"]], "set_output() (wildboar.distance.kmeans method)": [[15, "wildboar.distance.KMeans.set_output"]], "set_output() (wildboar.distance.kmedoids method)": [[15, "wildboar.distance.KMedoids.set_output"]], "set_params() (wildboar.distance.kmeans method)": [[15, "wildboar.distance.KMeans.set_params"]], "set_params() (wildboar.distance.kmedoids method)": [[15, "wildboar.distance.KMedoids.set_params"]], "set_params() (wildboar.distance.kneighborsclassifier method)": [[15, "wildboar.distance.KNeighborsClassifier.set_params"]], "subsequence_match() (in module wildboar.distance)": [[15, "wildboar.distance.subsequence_match"]], "transform() (wildboar.distance.kmeans method)": [[15, "wildboar.distance.KMeans.transform"]], "transform() (wildboar.distance.kmedoids method)": [[15, "wildboar.distance.KMedoids.transform"]], "wildboar.distance": [[15, "module-wildboar.distance"]], "baggingclassifier (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier"]], "baggingregressor (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.BaggingRegressor"]], "basebagging (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.BaseBagging"]], "baseforestclassifier (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier"]], "baseforestregressor (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.BaseForestRegressor"]], "baseshapeletforestclassifier (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier"]], "baseshapeletforestregressor (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestRegressor"]], "extrashapelettreesclassifier (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier"]], "extrashapelettreesregressor (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesRegressor"]], "forestmixin (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.ForestMixin"]], "intervalforestclassifier (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier"]], "intervalforestregressor (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.IntervalForestRegressor"]], "isolationshapeletforest (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.IsolationShapeletForest"]], "pivotforestclassifier (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier"]], "proximityforestclassifier (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier"]], "rocketforestclassifier (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier"]], "rocketforestregressor (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.RocketForestRegressor"]], "shapeletforestclassifier (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier"]], "shapeletforestembedding (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.ShapeletForestEmbedding"]], "shapeletforestregressor (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.ShapeletForestRegressor"]], "base_estimator_ (wildboar.ensemble._ensemble.baggingclassifier property)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.baggingregressor property)": [[16, "wildboar.ensemble._ensemble.BaggingRegressor.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.basebagging property)": [[16, "wildboar.ensemble._ensemble.BaseBagging.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.baseforestclassifier property)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.baseforestregressor property)": [[16, "wildboar.ensemble._ensemble.BaseForestRegressor.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.baseshapeletforestclassifier property)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.baseshapeletforestregressor property)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestRegressor.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.extrashapelettreesclassifier property)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.extrashapelettreesregressor property)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesRegressor.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.intervalforestclassifier property)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.intervalforestregressor property)": [[16, "wildboar.ensemble._ensemble.IntervalForestRegressor.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.isolationshapeletforest property)": [[16, "wildboar.ensemble._ensemble.IsolationShapeletForest.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.pivotforestclassifier property)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.proximityforestclassifier property)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.rocketforestclassifier property)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.rocketforestregressor property)": [[16, "wildboar.ensemble._ensemble.RocketForestRegressor.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.shapeletforestclassifier property)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.shapeletforestembedding property)": [[16, "wildboar.ensemble._ensemble.ShapeletForestEmbedding.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.shapeletforestregressor property)": [[16, "wildboar.ensemble._ensemble.ShapeletForestRegressor.base_estimator_"]], "decision_function() (wildboar.ensemble._ensemble.baggingclassifier method)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier.decision_function"]], "decision_function() (wildboar.ensemble._ensemble.baseforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier.decision_function"]], "decision_function() (wildboar.ensemble._ensemble.baseshapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier.decision_function"]], "decision_function() (wildboar.ensemble._ensemble.extrashapelettreesclassifier method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier.decision_function"]], "decision_function() (wildboar.ensemble._ensemble.intervalforestclassifier method)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier.decision_function"]], "decision_function() (wildboar.ensemble._ensemble.pivotforestclassifier method)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier.decision_function"]], "decision_function() (wildboar.ensemble._ensemble.proximityforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier.decision_function"]], "decision_function() (wildboar.ensemble._ensemble.rocketforestclassifier method)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier.decision_function"]], "decision_function() (wildboar.ensemble._ensemble.shapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier.decision_function"]], "estimators_samples_ (wildboar.ensemble._ensemble.baggingclassifier property)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.baggingregressor property)": [[16, "wildboar.ensemble._ensemble.BaggingRegressor.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.basebagging property)": [[16, "wildboar.ensemble._ensemble.BaseBagging.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.baseforestclassifier property)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.baseforestregressor property)": [[16, "wildboar.ensemble._ensemble.BaseForestRegressor.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.baseshapeletforestclassifier property)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.baseshapeletforestregressor property)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestRegressor.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.extrashapelettreesclassifier property)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.extrashapelettreesregressor property)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesRegressor.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.intervalforestclassifier property)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.intervalforestregressor property)": [[16, "wildboar.ensemble._ensemble.IntervalForestRegressor.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.isolationshapeletforest property)": [[16, "wildboar.ensemble._ensemble.IsolationShapeletForest.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.pivotforestclassifier property)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.proximityforestclassifier property)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.rocketforestclassifier property)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.rocketforestregressor property)": [[16, "wildboar.ensemble._ensemble.RocketForestRegressor.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.shapeletforestclassifier property)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.shapeletforestembedding property)": [[16, "wildboar.ensemble._ensemble.ShapeletForestEmbedding.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.shapeletforestregressor property)": [[16, "wildboar.ensemble._ensemble.ShapeletForestRegressor.estimators_samples_"]], "fit() (wildboar.ensemble._ensemble.baggingclassifier method)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier.fit"]], "fit() (wildboar.ensemble._ensemble.baggingregressor method)": [[16, "wildboar.ensemble._ensemble.BaggingRegressor.fit"]], "fit() (wildboar.ensemble._ensemble.basebagging method)": [[16, "wildboar.ensemble._ensemble.BaseBagging.fit"]], "fit() (wildboar.ensemble._ensemble.baseforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier.fit"]], "fit() (wildboar.ensemble._ensemble.baseforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseForestRegressor.fit"]], "fit() (wildboar.ensemble._ensemble.baseshapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier.fit"]], "fit() (wildboar.ensemble._ensemble.baseshapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestRegressor.fit"]], "fit() (wildboar.ensemble._ensemble.extrashapelettreesclassifier method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier.fit"]], "fit() (wildboar.ensemble._ensemble.extrashapelettreesregressor method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesRegressor.fit"]], "fit() (wildboar.ensemble._ensemble.intervalforestclassifier method)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier.fit"]], "fit() (wildboar.ensemble._ensemble.intervalforestregressor method)": [[16, "wildboar.ensemble._ensemble.IntervalForestRegressor.fit"]], "fit() (wildboar.ensemble._ensemble.isolationshapeletforest method)": [[16, "wildboar.ensemble._ensemble.IsolationShapeletForest.fit"]], "fit() (wildboar.ensemble._ensemble.pivotforestclassifier method)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier.fit"]], "fit() (wildboar.ensemble._ensemble.proximityforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier.fit"]], "fit() (wildboar.ensemble._ensemble.rocketforestclassifier method)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier.fit"]], "fit() (wildboar.ensemble._ensemble.rocketforestregressor method)": [[16, "wildboar.ensemble._ensemble.RocketForestRegressor.fit"]], "fit() (wildboar.ensemble._ensemble.shapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier.fit"]], "fit() (wildboar.ensemble._ensemble.shapeletforestembedding method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestEmbedding.fit"]], "fit() (wildboar.ensemble._ensemble.shapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestRegressor.fit"]], "fit_predict() (wildboar.ensemble._ensemble.isolationshapeletforest method)": [[16, "wildboar.ensemble._ensemble.IsolationShapeletForest.fit_predict"]], "get_metadata_routing() (wildboar.ensemble._ensemble.baggingclassifier method)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.baggingregressor method)": [[16, "wildboar.ensemble._ensemble.BaggingRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.basebagging method)": [[16, "wildboar.ensemble._ensemble.BaseBagging.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.baseforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.baseforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseForestRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.baseshapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.baseshapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.extrashapelettreesclassifier method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.extrashapelettreesregressor method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.intervalforestclassifier method)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.intervalforestregressor method)": [[16, "wildboar.ensemble._ensemble.IntervalForestRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.isolationshapeletforest method)": [[16, "wildboar.ensemble._ensemble.IsolationShapeletForest.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.pivotforestclassifier method)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.proximityforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.rocketforestclassifier method)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.rocketforestregressor method)": [[16, "wildboar.ensemble._ensemble.RocketForestRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.shapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.shapeletforestembedding method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestEmbedding.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.shapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestRegressor.get_metadata_routing"]], "get_params() (wildboar.ensemble._ensemble.baggingclassifier method)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier.get_params"]], "get_params() (wildboar.ensemble._ensemble.baggingregressor method)": [[16, "wildboar.ensemble._ensemble.BaggingRegressor.get_params"]], "get_params() (wildboar.ensemble._ensemble.basebagging method)": [[16, "wildboar.ensemble._ensemble.BaseBagging.get_params"]], "get_params() (wildboar.ensemble._ensemble.baseforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier.get_params"]], "get_params() (wildboar.ensemble._ensemble.baseforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseForestRegressor.get_params"]], "get_params() (wildboar.ensemble._ensemble.baseshapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier.get_params"]], "get_params() (wildboar.ensemble._ensemble.baseshapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestRegressor.get_params"]], "get_params() (wildboar.ensemble._ensemble.extrashapelettreesclassifier method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier.get_params"]], "get_params() (wildboar.ensemble._ensemble.extrashapelettreesregressor method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesRegressor.get_params"]], "get_params() (wildboar.ensemble._ensemble.intervalforestclassifier method)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier.get_params"]], "get_params() (wildboar.ensemble._ensemble.intervalforestregressor method)": [[16, "wildboar.ensemble._ensemble.IntervalForestRegressor.get_params"]], "get_params() (wildboar.ensemble._ensemble.isolationshapeletforest method)": [[16, "wildboar.ensemble._ensemble.IsolationShapeletForest.get_params"]], "get_params() (wildboar.ensemble._ensemble.pivotforestclassifier method)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier.get_params"]], "get_params() (wildboar.ensemble._ensemble.proximityforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier.get_params"]], "get_params() (wildboar.ensemble._ensemble.rocketforestclassifier method)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier.get_params"]], "get_params() (wildboar.ensemble._ensemble.rocketforestregressor method)": [[16, "wildboar.ensemble._ensemble.RocketForestRegressor.get_params"]], "get_params() (wildboar.ensemble._ensemble.shapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier.get_params"]], "get_params() (wildboar.ensemble._ensemble.shapeletforestembedding method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestEmbedding.get_params"]], "get_params() (wildboar.ensemble._ensemble.shapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestRegressor.get_params"]], "predict() (wildboar.ensemble._ensemble.baggingclassifier method)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier.predict"]], "predict() (wildboar.ensemble._ensemble.baggingregressor method)": [[16, "wildboar.ensemble._ensemble.BaggingRegressor.predict"]], "predict() (wildboar.ensemble._ensemble.baseforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier.predict"]], "predict() (wildboar.ensemble._ensemble.baseforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseForestRegressor.predict"]], "predict() (wildboar.ensemble._ensemble.baseshapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier.predict"]], "predict() (wildboar.ensemble._ensemble.baseshapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestRegressor.predict"]], "predict() (wildboar.ensemble._ensemble.extrashapelettreesclassifier method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier.predict"]], "predict() (wildboar.ensemble._ensemble.extrashapelettreesregressor method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesRegressor.predict"]], "predict() (wildboar.ensemble._ensemble.intervalforestclassifier method)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier.predict"]], "predict() (wildboar.ensemble._ensemble.intervalforestregressor method)": [[16, "wildboar.ensemble._ensemble.IntervalForestRegressor.predict"]], "predict() (wildboar.ensemble._ensemble.pivotforestclassifier method)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier.predict"]], "predict() (wildboar.ensemble._ensemble.proximityforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier.predict"]], "predict() (wildboar.ensemble._ensemble.rocketforestclassifier method)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier.predict"]], "predict() (wildboar.ensemble._ensemble.rocketforestregressor method)": [[16, "wildboar.ensemble._ensemble.RocketForestRegressor.predict"]], "predict() (wildboar.ensemble._ensemble.shapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier.predict"]], "predict() (wildboar.ensemble._ensemble.shapeletforestembedding method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestEmbedding.predict"]], "predict() (wildboar.ensemble._ensemble.shapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestRegressor.predict"]], "predict_log_proba() (wildboar.ensemble._ensemble.baggingclassifier method)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble._ensemble.baseforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble._ensemble.baseshapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble._ensemble.extrashapelettreesclassifier method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble._ensemble.intervalforestclassifier method)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble._ensemble.pivotforestclassifier method)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble._ensemble.proximityforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble._ensemble.rocketforestclassifier method)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble._ensemble.shapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier.predict_log_proba"]], "predict_proba() (wildboar.ensemble._ensemble.baggingclassifier method)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble._ensemble.baseforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble._ensemble.baseshapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble._ensemble.extrashapelettreesclassifier method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble._ensemble.intervalforestclassifier method)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble._ensemble.pivotforestclassifier method)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble._ensemble.proximityforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble._ensemble.rocketforestclassifier method)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble._ensemble.shapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier.predict_proba"]], "score() (wildboar.ensemble._ensemble.baggingclassifier method)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier.score"]], "score() (wildboar.ensemble._ensemble.baggingregressor method)": [[16, "wildboar.ensemble._ensemble.BaggingRegressor.score"]], "score() (wildboar.ensemble._ensemble.baseforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier.score"]], "score() (wildboar.ensemble._ensemble.baseforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseForestRegressor.score"]], "score() (wildboar.ensemble._ensemble.baseshapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier.score"]], "score() (wildboar.ensemble._ensemble.baseshapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestRegressor.score"]], "score() (wildboar.ensemble._ensemble.extrashapelettreesclassifier method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier.score"]], "score() (wildboar.ensemble._ensemble.extrashapelettreesregressor method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesRegressor.score"]], "score() (wildboar.ensemble._ensemble.intervalforestclassifier method)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier.score"]], "score() (wildboar.ensemble._ensemble.intervalforestregressor method)": [[16, "wildboar.ensemble._ensemble.IntervalForestRegressor.score"]], "score() (wildboar.ensemble._ensemble.pivotforestclassifier method)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier.score"]], "score() (wildboar.ensemble._ensemble.proximityforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier.score"]], "score() (wildboar.ensemble._ensemble.rocketforestclassifier method)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier.score"]], "score() (wildboar.ensemble._ensemble.rocketforestregressor method)": [[16, "wildboar.ensemble._ensemble.RocketForestRegressor.score"]], "score() (wildboar.ensemble._ensemble.shapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier.score"]], "score() (wildboar.ensemble._ensemble.shapeletforestembedding method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestEmbedding.score"]], "score() (wildboar.ensemble._ensemble.shapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestRegressor.score"]], "set_params() (wildboar.ensemble._ensemble.baggingclassifier method)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier.set_params"]], "set_params() (wildboar.ensemble._ensemble.baggingregressor method)": [[16, "wildboar.ensemble._ensemble.BaggingRegressor.set_params"]], "set_params() (wildboar.ensemble._ensemble.basebagging method)": [[16, "wildboar.ensemble._ensemble.BaseBagging.set_params"]], "set_params() (wildboar.ensemble._ensemble.baseforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier.set_params"]], "set_params() (wildboar.ensemble._ensemble.baseforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseForestRegressor.set_params"]], "set_params() (wildboar.ensemble._ensemble.baseshapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier.set_params"]], "set_params() (wildboar.ensemble._ensemble.baseshapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestRegressor.set_params"]], "set_params() (wildboar.ensemble._ensemble.extrashapelettreesclassifier method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier.set_params"]], "set_params() (wildboar.ensemble._ensemble.extrashapelettreesregressor method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesRegressor.set_params"]], "set_params() (wildboar.ensemble._ensemble.intervalforestclassifier method)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier.set_params"]], "set_params() (wildboar.ensemble._ensemble.intervalforestregressor method)": [[16, "wildboar.ensemble._ensemble.IntervalForestRegressor.set_params"]], "set_params() (wildboar.ensemble._ensemble.isolationshapeletforest method)": [[16, "wildboar.ensemble._ensemble.IsolationShapeletForest.set_params"]], "set_params() (wildboar.ensemble._ensemble.pivotforestclassifier method)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier.set_params"]], "set_params() (wildboar.ensemble._ensemble.proximityforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier.set_params"]], "set_params() (wildboar.ensemble._ensemble.rocketforestclassifier method)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier.set_params"]], "set_params() (wildboar.ensemble._ensemble.rocketforestregressor method)": [[16, "wildboar.ensemble._ensemble.RocketForestRegressor.set_params"]], "set_params() (wildboar.ensemble._ensemble.shapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier.set_params"]], "set_params() (wildboar.ensemble._ensemble.shapeletforestembedding method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestEmbedding.set_params"]], "set_params() (wildboar.ensemble._ensemble.shapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestRegressor.set_params"]], "wildboar.ensemble._ensemble": [[16, "module-wildboar.ensemble._ensemble"]], "baggingclassifier (class in wildboar.ensemble)": [[17, "wildboar.ensemble.BaggingClassifier"]], "baggingregressor (class in wildboar.ensemble)": [[17, "wildboar.ensemble.BaggingRegressor"]], "basebagging (class in wildboar.ensemble)": [[17, "wildboar.ensemble.BaseBagging"]], "extrashapelettreesclassifier (class in wildboar.ensemble)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier"]], "extrashapelettreesregressor (class in wildboar.ensemble)": [[17, "wildboar.ensemble.ExtraShapeletTreesRegressor"]], "intervalforestclassifier (class in wildboar.ensemble)": [[17, "wildboar.ensemble.IntervalForestClassifier"]], "intervalforestregressor (class in wildboar.ensemble)": [[17, "wildboar.ensemble.IntervalForestRegressor"]], "isolationshapeletforest (class in wildboar.ensemble)": [[17, "wildboar.ensemble.IsolationShapeletForest"]], "pivotforestclassifier (class in wildboar.ensemble)": [[17, "wildboar.ensemble.PivotForestClassifier"]], "proximityforestclassifier (class in wildboar.ensemble)": [[17, "wildboar.ensemble.ProximityForestClassifier"]], "rocketforestclassifier (class in wildboar.ensemble)": [[17, "wildboar.ensemble.RocketForestClassifier"]], "rocketforestregressor (class in wildboar.ensemble)": [[17, "wildboar.ensemble.RocketForestRegressor"]], "shapeletforestclassifier (class in wildboar.ensemble)": [[17, "wildboar.ensemble.ShapeletForestClassifier"]], "shapeletforestembedding (class in wildboar.ensemble)": [[17, "wildboar.ensemble.ShapeletForestEmbedding"]], "shapeletforestregressor (class in wildboar.ensemble)": [[17, "wildboar.ensemble.ShapeletForestRegressor"]], "base_estimator_ (wildboar.ensemble.baggingclassifier property)": [[17, "wildboar.ensemble.BaggingClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble.baggingregressor property)": [[17, "wildboar.ensemble.BaggingRegressor.base_estimator_"]], "base_estimator_ (wildboar.ensemble.basebagging property)": [[17, "wildboar.ensemble.BaseBagging.base_estimator_"]], "base_estimator_ (wildboar.ensemble.extrashapelettreesclassifier property)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble.extrashapelettreesregressor property)": [[17, "wildboar.ensemble.ExtraShapeletTreesRegressor.base_estimator_"]], "base_estimator_ (wildboar.ensemble.intervalforestclassifier property)": [[17, "wildboar.ensemble.IntervalForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble.intervalforestregressor property)": [[17, "wildboar.ensemble.IntervalForestRegressor.base_estimator_"]], "base_estimator_ (wildboar.ensemble.isolationshapeletforest property)": [[17, "wildboar.ensemble.IsolationShapeletForest.base_estimator_"]], "base_estimator_ (wildboar.ensemble.pivotforestclassifier property)": [[17, "wildboar.ensemble.PivotForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble.proximityforestclassifier property)": [[17, "wildboar.ensemble.ProximityForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble.rocketforestclassifier property)": [[17, "wildboar.ensemble.RocketForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble.rocketforestregressor property)": [[17, "wildboar.ensemble.RocketForestRegressor.base_estimator_"]], "base_estimator_ (wildboar.ensemble.shapeletforestclassifier property)": [[17, "wildboar.ensemble.ShapeletForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble.shapeletforestembedding property)": [[17, "wildboar.ensemble.ShapeletForestEmbedding.base_estimator_"]], "base_estimator_ (wildboar.ensemble.shapeletforestregressor property)": [[17, "wildboar.ensemble.ShapeletForestRegressor.base_estimator_"]], "decision_function() (wildboar.ensemble.baggingclassifier method)": [[17, "wildboar.ensemble.BaggingClassifier.decision_function"]], "decision_function() (wildboar.ensemble.extrashapelettreesclassifier method)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier.decision_function"]], "decision_function() (wildboar.ensemble.intervalforestclassifier method)": [[17, "wildboar.ensemble.IntervalForestClassifier.decision_function"]], "decision_function() (wildboar.ensemble.pivotforestclassifier method)": [[17, "wildboar.ensemble.PivotForestClassifier.decision_function"]], "decision_function() (wildboar.ensemble.proximityforestclassifier method)": [[17, "wildboar.ensemble.ProximityForestClassifier.decision_function"]], "decision_function() (wildboar.ensemble.rocketforestclassifier method)": [[17, "wildboar.ensemble.RocketForestClassifier.decision_function"]], "decision_function() (wildboar.ensemble.shapeletforestclassifier method)": [[17, "wildboar.ensemble.ShapeletForestClassifier.decision_function"]], "estimators_samples_ (wildboar.ensemble.baggingclassifier property)": [[17, "wildboar.ensemble.BaggingClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.baggingregressor property)": [[17, "wildboar.ensemble.BaggingRegressor.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.basebagging property)": [[17, "wildboar.ensemble.BaseBagging.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.extrashapelettreesclassifier property)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.extrashapelettreesregressor property)": [[17, "wildboar.ensemble.ExtraShapeletTreesRegressor.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.intervalforestclassifier property)": [[17, "wildboar.ensemble.IntervalForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.intervalforestregressor property)": [[17, "wildboar.ensemble.IntervalForestRegressor.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.isolationshapeletforest property)": [[17, "wildboar.ensemble.IsolationShapeletForest.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.pivotforestclassifier property)": [[17, "wildboar.ensemble.PivotForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.proximityforestclassifier property)": [[17, "wildboar.ensemble.ProximityForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.rocketforestclassifier property)": [[17, "wildboar.ensemble.RocketForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.rocketforestregressor property)": [[17, "wildboar.ensemble.RocketForestRegressor.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.shapeletforestclassifier property)": [[17, "wildboar.ensemble.ShapeletForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.shapeletforestembedding property)": [[17, "wildboar.ensemble.ShapeletForestEmbedding.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.shapeletforestregressor property)": [[17, "wildboar.ensemble.ShapeletForestRegressor.estimators_samples_"]], "fit() (wildboar.ensemble.baggingclassifier method)": [[17, "wildboar.ensemble.BaggingClassifier.fit"]], "fit() (wildboar.ensemble.baggingregressor method)": [[17, "wildboar.ensemble.BaggingRegressor.fit"]], "fit() (wildboar.ensemble.basebagging method)": [[17, "wildboar.ensemble.BaseBagging.fit"]], "fit() (wildboar.ensemble.extrashapelettreesclassifier method)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier.fit"]], "fit() (wildboar.ensemble.extrashapelettreesregressor method)": [[17, "wildboar.ensemble.ExtraShapeletTreesRegressor.fit"]], "fit() (wildboar.ensemble.intervalforestclassifier method)": [[17, "wildboar.ensemble.IntervalForestClassifier.fit"]], "fit() (wildboar.ensemble.intervalforestregressor method)": [[17, "wildboar.ensemble.IntervalForestRegressor.fit"]], "fit() (wildboar.ensemble.isolationshapeletforest method)": [[17, "wildboar.ensemble.IsolationShapeletForest.fit"]], "fit() (wildboar.ensemble.pivotforestclassifier method)": [[17, "wildboar.ensemble.PivotForestClassifier.fit"]], "fit() (wildboar.ensemble.proximityforestclassifier method)": [[17, "wildboar.ensemble.ProximityForestClassifier.fit"]], "fit() (wildboar.ensemble.rocketforestclassifier method)": [[17, "wildboar.ensemble.RocketForestClassifier.fit"]], "fit() (wildboar.ensemble.rocketforestregressor method)": [[17, "wildboar.ensemble.RocketForestRegressor.fit"]], "fit() (wildboar.ensemble.shapeletforestclassifier method)": [[17, "wildboar.ensemble.ShapeletForestClassifier.fit"]], "fit() (wildboar.ensemble.shapeletforestembedding method)": [[17, "wildboar.ensemble.ShapeletForestEmbedding.fit"]], "fit() (wildboar.ensemble.shapeletforestregressor method)": [[17, "wildboar.ensemble.ShapeletForestRegressor.fit"]], "fit_predict() (wildboar.ensemble.isolationshapeletforest method)": [[17, "wildboar.ensemble.IsolationShapeletForest.fit_predict"]], "get_metadata_routing() (wildboar.ensemble.baggingclassifier method)": [[17, "wildboar.ensemble.BaggingClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.baggingregressor method)": [[17, "wildboar.ensemble.BaggingRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.basebagging method)": [[17, "wildboar.ensemble.BaseBagging.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.extrashapelettreesclassifier method)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.extrashapelettreesregressor method)": [[17, "wildboar.ensemble.ExtraShapeletTreesRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.intervalforestclassifier method)": [[17, "wildboar.ensemble.IntervalForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.intervalforestregressor method)": [[17, "wildboar.ensemble.IntervalForestRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.isolationshapeletforest method)": [[17, "wildboar.ensemble.IsolationShapeletForest.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.pivotforestclassifier method)": [[17, "wildboar.ensemble.PivotForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.proximityforestclassifier method)": [[17, "wildboar.ensemble.ProximityForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.rocketforestclassifier method)": [[17, "wildboar.ensemble.RocketForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.rocketforestregressor method)": [[17, "wildboar.ensemble.RocketForestRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.shapeletforestclassifier method)": [[17, "wildboar.ensemble.ShapeletForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.shapeletforestembedding method)": [[17, "wildboar.ensemble.ShapeletForestEmbedding.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.shapeletforestregressor method)": [[17, "wildboar.ensemble.ShapeletForestRegressor.get_metadata_routing"]], "get_params() (wildboar.ensemble.baggingclassifier method)": [[17, "wildboar.ensemble.BaggingClassifier.get_params"]], "get_params() (wildboar.ensemble.baggingregressor method)": [[17, "wildboar.ensemble.BaggingRegressor.get_params"]], "get_params() (wildboar.ensemble.basebagging method)": [[17, "wildboar.ensemble.BaseBagging.get_params"]], "get_params() (wildboar.ensemble.extrashapelettreesclassifier method)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier.get_params"]], "get_params() (wildboar.ensemble.extrashapelettreesregressor method)": [[17, "wildboar.ensemble.ExtraShapeletTreesRegressor.get_params"]], "get_params() (wildboar.ensemble.intervalforestclassifier method)": [[17, "wildboar.ensemble.IntervalForestClassifier.get_params"]], "get_params() (wildboar.ensemble.intervalforestregressor method)": [[17, "wildboar.ensemble.IntervalForestRegressor.get_params"]], "get_params() (wildboar.ensemble.isolationshapeletforest method)": [[17, "wildboar.ensemble.IsolationShapeletForest.get_params"]], "get_params() (wildboar.ensemble.pivotforestclassifier method)": [[17, "wildboar.ensemble.PivotForestClassifier.get_params"]], "get_params() (wildboar.ensemble.proximityforestclassifier method)": [[17, "wildboar.ensemble.ProximityForestClassifier.get_params"]], "get_params() (wildboar.ensemble.rocketforestclassifier method)": [[17, "wildboar.ensemble.RocketForestClassifier.get_params"]], "get_params() (wildboar.ensemble.rocketforestregressor method)": [[17, "wildboar.ensemble.RocketForestRegressor.get_params"]], "get_params() (wildboar.ensemble.shapeletforestclassifier method)": [[17, "wildboar.ensemble.ShapeletForestClassifier.get_params"]], "get_params() (wildboar.ensemble.shapeletforestembedding method)": [[17, "wildboar.ensemble.ShapeletForestEmbedding.get_params"]], "get_params() (wildboar.ensemble.shapeletforestregressor method)": [[17, "wildboar.ensemble.ShapeletForestRegressor.get_params"]], "predict() (wildboar.ensemble.baggingclassifier method)": [[17, "wildboar.ensemble.BaggingClassifier.predict"]], "predict() (wildboar.ensemble.baggingregressor method)": [[17, "wildboar.ensemble.BaggingRegressor.predict"]], "predict() (wildboar.ensemble.extrashapelettreesclassifier method)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier.predict"]], "predict() (wildboar.ensemble.extrashapelettreesregressor method)": [[17, "wildboar.ensemble.ExtraShapeletTreesRegressor.predict"]], "predict() (wildboar.ensemble.intervalforestclassifier method)": [[17, "wildboar.ensemble.IntervalForestClassifier.predict"]], "predict() (wildboar.ensemble.intervalforestregressor method)": [[17, "wildboar.ensemble.IntervalForestRegressor.predict"]], "predict() (wildboar.ensemble.pivotforestclassifier method)": [[17, "wildboar.ensemble.PivotForestClassifier.predict"]], "predict() (wildboar.ensemble.proximityforestclassifier method)": [[17, "wildboar.ensemble.ProximityForestClassifier.predict"]], "predict() (wildboar.ensemble.rocketforestclassifier method)": [[17, "wildboar.ensemble.RocketForestClassifier.predict"]], "predict() (wildboar.ensemble.rocketforestregressor method)": [[17, "wildboar.ensemble.RocketForestRegressor.predict"]], "predict() (wildboar.ensemble.shapeletforestclassifier method)": [[17, "wildboar.ensemble.ShapeletForestClassifier.predict"]], "predict() (wildboar.ensemble.shapeletforestembedding method)": [[17, "wildboar.ensemble.ShapeletForestEmbedding.predict"]], "predict() (wildboar.ensemble.shapeletforestregressor method)": [[17, "wildboar.ensemble.ShapeletForestRegressor.predict"]], "predict_log_proba() (wildboar.ensemble.baggingclassifier method)": [[17, "wildboar.ensemble.BaggingClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble.extrashapelettreesclassifier method)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble.intervalforestclassifier method)": [[17, "wildboar.ensemble.IntervalForestClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble.pivotforestclassifier method)": [[17, "wildboar.ensemble.PivotForestClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble.proximityforestclassifier method)": [[17, "wildboar.ensemble.ProximityForestClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble.rocketforestclassifier method)": [[17, "wildboar.ensemble.RocketForestClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble.shapeletforestclassifier method)": [[17, "wildboar.ensemble.ShapeletForestClassifier.predict_log_proba"]], "predict_proba() (wildboar.ensemble.baggingclassifier method)": [[17, "wildboar.ensemble.BaggingClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble.extrashapelettreesclassifier method)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble.intervalforestclassifier method)": [[17, "wildboar.ensemble.IntervalForestClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble.pivotforestclassifier method)": [[17, "wildboar.ensemble.PivotForestClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble.proximityforestclassifier method)": [[17, "wildboar.ensemble.ProximityForestClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble.rocketforestclassifier method)": [[17, "wildboar.ensemble.RocketForestClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble.shapeletforestclassifier method)": [[17, "wildboar.ensemble.ShapeletForestClassifier.predict_proba"]], "score() (wildboar.ensemble.baggingclassifier method)": [[17, "wildboar.ensemble.BaggingClassifier.score"]], "score() (wildboar.ensemble.baggingregressor method)": [[17, "wildboar.ensemble.BaggingRegressor.score"]], "score() (wildboar.ensemble.extrashapelettreesclassifier method)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier.score"]], "score() (wildboar.ensemble.extrashapelettreesregressor method)": [[17, "wildboar.ensemble.ExtraShapeletTreesRegressor.score"]], "score() (wildboar.ensemble.intervalforestclassifier method)": [[17, "wildboar.ensemble.IntervalForestClassifier.score"]], "score() (wildboar.ensemble.intervalforestregressor method)": [[17, "wildboar.ensemble.IntervalForestRegressor.score"]], "score() (wildboar.ensemble.pivotforestclassifier method)": [[17, "wildboar.ensemble.PivotForestClassifier.score"]], "score() (wildboar.ensemble.proximityforestclassifier method)": [[17, "wildboar.ensemble.ProximityForestClassifier.score"]], "score() (wildboar.ensemble.rocketforestclassifier method)": [[17, "wildboar.ensemble.RocketForestClassifier.score"]], "score() (wildboar.ensemble.rocketforestregressor method)": [[17, "wildboar.ensemble.RocketForestRegressor.score"]], "score() (wildboar.ensemble.shapeletforestclassifier method)": [[17, "wildboar.ensemble.ShapeletForestClassifier.score"]], "score() (wildboar.ensemble.shapeletforestembedding method)": [[17, "wildboar.ensemble.ShapeletForestEmbedding.score"]], "score() (wildboar.ensemble.shapeletforestregressor method)": [[17, "wildboar.ensemble.ShapeletForestRegressor.score"]], "set_params() (wildboar.ensemble.baggingclassifier method)": [[17, "wildboar.ensemble.BaggingClassifier.set_params"]], "set_params() (wildboar.ensemble.baggingregressor method)": [[17, "wildboar.ensemble.BaggingRegressor.set_params"]], "set_params() (wildboar.ensemble.basebagging method)": [[17, "wildboar.ensemble.BaseBagging.set_params"]], "set_params() (wildboar.ensemble.extrashapelettreesclassifier method)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier.set_params"]], "set_params() (wildboar.ensemble.extrashapelettreesregressor method)": [[17, "wildboar.ensemble.ExtraShapeletTreesRegressor.set_params"]], "set_params() (wildboar.ensemble.intervalforestclassifier method)": [[17, "wildboar.ensemble.IntervalForestClassifier.set_params"]], "set_params() (wildboar.ensemble.intervalforestregressor method)": [[17, "wildboar.ensemble.IntervalForestRegressor.set_params"]], "set_params() (wildboar.ensemble.isolationshapeletforest method)": [[17, "wildboar.ensemble.IsolationShapeletForest.set_params"]], "set_params() (wildboar.ensemble.pivotforestclassifier method)": [[17, "wildboar.ensemble.PivotForestClassifier.set_params"]], "set_params() (wildboar.ensemble.proximityforestclassifier method)": [[17, "wildboar.ensemble.ProximityForestClassifier.set_params"]], "set_params() (wildboar.ensemble.rocketforestclassifier method)": [[17, "wildboar.ensemble.RocketForestClassifier.set_params"]], "set_params() (wildboar.ensemble.rocketforestregressor method)": [[17, "wildboar.ensemble.RocketForestRegressor.set_params"]], "set_params() (wildboar.ensemble.shapeletforestclassifier method)": [[17, "wildboar.ensemble.ShapeletForestClassifier.set_params"]], "set_params() (wildboar.ensemble.shapeletforestembedding method)": [[17, "wildboar.ensemble.ShapeletForestEmbedding.set_params"]], "set_params() (wildboar.ensemble.shapeletforestregressor method)": [[17, "wildboar.ensemble.ShapeletForestRegressor.set_params"]], "wildboar.ensemble": [[17, "module-wildboar.ensemble"]], "amplitudeimportance (class in wildboar.explain._importance)": [[18, "wildboar.explain._importance.AmplitudeImportance"]], "intervalimportance (class in wildboar.explain._importance)": [[18, "wildboar.explain._importance.IntervalImportance"]], "permuteimportance (class in wildboar.explain._importance)": [[18, "wildboar.explain._importance.PermuteImportance"]], "shapeletimportance (class in wildboar.explain._importance)": [[18, "wildboar.explain._importance.ShapeletImportance"]], "fit_explain() (wildboar.explain._importance.amplitudeimportance method)": [[18, "wildboar.explain._importance.AmplitudeImportance.fit_explain"]], "fit_explain() (wildboar.explain._importance.intervalimportance method)": [[18, "wildboar.explain._importance.IntervalImportance.fit_explain"]], "fit_explain() (wildboar.explain._importance.shapeletimportance method)": [[18, "wildboar.explain._importance.ShapeletImportance.fit_explain"]], "get_metadata_routing() (wildboar.explain._importance.amplitudeimportance method)": [[18, "wildboar.explain._importance.AmplitudeImportance.get_metadata_routing"]], "get_metadata_routing() (wildboar.explain._importance.intervalimportance method)": [[18, "wildboar.explain._importance.IntervalImportance.get_metadata_routing"]], "get_metadata_routing() (wildboar.explain._importance.permuteimportance method)": [[18, "wildboar.explain._importance.PermuteImportance.get_metadata_routing"]], "get_metadata_routing() (wildboar.explain._importance.shapeletimportance method)": [[18, "wildboar.explain._importance.ShapeletImportance.get_metadata_routing"]], "get_params() (wildboar.explain._importance.amplitudeimportance method)": [[18, "wildboar.explain._importance.AmplitudeImportance.get_params"]], "get_params() (wildboar.explain._importance.intervalimportance method)": [[18, "wildboar.explain._importance.IntervalImportance.get_params"]], "get_params() (wildboar.explain._importance.permuteimportance method)": [[18, "wildboar.explain._importance.PermuteImportance.get_params"]], "get_params() (wildboar.explain._importance.shapeletimportance method)": [[18, "wildboar.explain._importance.ShapeletImportance.get_params"]], "plot() (wildboar.explain._importance.amplitudeimportance method)": [[18, "wildboar.explain._importance.AmplitudeImportance.plot"]], "plot() (wildboar.explain._importance.intervalimportance method)": [[18, "wildboar.explain._importance.IntervalImportance.plot"]], "plot() (wildboar.explain._importance.shapeletimportance method)": [[18, "wildboar.explain._importance.ShapeletImportance.plot"]], "plot_importances() (in module wildboar.explain._importance)": [[18, "wildboar.explain._importance.plot_importances"]], "set_params() (wildboar.explain._importance.amplitudeimportance method)": [[18, "wildboar.explain._importance.AmplitudeImportance.set_params"]], "set_params() (wildboar.explain._importance.intervalimportance method)": [[18, "wildboar.explain._importance.IntervalImportance.set_params"]], "set_params() (wildboar.explain._importance.permuteimportance method)": [[18, "wildboar.explain._importance.PermuteImportance.set_params"]], "set_params() (wildboar.explain._importance.shapeletimportance method)": [[18, "wildboar.explain._importance.ShapeletImportance.set_params"]], "wildboar.explain._importance": [[18, "module-wildboar.explain._importance"]], "counterfactuals() (in module wildboar.explain.counterfactual._helper)": [[19, "wildboar.explain.counterfactual._helper.counterfactuals"]], "wildboar.explain.counterfactual._helper": [[19, "module-wildboar.explain.counterfactual._helper"]], "kneighborscounterfactual (class in wildboar.explain.counterfactual._nn)": [[20, "wildboar.explain.counterfactual._nn.KNeighborsCounterfactual"]], "fit_explain() (wildboar.explain.counterfactual._nn.kneighborscounterfactual method)": [[20, "wildboar.explain.counterfactual._nn.KNeighborsCounterfactual.fit_explain"]], "get_metadata_routing() (wildboar.explain.counterfactual._nn.kneighborscounterfactual method)": [[20, "wildboar.explain.counterfactual._nn.KNeighborsCounterfactual.get_metadata_routing"]], "get_params() (wildboar.explain.counterfactual._nn.kneighborscounterfactual method)": [[20, "wildboar.explain.counterfactual._nn.KNeighborsCounterfactual.get_params"]], "plot() (wildboar.explain.counterfactual._nn.kneighborscounterfactual method)": [[20, "wildboar.explain.counterfactual._nn.KNeighborsCounterfactual.plot"]], "score() (wildboar.explain.counterfactual._nn.kneighborscounterfactual method)": [[20, "wildboar.explain.counterfactual._nn.KNeighborsCounterfactual.score"]], "set_params() (wildboar.explain.counterfactual._nn.kneighborscounterfactual method)": [[20, "wildboar.explain.counterfactual._nn.KNeighborsCounterfactual.set_params"]], "wildboar.explain.counterfactual._nn": [[20, "module-wildboar.explain.counterfactual._nn"]], "dynamictimewarptransform (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.DynamicTimeWarpTransform"]], "euclideantransform (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.EuclideanTransform"]], "knearestprototypesampler (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.KNearestPrototypeSampler"]], "knearestshapeletprototypesampler (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.KNearestShapeletPrototypeSampler"]], "metrictransform (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.MetricTransform"]], "predictevaluator (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.PredictEvaluator"]], "probabilityevaluator (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.ProbabilityEvaluator"]], "prototypecounterfactual (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.PrototypeCounterfactual"]], "prototypesampler (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.PrototypeSampler"]], "shapeletprototypesampler (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.ShapeletPrototypeSampler"]], "targetevaluator (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.TargetEvaluator"]], "uniformprototypesampler (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.UniformPrototypeSampler"]], "weighteddynamictimewarptransform (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.WeightedDynamicTimeWarpTransform"]], "fit_explain() (wildboar.explain.counterfactual._proto.prototypecounterfactual method)": [[21, "wildboar.explain.counterfactual._proto.PrototypeCounterfactual.fit_explain"]], "get_metadata_routing() (wildboar.explain.counterfactual._proto.prototypecounterfactual method)": [[21, "wildboar.explain.counterfactual._proto.PrototypeCounterfactual.get_metadata_routing"]], "get_params() (wildboar.explain.counterfactual._proto.prototypecounterfactual method)": [[21, "wildboar.explain.counterfactual._proto.PrototypeCounterfactual.get_params"]], "is_counterfactual() (wildboar.explain.counterfactual._proto.predictevaluator method)": [[21, "wildboar.explain.counterfactual._proto.PredictEvaluator.is_counterfactual"]], "is_counterfactual() (wildboar.explain.counterfactual._proto.probabilityevaluator method)": [[21, "wildboar.explain.counterfactual._proto.ProbabilityEvaluator.is_counterfactual"]], "is_counterfactual() (wildboar.explain.counterfactual._proto.targetevaluator method)": [[21, "wildboar.explain.counterfactual._proto.TargetEvaluator.is_counterfactual"]], "move() (wildboar.explain.counterfactual._proto.dynamictimewarptransform method)": [[21, "wildboar.explain.counterfactual._proto.DynamicTimeWarpTransform.move"]], "move() (wildboar.explain.counterfactual._proto.euclideantransform method)": [[21, "wildboar.explain.counterfactual._proto.EuclideanTransform.move"]], "move() (wildboar.explain.counterfactual._proto.knearestprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.KNearestPrototypeSampler.move"]], "move() (wildboar.explain.counterfactual._proto.knearestshapeletprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.KNearestShapeletPrototypeSampler.move"]], "move() (wildboar.explain.counterfactual._proto.metrictransform method)": [[21, "wildboar.explain.counterfactual._proto.MetricTransform.move"]], "move() (wildboar.explain.counterfactual._proto.prototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.PrototypeSampler.move"]], "move() (wildboar.explain.counterfactual._proto.shapeletprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.ShapeletPrototypeSampler.move"]], "move() (wildboar.explain.counterfactual._proto.uniformprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.UniformPrototypeSampler.move"]], "move() (wildboar.explain.counterfactual._proto.weighteddynamictimewarptransform method)": [[21, "wildboar.explain.counterfactual._proto.WeightedDynamicTimeWarpTransform.move"]], "nearest_index() (wildboar.explain.counterfactual._proto.knearestprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.KNearestPrototypeSampler.nearest_index"]], "plot() (wildboar.explain.counterfactual._proto.prototypecounterfactual method)": [[21, "wildboar.explain.counterfactual._proto.PrototypeCounterfactual.plot"]], "sample() (wildboar.explain.counterfactual._proto.knearestprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.KNearestPrototypeSampler.sample"]], "sample() (wildboar.explain.counterfactual._proto.knearestshapeletprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.KNearestShapeletPrototypeSampler.sample"]], "sample() (wildboar.explain.counterfactual._proto.prototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.PrototypeSampler.sample"]], "sample() (wildboar.explain.counterfactual._proto.shapeletprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.ShapeletPrototypeSampler.sample"]], "sample() (wildboar.explain.counterfactual._proto.uniformprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.UniformPrototypeSampler.sample"]], "sample_move() (wildboar.explain.counterfactual._proto.knearestprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.KNearestPrototypeSampler.sample_move"]], "sample_move() (wildboar.explain.counterfactual._proto.knearestshapeletprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.KNearestShapeletPrototypeSampler.sample_move"]], "sample_move() (wildboar.explain.counterfactual._proto.prototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.PrototypeSampler.sample_move"]], "sample_move() (wildboar.explain.counterfactual._proto.shapeletprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.ShapeletPrototypeSampler.sample_move"]], "sample_move() (wildboar.explain.counterfactual._proto.uniformprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.UniformPrototypeSampler.sample_move"]], "sample_shapelet() (wildboar.explain.counterfactual._proto.shapeletprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.ShapeletPrototypeSampler.sample_shapelet"]], "score() (wildboar.explain.counterfactual._proto.prototypecounterfactual method)": [[21, "wildboar.explain.counterfactual._proto.PrototypeCounterfactual.score"]], "set_params() (wildboar.explain.counterfactual._proto.prototypecounterfactual method)": [[21, "wildboar.explain.counterfactual._proto.PrototypeCounterfactual.set_params"]], "wildboar.explain.counterfactual._proto": [[21, "module-wildboar.explain.counterfactual._proto"]], "shapeletforestcounterfactual (class in wildboar.explain.counterfactual._sf)": [[22, "wildboar.explain.counterfactual._sf.ShapeletForestCounterfactual"]], "fit_explain() (wildboar.explain.counterfactual._sf.shapeletforestcounterfactual method)": [[22, "wildboar.explain.counterfactual._sf.ShapeletForestCounterfactual.fit_explain"]], "get_metadata_routing() (wildboar.explain.counterfactual._sf.shapeletforestcounterfactual method)": [[22, "wildboar.explain.counterfactual._sf.ShapeletForestCounterfactual.get_metadata_routing"]], "get_params() (wildboar.explain.counterfactual._sf.shapeletforestcounterfactual method)": [[22, "wildboar.explain.counterfactual._sf.ShapeletForestCounterfactual.get_params"]], "plot() (wildboar.explain.counterfactual._sf.shapeletforestcounterfactual method)": [[22, "wildboar.explain.counterfactual._sf.ShapeletForestCounterfactual.plot"]], "score() (wildboar.explain.counterfactual._sf.shapeletforestcounterfactual method)": [[22, "wildboar.explain.counterfactual._sf.ShapeletForestCounterfactual.score"]], "set_params() (wildboar.explain.counterfactual._sf.shapeletforestcounterfactual method)": [[22, "wildboar.explain.counterfactual._sf.ShapeletForestCounterfactual.set_params"]], "wildboar.explain.counterfactual._sf": [[22, "module-wildboar.explain.counterfactual._sf"]], "kneighborscounterfactual (class in wildboar.explain.counterfactual)": [[23, "wildboar.explain.counterfactual.KNeighborsCounterfactual"]], "prototypecounterfactual (class in wildboar.explain.counterfactual)": [[23, "wildboar.explain.counterfactual.PrototypeCounterfactual"]], "shapeletforestcounterfactual (class in wildboar.explain.counterfactual)": [[23, "wildboar.explain.counterfactual.ShapeletForestCounterfactual"]], "counterfactuals() (in module wildboar.explain.counterfactual)": [[23, "wildboar.explain.counterfactual.counterfactuals"]], "fit_explain() (wildboar.explain.counterfactual.kneighborscounterfactual method)": [[23, "wildboar.explain.counterfactual.KNeighborsCounterfactual.fit_explain"]], "fit_explain() (wildboar.explain.counterfactual.prototypecounterfactual method)": [[23, "wildboar.explain.counterfactual.PrototypeCounterfactual.fit_explain"]], "fit_explain() (wildboar.explain.counterfactual.shapeletforestcounterfactual method)": [[23, "wildboar.explain.counterfactual.ShapeletForestCounterfactual.fit_explain"]], "get_metadata_routing() (wildboar.explain.counterfactual.kneighborscounterfactual method)": [[23, "wildboar.explain.counterfactual.KNeighborsCounterfactual.get_metadata_routing"]], "get_metadata_routing() (wildboar.explain.counterfactual.prototypecounterfactual method)": [[23, "wildboar.explain.counterfactual.PrototypeCounterfactual.get_metadata_routing"]], "get_metadata_routing() (wildboar.explain.counterfactual.shapeletforestcounterfactual method)": [[23, "wildboar.explain.counterfactual.ShapeletForestCounterfactual.get_metadata_routing"]], "get_params() (wildboar.explain.counterfactual.kneighborscounterfactual method)": [[23, "wildboar.explain.counterfactual.KNeighborsCounterfactual.get_params"]], "get_params() (wildboar.explain.counterfactual.prototypecounterfactual method)": [[23, "wildboar.explain.counterfactual.PrototypeCounterfactual.get_params"]], "get_params() (wildboar.explain.counterfactual.shapeletforestcounterfactual method)": [[23, "wildboar.explain.counterfactual.ShapeletForestCounterfactual.get_params"]], "plot() (wildboar.explain.counterfactual.kneighborscounterfactual method)": [[23, "wildboar.explain.counterfactual.KNeighborsCounterfactual.plot"]], "plot() (wildboar.explain.counterfactual.prototypecounterfactual method)": [[23, "wildboar.explain.counterfactual.PrototypeCounterfactual.plot"]], "plot() (wildboar.explain.counterfactual.shapeletforestcounterfactual method)": [[23, "wildboar.explain.counterfactual.ShapeletForestCounterfactual.plot"]], "proximity() (in module wildboar.explain.counterfactual)": [[23, "wildboar.explain.counterfactual.proximity"]], "score() (wildboar.explain.counterfactual.kneighborscounterfactual method)": [[23, "wildboar.explain.counterfactual.KNeighborsCounterfactual.score"]], "score() (wildboar.explain.counterfactual.prototypecounterfactual method)": [[23, "wildboar.explain.counterfactual.PrototypeCounterfactual.score"]], "score() (wildboar.explain.counterfactual.shapeletforestcounterfactual method)": [[23, "wildboar.explain.counterfactual.ShapeletForestCounterfactual.score"]], "set_params() (wildboar.explain.counterfactual.kneighborscounterfactual method)": [[23, "wildboar.explain.counterfactual.KNeighborsCounterfactual.set_params"]], "set_params() (wildboar.explain.counterfactual.prototypecounterfactual method)": [[23, "wildboar.explain.counterfactual.PrototypeCounterfactual.set_params"]], "set_params() (wildboar.explain.counterfactual.shapeletforestcounterfactual method)": [[23, "wildboar.explain.counterfactual.ShapeletForestCounterfactual.set_params"]], "wildboar.explain.counterfactual": [[23, "module-wildboar.explain.counterfactual"]], "amplitudeimportance (class in wildboar.explain)": [[24, "wildboar.explain.AmplitudeImportance"]], "intervalimportance (class in wildboar.explain)": [[24, "wildboar.explain.IntervalImportance"]], "shapeletimportance (class in wildboar.explain)": [[24, "wildboar.explain.ShapeletImportance"]], "fit_explain() (wildboar.explain.amplitudeimportance method)": [[24, "wildboar.explain.AmplitudeImportance.fit_explain"]], "fit_explain() (wildboar.explain.intervalimportance method)": [[24, "wildboar.explain.IntervalImportance.fit_explain"]], "fit_explain() (wildboar.explain.shapeletimportance method)": [[24, "wildboar.explain.ShapeletImportance.fit_explain"]], "get_metadata_routing() (wildboar.explain.amplitudeimportance method)": [[24, "wildboar.explain.AmplitudeImportance.get_metadata_routing"]], "get_metadata_routing() (wildboar.explain.intervalimportance method)": [[24, "wildboar.explain.IntervalImportance.get_metadata_routing"]], "get_metadata_routing() (wildboar.explain.shapeletimportance method)": [[24, "wildboar.explain.ShapeletImportance.get_metadata_routing"]], "get_params() (wildboar.explain.amplitudeimportance method)": [[24, "wildboar.explain.AmplitudeImportance.get_params"]], "get_params() (wildboar.explain.intervalimportance method)": [[24, "wildboar.explain.IntervalImportance.get_params"]], "get_params() (wildboar.explain.shapeletimportance method)": [[24, "wildboar.explain.ShapeletImportance.get_params"]], "plot() (wildboar.explain.amplitudeimportance method)": [[24, "wildboar.explain.AmplitudeImportance.plot"]], "plot() (wildboar.explain.intervalimportance method)": [[24, "wildboar.explain.IntervalImportance.plot"]], "plot() (wildboar.explain.shapeletimportance method)": [[24, "wildboar.explain.ShapeletImportance.plot"]], "plot_importances() (in module wildboar.explain)": [[24, "wildboar.explain.plot_importances"]], "set_params() (wildboar.explain.amplitudeimportance method)": [[24, "wildboar.explain.AmplitudeImportance.set_params"]], "set_params() (wildboar.explain.intervalimportance method)": [[24, "wildboar.explain.IntervalImportance.set_params"]], "set_params() (wildboar.explain.shapeletimportance method)": [[24, "wildboar.explain.ShapeletImportance.set_params"]], "wildboar.explain": [[24, "module-wildboar.explain"]], "iseos() (in module wildboar)": [[25, "wildboar.iseos"]], "wildboar": [[25, "module-wildboar"]], "hydraclassifier (class in wildboar.linear_model._hydra)": [[26, "wildboar.linear_model._hydra.HydraClassifier"]], "get_metadata_routing() (wildboar.linear_model._hydra.hydraclassifier method)": [[26, "wildboar.linear_model._hydra.HydraClassifier.get_metadata_routing"]], "get_params() (wildboar.linear_model._hydra.hydraclassifier method)": [[26, "wildboar.linear_model._hydra.HydraClassifier.get_params"]], "score() (wildboar.linear_model._hydra.hydraclassifier method)": [[26, "wildboar.linear_model._hydra.HydraClassifier.score"]], "set_params() (wildboar.linear_model._hydra.hydraclassifier method)": [[26, "wildboar.linear_model._hydra.HydraClassifier.set_params"]], "wildboar.linear_model._hydra": [[26, "module-wildboar.linear_model._hydra"]], "rocketclassifier (class in wildboar.linear_model._rocket)": [[27, "wildboar.linear_model._rocket.RocketClassifier"]], "rocketregressor (class in wildboar.linear_model._rocket)": [[27, "wildboar.linear_model._rocket.RocketRegressor"]], "get_metadata_routing() (wildboar.linear_model._rocket.rocketclassifier method)": [[27, "wildboar.linear_model._rocket.RocketClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.linear_model._rocket.rocketregressor method)": [[27, "wildboar.linear_model._rocket.RocketRegressor.get_metadata_routing"]], "get_params() (wildboar.linear_model._rocket.rocketclassifier method)": [[27, "wildboar.linear_model._rocket.RocketClassifier.get_params"]], "get_params() (wildboar.linear_model._rocket.rocketregressor method)": [[27, "wildboar.linear_model._rocket.RocketRegressor.get_params"]], "score() (wildboar.linear_model._rocket.rocketclassifier method)": [[27, "wildboar.linear_model._rocket.RocketClassifier.score"]], "score() (wildboar.linear_model._rocket.rocketregressor method)": [[27, "wildboar.linear_model._rocket.RocketRegressor.score"]], "set_params() (wildboar.linear_model._rocket.rocketclassifier method)": [[27, "wildboar.linear_model._rocket.RocketClassifier.set_params"]], "set_params() (wildboar.linear_model._rocket.rocketregressor method)": [[27, "wildboar.linear_model._rocket.RocketRegressor.set_params"]], "wildboar.linear_model._rocket": [[27, "module-wildboar.linear_model._rocket"]], "randomshapeletclassifier (class in wildboar.linear_model._shapelet)": [[28, "wildboar.linear_model._shapelet.RandomShapeletClassifier"]], "randomshapeletregressor (class in wildboar.linear_model._shapelet)": [[28, "wildboar.linear_model._shapelet.RandomShapeletRegressor"]], "get_metadata_routing() (wildboar.linear_model._shapelet.randomshapeletclassifier method)": [[28, "wildboar.linear_model._shapelet.RandomShapeletClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.linear_model._shapelet.randomshapeletregressor method)": [[28, "wildboar.linear_model._shapelet.RandomShapeletRegressor.get_metadata_routing"]], "get_params() (wildboar.linear_model._shapelet.randomshapeletclassifier method)": [[28, "wildboar.linear_model._shapelet.RandomShapeletClassifier.get_params"]], "get_params() (wildboar.linear_model._shapelet.randomshapeletregressor method)": [[28, "wildboar.linear_model._shapelet.RandomShapeletRegressor.get_params"]], "score() (wildboar.linear_model._shapelet.randomshapeletclassifier method)": [[28, "wildboar.linear_model._shapelet.RandomShapeletClassifier.score"]], "score() (wildboar.linear_model._shapelet.randomshapeletregressor method)": [[28, "wildboar.linear_model._shapelet.RandomShapeletRegressor.score"]], "set_params() (wildboar.linear_model._shapelet.randomshapeletclassifier method)": [[28, "wildboar.linear_model._shapelet.RandomShapeletClassifier.set_params"]], "set_params() (wildboar.linear_model._shapelet.randomshapeletregressor method)": [[28, "wildboar.linear_model._shapelet.RandomShapeletRegressor.set_params"]], "wildboar.linear_model._shapelet": [[28, "module-wildboar.linear_model._shapelet"]], "basetransformclassifier (class in wildboar.linear_model._transform)": [[29, "wildboar.linear_model._transform.BaseTransformClassifier"]], "basetransformestimator (class in wildboar.linear_model._transform)": [[29, "wildboar.linear_model._transform.BaseTransformEstimator"]], "basetransformregressor (class in wildboar.linear_model._transform)": [[29, "wildboar.linear_model._transform.BaseTransformRegressor"]], "transformridgecv (class in wildboar.linear_model._transform)": [[29, "wildboar.linear_model._transform.TransformRidgeCV"]], "transformridgeclassifiercv (class in wildboar.linear_model._transform)": [[29, "wildboar.linear_model._transform.TransformRidgeClassifierCV"]], "get_metadata_routing() (wildboar.linear_model._transform.basetransformclassifier method)": [[29, "wildboar.linear_model._transform.BaseTransformClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.linear_model._transform.basetransformestimator method)": [[29, "wildboar.linear_model._transform.BaseTransformEstimator.get_metadata_routing"]], "get_metadata_routing() (wildboar.linear_model._transform.basetransformregressor method)": [[29, "wildboar.linear_model._transform.BaseTransformRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.linear_model._transform.transformridgecv method)": [[29, "wildboar.linear_model._transform.TransformRidgeCV.get_metadata_routing"]], "get_metadata_routing() (wildboar.linear_model._transform.transformridgeclassifiercv method)": [[29, "wildboar.linear_model._transform.TransformRidgeClassifierCV.get_metadata_routing"]], "get_params() (wildboar.linear_model._transform.basetransformclassifier method)": [[29, "wildboar.linear_model._transform.BaseTransformClassifier.get_params"]], "get_params() (wildboar.linear_model._transform.basetransformestimator method)": [[29, "wildboar.linear_model._transform.BaseTransformEstimator.get_params"]], "get_params() (wildboar.linear_model._transform.basetransformregressor method)": [[29, "wildboar.linear_model._transform.BaseTransformRegressor.get_params"]], "get_params() (wildboar.linear_model._transform.transformridgecv method)": [[29, "wildboar.linear_model._transform.TransformRidgeCV.get_params"]], "get_params() (wildboar.linear_model._transform.transformridgeclassifiercv method)": [[29, "wildboar.linear_model._transform.TransformRidgeClassifierCV.get_params"]], "score() (wildboar.linear_model._transform.basetransformclassifier method)": [[29, "wildboar.linear_model._transform.BaseTransformClassifier.score"]], "score() (wildboar.linear_model._transform.basetransformregressor method)": [[29, "wildboar.linear_model._transform.BaseTransformRegressor.score"]], "score() (wildboar.linear_model._transform.transformridgecv method)": [[29, "wildboar.linear_model._transform.TransformRidgeCV.score"]], "score() (wildboar.linear_model._transform.transformridgeclassifiercv method)": [[29, "wildboar.linear_model._transform.TransformRidgeClassifierCV.score"]], "set_params() (wildboar.linear_model._transform.basetransformclassifier method)": [[29, "wildboar.linear_model._transform.BaseTransformClassifier.set_params"]], "set_params() (wildboar.linear_model._transform.basetransformestimator method)": [[29, "wildboar.linear_model._transform.BaseTransformEstimator.set_params"]], "set_params() (wildboar.linear_model._transform.basetransformregressor method)": [[29, "wildboar.linear_model._transform.BaseTransformRegressor.set_params"]], "set_params() (wildboar.linear_model._transform.transformridgecv method)": [[29, "wildboar.linear_model._transform.TransformRidgeCV.set_params"]], "set_params() (wildboar.linear_model._transform.transformridgeclassifiercv method)": [[29, "wildboar.linear_model._transform.TransformRidgeClassifierCV.set_params"]], "wildboar.linear_model._transform": [[29, "module-wildboar.linear_model._transform"]], "hydraclassifier (class in wildboar.linear_model)": [[30, "wildboar.linear_model.HydraClassifier"]], "randomshapeletclassifier (class in wildboar.linear_model)": [[30, "wildboar.linear_model.RandomShapeletClassifier"]], "randomshapeletregressor (class in wildboar.linear_model)": [[30, "wildboar.linear_model.RandomShapeletRegressor"]], "rocketclassifier (class in wildboar.linear_model)": [[30, "wildboar.linear_model.RocketClassifier"]], "rocketregressor (class in wildboar.linear_model)": [[30, "wildboar.linear_model.RocketRegressor"]], "get_metadata_routing() (wildboar.linear_model.hydraclassifier method)": [[30, "wildboar.linear_model.HydraClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.linear_model.randomshapeletclassifier method)": [[30, "wildboar.linear_model.RandomShapeletClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.linear_model.randomshapeletregressor method)": [[30, "wildboar.linear_model.RandomShapeletRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.linear_model.rocketclassifier method)": [[30, "wildboar.linear_model.RocketClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.linear_model.rocketregressor method)": [[30, "wildboar.linear_model.RocketRegressor.get_metadata_routing"]], "get_params() (wildboar.linear_model.hydraclassifier method)": [[30, "wildboar.linear_model.HydraClassifier.get_params"]], "get_params() (wildboar.linear_model.randomshapeletclassifier method)": [[30, "wildboar.linear_model.RandomShapeletClassifier.get_params"]], "get_params() (wildboar.linear_model.randomshapeletregressor method)": [[30, "wildboar.linear_model.RandomShapeletRegressor.get_params"]], "get_params() (wildboar.linear_model.rocketclassifier method)": [[30, "wildboar.linear_model.RocketClassifier.get_params"]], "get_params() (wildboar.linear_model.rocketregressor method)": [[30, "wildboar.linear_model.RocketRegressor.get_params"]], "score() (wildboar.linear_model.hydraclassifier method)": [[30, "wildboar.linear_model.HydraClassifier.score"]], "score() (wildboar.linear_model.randomshapeletclassifier method)": [[30, "wildboar.linear_model.RandomShapeletClassifier.score"]], "score() (wildboar.linear_model.randomshapeletregressor method)": [[30, "wildboar.linear_model.RandomShapeletRegressor.score"]], "score() (wildboar.linear_model.rocketclassifier method)": [[30, "wildboar.linear_model.RocketClassifier.score"]], "score() (wildboar.linear_model.rocketregressor method)": [[30, "wildboar.linear_model.RocketRegressor.score"]], "set_params() (wildboar.linear_model.hydraclassifier method)": [[30, "wildboar.linear_model.HydraClassifier.set_params"]], "set_params() (wildboar.linear_model.randomshapeletclassifier method)": [[30, "wildboar.linear_model.RandomShapeletClassifier.set_params"]], "set_params() (wildboar.linear_model.randomshapeletregressor method)": [[30, "wildboar.linear_model.RandomShapeletRegressor.set_params"]], "set_params() (wildboar.linear_model.rocketclassifier method)": [[30, "wildboar.linear_model.RocketClassifier.set_params"]], "set_params() (wildboar.linear_model.rocketregressor method)": [[30, "wildboar.linear_model.RocketRegressor.set_params"]], "wildboar.linear_model": [[30, "module-wildboar.linear_model"]], "silhouette_samples() (in module wildboar.metrics._cluster)": [[31, "wildboar.metrics._cluster.silhouette_samples"]], "silhouette_score() (in module wildboar.metrics._cluster)": [[31, "wildboar.metrics._cluster.silhouette_score"]], "wildboar.metrics._cluster": [[31, "module-wildboar.metrics._cluster"]], "compactness_score() (in module wildboar.metrics._counterfactual)": [[32, "wildboar.metrics._counterfactual.compactness_score"]], "plausability_score() (in module wildboar.metrics._counterfactual)": [[32, "wildboar.metrics._counterfactual.plausability_score"]], "proximity_score() (in module wildboar.metrics._counterfactual)": [[32, "wildboar.metrics._counterfactual.proximity_score"]], "redudancy_score() (in module wildboar.metrics._counterfactual)": [[32, "wildboar.metrics._counterfactual.redudancy_score"]], "relative_proximity_score() (in module wildboar.metrics._counterfactual)": [[32, "wildboar.metrics._counterfactual.relative_proximity_score"]], "validity_score() (in module wildboar.metrics._counterfactual)": [[32, "wildboar.metrics._counterfactual.validity_score"]], "wildboar.metrics._counterfactual": [[32, "module-wildboar.metrics._counterfactual"]], "compactness_score() (in module wildboar.metrics)": [[33, "wildboar.metrics.compactness_score"]], "plausability_score() (in module wildboar.metrics)": [[33, "wildboar.metrics.plausability_score"]], "proximity_score() (in module wildboar.metrics)": [[33, "wildboar.metrics.proximity_score"]], "redudancy_score() (in module wildboar.metrics)": [[33, "wildboar.metrics.redudancy_score"]], "relative_proximity_score() (in module wildboar.metrics)": [[33, "wildboar.metrics.relative_proximity_score"]], "silhouette_samples() (in module wildboar.metrics)": [[33, "wildboar.metrics.silhouette_samples"]], "silhouette_score() (in module wildboar.metrics)": [[33, "wildboar.metrics.silhouette_score"]], "validity_score() (in module wildboar.metrics)": [[33, "wildboar.metrics.validity_score"]], "wildboar.metrics": [[33, "module-wildboar.metrics"]], "repeatedoutliersplit (class in wildboar.model_selection._cv)": [[34, "wildboar.model_selection._cv.RepeatedOutlierSplit"]], "get_n_splits() (wildboar.model_selection._cv.repeatedoutliersplit method)": [[34, "wildboar.model_selection._cv.RepeatedOutlierSplit.get_n_splits"]], "split() (wildboar.model_selection._cv.repeatedoutliersplit method)": [[34, "wildboar.model_selection._cv.RepeatedOutlierSplit.split"]], "wildboar.model_selection._cv": [[34, "module-wildboar.model_selection._cv"]], "outlier_train_test_split() (in module wildboar.model_selection._outlier)": [[35, "wildboar.model_selection._outlier.outlier_train_test_split"]], "wildboar.model_selection._outlier": [[35, "module-wildboar.model_selection._outlier"]], "repeatedoutliersplit (class in wildboar.model_selection)": [[36, "wildboar.model_selection.RepeatedOutlierSplit"]], "get_n_splits() (wildboar.model_selection.repeatedoutliersplit method)": [[36, "wildboar.model_selection.RepeatedOutlierSplit.get_n_splits"]], "outlier_train_test_split() (in module wildboar.model_selection)": [[36, "wildboar.model_selection.outlier_train_test_split"]], "split() (wildboar.model_selection.repeatedoutliersplit method)": [[36, "wildboar.model_selection.RepeatedOutlierSplit.split"]], "wildboar.model_selection": [[36, "module-wildboar.model_selection"]], "baseattributetransform (class in wildboar.transform._base)": [[37, "wildboar.transform._base.BaseAttributeTransform"]], "fit() (wildboar.transform._base.baseattributetransform method)": [[37, "wildboar.transform._base.BaseAttributeTransform.fit"]], "fit_transform() (wildboar.transform._base.baseattributetransform method)": [[37, "wildboar.transform._base.BaseAttributeTransform.fit_transform"]], "get_metadata_routing() (wildboar.transform._base.baseattributetransform method)": [[37, "wildboar.transform._base.BaseAttributeTransform.get_metadata_routing"]], "get_params() (wildboar.transform._base.baseattributetransform method)": [[37, "wildboar.transform._base.BaseAttributeTransform.get_params"]], "set_output() (wildboar.transform._base.baseattributetransform method)": [[37, "wildboar.transform._base.BaseAttributeTransform.set_output"]], "set_params() (wildboar.transform._base.baseattributetransform method)": [[37, "wildboar.transform._base.BaseAttributeTransform.set_params"]], "transform() (wildboar.transform._base.baseattributetransform method)": [[37, "wildboar.transform._base.BaseAttributeTransform.transform"]], "wildboar.transform._base": [[37, "module-wildboar.transform._base"]], "convolve() (in module wildboar.transform._conv)": [[38, "wildboar.transform._conv.convolve"]], "wildboar.transform._conv": [[38, "module-wildboar.transform._conv"]], "difftransform (class in wildboar.transform._diff)": [[39, "wildboar.transform._diff.DiffTransform"]], "fit_transform() (wildboar.transform._diff.difftransform method)": [[39, "wildboar.transform._diff.DiffTransform.fit_transform"]], "get_metadata_routing() (wildboar.transform._diff.difftransform method)": [[39, "wildboar.transform._diff.DiffTransform.get_metadata_routing"]], "get_params() (wildboar.transform._diff.difftransform method)": [[39, "wildboar.transform._diff.DiffTransform.get_params"]], "set_output() (wildboar.transform._diff.difftransform method)": [[39, "wildboar.transform._diff.DiffTransform.set_output"]], "set_params() (wildboar.transform._diff.difftransform method)": [[39, "wildboar.transform._diff.DiffTransform.set_params"]], "wildboar.transform._diff": [[39, "module-wildboar.transform._diff"]], "hydratransform (class in wildboar.transform._hydra)": [[40, "wildboar.transform._hydra.HydraTransform"]], "fit() (wildboar.transform._hydra.hydratransform method)": [[40, "wildboar.transform._hydra.HydraTransform.fit"]], "fit_transform() (wildboar.transform._hydra.hydratransform method)": [[40, "wildboar.transform._hydra.HydraTransform.fit_transform"]], "get_metadata_routing() (wildboar.transform._hydra.hydratransform method)": [[40, "wildboar.transform._hydra.HydraTransform.get_metadata_routing"]], "get_params() (wildboar.transform._hydra.hydratransform method)": [[40, "wildboar.transform._hydra.HydraTransform.get_params"]], "set_output() (wildboar.transform._hydra.hydratransform method)": [[40, "wildboar.transform._hydra.HydraTransform.set_output"]], "set_params() (wildboar.transform._hydra.hydratransform method)": [[40, "wildboar.transform._hydra.HydraTransform.set_params"]], "transform() (wildboar.transform._hydra.hydratransform method)": [[40, "wildboar.transform._hydra.HydraTransform.transform"]], "wildboar.transform._hydra": [[40, "module-wildboar.transform._hydra"]], "featuretransform (class in wildboar.transform._interval)": [[41, "wildboar.transform._interval.FeatureTransform"]], "intervalmixin (class in wildboar.transform._interval)": [[41, "wildboar.transform._interval.IntervalMixin"]], "intervaltransform (class in wildboar.transform._interval)": [[41, "wildboar.transform._interval.IntervalTransform"]], "fit() (wildboar.transform._interval.featuretransform method)": [[41, "wildboar.transform._interval.FeatureTransform.fit"]], "fit() (wildboar.transform._interval.intervaltransform method)": [[41, "wildboar.transform._interval.IntervalTransform.fit"]], "fit_transform() (wildboar.transform._interval.featuretransform method)": [[41, "wildboar.transform._interval.FeatureTransform.fit_transform"]], "fit_transform() (wildboar.transform._interval.intervaltransform method)": [[41, "wildboar.transform._interval.IntervalTransform.fit_transform"]], "get_metadata_routing() (wildboar.transform._interval.featuretransform method)": [[41, "wildboar.transform._interval.FeatureTransform.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform._interval.intervaltransform method)": [[41, "wildboar.transform._interval.IntervalTransform.get_metadata_routing"]], "get_params() (wildboar.transform._interval.featuretransform method)": [[41, "wildboar.transform._interval.FeatureTransform.get_params"]], "get_params() (wildboar.transform._interval.intervaltransform method)": [[41, "wildboar.transform._interval.IntervalTransform.get_params"]], "set_output() (wildboar.transform._interval.featuretransform method)": [[41, "wildboar.transform._interval.FeatureTransform.set_output"]], "set_output() (wildboar.transform._interval.intervaltransform method)": [[41, "wildboar.transform._interval.IntervalTransform.set_output"]], "set_params() (wildboar.transform._interval.featuretransform method)": [[41, "wildboar.transform._interval.FeatureTransform.set_params"]], "set_params() (wildboar.transform._interval.intervaltransform method)": [[41, "wildboar.transform._interval.IntervalTransform.set_params"]], "transform() (wildboar.transform._interval.featuretransform method)": [[41, "wildboar.transform._interval.FeatureTransform.transform"]], "transform() (wildboar.transform._interval.intervaltransform method)": [[41, "wildboar.transform._interval.IntervalTransform.transform"]], "wildboar.transform._interval": [[41, "module-wildboar.transform._interval"]], "matrixprofiletransform (class in wildboar.transform._matrix_profile)": [[42, "wildboar.transform._matrix_profile.MatrixProfileTransform"]], "fit() (wildboar.transform._matrix_profile.matrixprofiletransform method)": [[42, "wildboar.transform._matrix_profile.MatrixProfileTransform.fit"]], "fit_transform() (wildboar.transform._matrix_profile.matrixprofiletransform method)": [[42, "wildboar.transform._matrix_profile.MatrixProfileTransform.fit_transform"]], "get_metadata_routing() (wildboar.transform._matrix_profile.matrixprofiletransform method)": [[42, "wildboar.transform._matrix_profile.MatrixProfileTransform.get_metadata_routing"]], "get_params() (wildboar.transform._matrix_profile.matrixprofiletransform method)": [[42, "wildboar.transform._matrix_profile.MatrixProfileTransform.get_params"]], "set_output() (wildboar.transform._matrix_profile.matrixprofiletransform method)": [[42, "wildboar.transform._matrix_profile.MatrixProfileTransform.set_output"]], "set_params() (wildboar.transform._matrix_profile.matrixprofiletransform method)": [[42, "wildboar.transform._matrix_profile.MatrixProfileTransform.set_params"]], "transform() (wildboar.transform._matrix_profile.matrixprofiletransform method)": [[42, "wildboar.transform._matrix_profile.MatrixProfileTransform.transform"]], "wildboar.transform._matrix_profile": [[42, "module-wildboar.transform._matrix_profile"]], "pivotmixin (class in wildboar.transform._pivot)": [[43, "wildboar.transform._pivot.PivotMixin"]], "pivottransform (class in wildboar.transform._pivot)": [[43, "wildboar.transform._pivot.PivotTransform"]], "proximitytransform (class in wildboar.transform._pivot)": [[43, "wildboar.transform._pivot.ProximityTransform"]], "fit() (wildboar.transform._pivot.pivottransform method)": [[43, "wildboar.transform._pivot.PivotTransform.fit"]], "fit_transform() (wildboar.transform._pivot.pivottransform method)": [[43, "wildboar.transform._pivot.PivotTransform.fit_transform"]], "fit_transform() (wildboar.transform._pivot.proximitytransform method)": [[43, "wildboar.transform._pivot.ProximityTransform.fit_transform"]], "get_metadata_routing() (wildboar.transform._pivot.pivottransform method)": [[43, "wildboar.transform._pivot.PivotTransform.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform._pivot.proximitytransform method)": [[43, "wildboar.transform._pivot.ProximityTransform.get_metadata_routing"]], "get_params() (wildboar.transform._pivot.pivottransform method)": [[43, "wildboar.transform._pivot.PivotTransform.get_params"]], "get_params() (wildboar.transform._pivot.proximitytransform method)": [[43, "wildboar.transform._pivot.ProximityTransform.get_params"]], "set_output() (wildboar.transform._pivot.pivottransform method)": [[43, "wildboar.transform._pivot.PivotTransform.set_output"]], "set_output() (wildboar.transform._pivot.proximitytransform method)": [[43, "wildboar.transform._pivot.ProximityTransform.set_output"]], "set_params() (wildboar.transform._pivot.pivottransform method)": [[43, "wildboar.transform._pivot.PivotTransform.set_params"]], "set_params() (wildboar.transform._pivot.proximitytransform method)": [[43, "wildboar.transform._pivot.ProximityTransform.set_params"]], "transform() (wildboar.transform._pivot.pivottransform method)": [[43, "wildboar.transform._pivot.PivotTransform.transform"]], "wildboar.transform._pivot": [[43, "module-wildboar.transform._pivot"]], "rocketmixin (class in wildboar.transform._rocket)": [[44, "wildboar.transform._rocket.RocketMixin"]], "rockettransform (class in wildboar.transform._rocket)": [[44, "wildboar.transform._rocket.RocketTransform"]], "fit() (wildboar.transform._rocket.rockettransform method)": [[44, "wildboar.transform._rocket.RocketTransform.fit"]], "fit_transform() (wildboar.transform._rocket.rockettransform method)": [[44, "wildboar.transform._rocket.RocketTransform.fit_transform"]], "get_metadata_routing() (wildboar.transform._rocket.rockettransform method)": [[44, "wildboar.transform._rocket.RocketTransform.get_metadata_routing"]], "get_params() (wildboar.transform._rocket.rockettransform method)": [[44, "wildboar.transform._rocket.RocketTransform.get_params"]], "set_output() (wildboar.transform._rocket.rockettransform method)": [[44, "wildboar.transform._rocket.RocketTransform.set_output"]], "set_params() (wildboar.transform._rocket.rockettransform method)": [[44, "wildboar.transform._rocket.RocketTransform.set_params"]], "transform() (wildboar.transform._rocket.rockettransform method)": [[44, "wildboar.transform._rocket.RocketTransform.transform"]], "wildboar.transform._rocket": [[44, "module-wildboar.transform._rocket"]], "binning (class in wildboar.transform._sax)": [[45, "wildboar.transform._sax.Binning"]], "normalbinning (class in wildboar.transform._sax)": [[45, "wildboar.transform._sax.NormalBinning"]], "paa (class in wildboar.transform._sax)": [[45, "wildboar.transform._sax.PAA"]], "sax (class in wildboar.transform._sax)": [[45, "wildboar.transform._sax.SAX"]], "uniformbinning (class in wildboar.transform._sax)": [[45, "wildboar.transform._sax.UniformBinning"]], "fit_transform() (wildboar.transform._sax.paa method)": [[45, "wildboar.transform._sax.PAA.fit_transform"]], "fit_transform() (wildboar.transform._sax.sax method)": [[45, "wildboar.transform._sax.SAX.fit_transform"]], "get_metadata_routing() (wildboar.transform._sax.paa method)": [[45, "wildboar.transform._sax.PAA.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform._sax.sax method)": [[45, "wildboar.transform._sax.SAX.get_metadata_routing"]], "get_params() (wildboar.transform._sax.paa method)": [[45, "wildboar.transform._sax.PAA.get_params"]], "get_params() (wildboar.transform._sax.sax method)": [[45, "wildboar.transform._sax.SAX.get_params"]], "get_thresholds() (wildboar.transform._sax.binning method)": [[45, "wildboar.transform._sax.Binning.get_thresholds"]], "get_thresholds() (wildboar.transform._sax.normalbinning method)": [[45, "wildboar.transform._sax.NormalBinning.get_thresholds"]], "get_thresholds() (wildboar.transform._sax.uniformbinning method)": [[45, "wildboar.transform._sax.UniformBinning.get_thresholds"]], "piecewice_aggregate_approximation() (in module wildboar.transform._sax)": [[45, "wildboar.transform._sax.piecewice_aggregate_approximation"]], "scale() (wildboar.transform._sax.binning method)": [[45, "wildboar.transform._sax.Binning.scale"]], "scale() (wildboar.transform._sax.normalbinning method)": [[45, "wildboar.transform._sax.NormalBinning.scale"]], "scale() (wildboar.transform._sax.uniformbinning method)": [[45, "wildboar.transform._sax.UniformBinning.scale"]], "set_output() (wildboar.transform._sax.paa method)": [[45, "wildboar.transform._sax.PAA.set_output"]], "set_output() (wildboar.transform._sax.sax method)": [[45, "wildboar.transform._sax.SAX.set_output"]], "set_params() (wildboar.transform._sax.paa method)": [[45, "wildboar.transform._sax.PAA.set_params"]], "set_params() (wildboar.transform._sax.sax method)": [[45, "wildboar.transform._sax.SAX.set_params"]], "symbolic_aggregate_approximation() (in module wildboar.transform._sax)": [[45, "wildboar.transform._sax.symbolic_aggregate_approximation"]], "wildboar.transform._sax": [[45, "module-wildboar.transform._sax"]], "randomshapelettransform (class in wildboar.transform._shapelet)": [[46, "wildboar.transform._shapelet.RandomShapeletTransform"]], "shapeletmixin (class in wildboar.transform._shapelet)": [[46, "wildboar.transform._shapelet.ShapeletMixin"]], "fit() (wildboar.transform._shapelet.randomshapelettransform method)": [[46, "wildboar.transform._shapelet.RandomShapeletTransform.fit"]], "fit_transform() (wildboar.transform._shapelet.randomshapelettransform method)": [[46, "wildboar.transform._shapelet.RandomShapeletTransform.fit_transform"]], "get_metadata_routing() (wildboar.transform._shapelet.randomshapelettransform method)": [[46, "wildboar.transform._shapelet.RandomShapeletTransform.get_metadata_routing"]], "get_params() (wildboar.transform._shapelet.randomshapelettransform method)": [[46, "wildboar.transform._shapelet.RandomShapeletTransform.get_params"]], "set_output() (wildboar.transform._shapelet.randomshapelettransform method)": [[46, "wildboar.transform._shapelet.RandomShapeletTransform.set_output"]], "set_params() (wildboar.transform._shapelet.randomshapelettransform method)": [[46, "wildboar.transform._shapelet.RandomShapeletTransform.set_params"]], "transform() (wildboar.transform._shapelet.randomshapelettransform method)": [[46, "wildboar.transform._shapelet.RandomShapeletTransform.transform"]], "wildboar.transform._shapelet": [[46, "module-wildboar.transform._shapelet"]], "difftransform (class in wildboar.transform)": [[47, "wildboar.transform.DiffTransform"]], "featuretransform (class in wildboar.transform)": [[47, "wildboar.transform.FeatureTransform"]], "hydratransform (class in wildboar.transform)": [[47, "wildboar.transform.HydraTransform"]], "intervaltransform (class in wildboar.transform)": [[47, "wildboar.transform.IntervalTransform"]], "matrixprofiletransform (class in wildboar.transform)": [[47, "wildboar.transform.MatrixProfileTransform"]], "paa (class in wildboar.transform)": [[47, "wildboar.transform.PAA"]], "pivottransform (class in wildboar.transform)": [[47, "wildboar.transform.PivotTransform"]], "proximitytransform (class in wildboar.transform)": [[47, "wildboar.transform.ProximityTransform"]], "randomshapelettransform (class in wildboar.transform)": [[47, "wildboar.transform.RandomShapeletTransform"]], "rockettransform (class in wildboar.transform)": [[47, "wildboar.transform.RocketTransform"]], "sax (class in wildboar.transform)": [[47, "wildboar.transform.SAX"]], "convolve() (in module wildboar.transform)": [[47, "wildboar.transform.convolve"]], "fit() (wildboar.transform.featuretransform method)": [[47, "wildboar.transform.FeatureTransform.fit"]], "fit() (wildboar.transform.hydratransform method)": [[47, "wildboar.transform.HydraTransform.fit"]], "fit() (wildboar.transform.intervaltransform method)": [[47, "wildboar.transform.IntervalTransform.fit"]], "fit() (wildboar.transform.matrixprofiletransform method)": [[47, "wildboar.transform.MatrixProfileTransform.fit"]], "fit() (wildboar.transform.pivottransform method)": [[47, "wildboar.transform.PivotTransform.fit"]], "fit() (wildboar.transform.randomshapelettransform method)": [[47, "wildboar.transform.RandomShapeletTransform.fit"]], "fit() (wildboar.transform.rockettransform method)": [[47, "wildboar.transform.RocketTransform.fit"]], "fit_transform() (wildboar.transform.difftransform method)": [[47, "wildboar.transform.DiffTransform.fit_transform"]], "fit_transform() (wildboar.transform.featuretransform method)": [[47, "wildboar.transform.FeatureTransform.fit_transform"]], "fit_transform() (wildboar.transform.hydratransform method)": [[47, "wildboar.transform.HydraTransform.fit_transform"]], "fit_transform() (wildboar.transform.intervaltransform method)": [[47, "wildboar.transform.IntervalTransform.fit_transform"]], "fit_transform() (wildboar.transform.matrixprofiletransform method)": [[47, "wildboar.transform.MatrixProfileTransform.fit_transform"]], "fit_transform() (wildboar.transform.paa method)": [[47, "wildboar.transform.PAA.fit_transform"]], "fit_transform() (wildboar.transform.pivottransform method)": [[47, "wildboar.transform.PivotTransform.fit_transform"]], "fit_transform() (wildboar.transform.proximitytransform method)": [[47, "wildboar.transform.ProximityTransform.fit_transform"]], "fit_transform() (wildboar.transform.randomshapelettransform method)": [[47, "wildboar.transform.RandomShapeletTransform.fit_transform"]], "fit_transform() (wildboar.transform.rockettransform method)": [[47, "wildboar.transform.RocketTransform.fit_transform"]], "fit_transform() (wildboar.transform.sax method)": [[47, "wildboar.transform.SAX.fit_transform"]], "get_metadata_routing() (wildboar.transform.difftransform method)": [[47, "wildboar.transform.DiffTransform.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform.featuretransform method)": [[47, "wildboar.transform.FeatureTransform.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform.hydratransform method)": [[47, "wildboar.transform.HydraTransform.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform.intervaltransform method)": [[47, "wildboar.transform.IntervalTransform.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform.matrixprofiletransform method)": [[47, "wildboar.transform.MatrixProfileTransform.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform.paa method)": [[47, "wildboar.transform.PAA.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform.pivottransform method)": [[47, "wildboar.transform.PivotTransform.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform.proximitytransform method)": [[47, "wildboar.transform.ProximityTransform.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform.randomshapelettransform method)": [[47, "wildboar.transform.RandomShapeletTransform.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform.rockettransform method)": [[47, "wildboar.transform.RocketTransform.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform.sax method)": [[47, "wildboar.transform.SAX.get_metadata_routing"]], "get_params() (wildboar.transform.difftransform method)": [[47, "wildboar.transform.DiffTransform.get_params"]], "get_params() (wildboar.transform.featuretransform method)": [[47, "wildboar.transform.FeatureTransform.get_params"]], "get_params() (wildboar.transform.hydratransform method)": [[47, "wildboar.transform.HydraTransform.get_params"]], "get_params() (wildboar.transform.intervaltransform method)": [[47, "wildboar.transform.IntervalTransform.get_params"]], "get_params() (wildboar.transform.matrixprofiletransform method)": [[47, "wildboar.transform.MatrixProfileTransform.get_params"]], "get_params() (wildboar.transform.paa method)": [[47, "wildboar.transform.PAA.get_params"]], "get_params() (wildboar.transform.pivottransform method)": [[47, "wildboar.transform.PivotTransform.get_params"]], "get_params() (wildboar.transform.proximitytransform method)": [[47, "wildboar.transform.ProximityTransform.get_params"]], "get_params() (wildboar.transform.randomshapelettransform method)": [[47, "wildboar.transform.RandomShapeletTransform.get_params"]], "get_params() (wildboar.transform.rockettransform method)": [[47, "wildboar.transform.RocketTransform.get_params"]], "get_params() (wildboar.transform.sax method)": [[47, "wildboar.transform.SAX.get_params"]], "piecewice_aggregate_approximation() (in module wildboar.transform)": [[47, "wildboar.transform.piecewice_aggregate_approximation"]], "set_output() (wildboar.transform.difftransform method)": [[47, "wildboar.transform.DiffTransform.set_output"]], "set_output() (wildboar.transform.featuretransform method)": [[47, "wildboar.transform.FeatureTransform.set_output"]], "set_output() (wildboar.transform.hydratransform method)": [[47, "wildboar.transform.HydraTransform.set_output"]], "set_output() (wildboar.transform.intervaltransform method)": [[47, "wildboar.transform.IntervalTransform.set_output"]], "set_output() (wildboar.transform.matrixprofiletransform method)": [[47, "wildboar.transform.MatrixProfileTransform.set_output"]], "set_output() (wildboar.transform.paa method)": [[47, "wildboar.transform.PAA.set_output"]], "set_output() (wildboar.transform.pivottransform method)": [[47, "wildboar.transform.PivotTransform.set_output"]], "set_output() (wildboar.transform.proximitytransform method)": [[47, "wildboar.transform.ProximityTransform.set_output"]], "set_output() (wildboar.transform.randomshapelettransform method)": [[47, "wildboar.transform.RandomShapeletTransform.set_output"]], "set_output() (wildboar.transform.rockettransform method)": [[47, "wildboar.transform.RocketTransform.set_output"]], "set_output() (wildboar.transform.sax method)": [[47, "wildboar.transform.SAX.set_output"]], "set_params() (wildboar.transform.difftransform method)": [[47, "wildboar.transform.DiffTransform.set_params"]], "set_params() (wildboar.transform.featuretransform method)": [[47, "wildboar.transform.FeatureTransform.set_params"]], "set_params() (wildboar.transform.hydratransform method)": [[47, "wildboar.transform.HydraTransform.set_params"]], "set_params() (wildboar.transform.intervaltransform method)": [[47, "wildboar.transform.IntervalTransform.set_params"]], "set_params() (wildboar.transform.matrixprofiletransform method)": [[47, "wildboar.transform.MatrixProfileTransform.set_params"]], "set_params() (wildboar.transform.paa method)": [[47, "wildboar.transform.PAA.set_params"]], "set_params() (wildboar.transform.pivottransform method)": [[47, "wildboar.transform.PivotTransform.set_params"]], "set_params() (wildboar.transform.proximitytransform method)": [[47, "wildboar.transform.ProximityTransform.set_params"]], "set_params() (wildboar.transform.randomshapelettransform method)": [[47, "wildboar.transform.RandomShapeletTransform.set_params"]], "set_params() (wildboar.transform.rockettransform method)": [[47, "wildboar.transform.RocketTransform.set_params"]], "set_params() (wildboar.transform.sax method)": [[47, "wildboar.transform.SAX.set_params"]], "symbolic_aggregate_approximation() (in module wildboar.transform)": [[47, "wildboar.transform.symbolic_aggregate_approximation"]], "transform() (wildboar.transform.featuretransform method)": [[47, "wildboar.transform.FeatureTransform.transform"]], "transform() (wildboar.transform.hydratransform method)": [[47, "wildboar.transform.HydraTransform.transform"]], "transform() (wildboar.transform.intervaltransform method)": [[47, "wildboar.transform.IntervalTransform.transform"]], "transform() (wildboar.transform.matrixprofiletransform method)": [[47, "wildboar.transform.MatrixProfileTransform.transform"]], "transform() (wildboar.transform.pivottransform method)": [[47, "wildboar.transform.PivotTransform.transform"]], "transform() (wildboar.transform.randomshapelettransform method)": [[47, "wildboar.transform.RandomShapeletTransform.transform"]], "transform() (wildboar.transform.rockettransform method)": [[47, "wildboar.transform.RocketTransform.transform"]], "wildboar.transform": [[47, "module-wildboar.transform"]], "basetree (class in wildboar.tree._base)": [[48, "wildboar.tree._base.BaseTree"]], "basetreeclassifier (class in wildboar.tree._base)": [[48, "wildboar.tree._base.BaseTreeClassifier"]], "basetreeregressor (class in wildboar.tree._base)": [[48, "wildboar.tree._base.BaseTreeRegressor"]], "apply() (wildboar.tree._base.basetree method)": [[48, "wildboar.tree._base.BaseTree.apply"]], "apply() (wildboar.tree._base.basetreeclassifier method)": [[48, "wildboar.tree._base.BaseTreeClassifier.apply"]], "apply() (wildboar.tree._base.basetreeregressor method)": [[48, "wildboar.tree._base.BaseTreeRegressor.apply"]], "decision_path() (wildboar.tree._base.basetree method)": [[48, "wildboar.tree._base.BaseTree.decision_path"]], "decision_path() (wildboar.tree._base.basetreeclassifier method)": [[48, "wildboar.tree._base.BaseTreeClassifier.decision_path"]], "decision_path() (wildboar.tree._base.basetreeregressor method)": [[48, "wildboar.tree._base.BaseTreeRegressor.decision_path"]], "fit() (wildboar.tree._base.basetreeclassifier method)": [[48, "wildboar.tree._base.BaseTreeClassifier.fit"]], "fit() (wildboar.tree._base.basetreeregressor method)": [[48, "wildboar.tree._base.BaseTreeRegressor.fit"]], "get_metadata_routing() (wildboar.tree._base.basetree method)": [[48, "wildboar.tree._base.BaseTree.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._base.basetreeclassifier method)": [[48, "wildboar.tree._base.BaseTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._base.basetreeregressor method)": [[48, "wildboar.tree._base.BaseTreeRegressor.get_metadata_routing"]], "get_params() (wildboar.tree._base.basetree method)": [[48, "wildboar.tree._base.BaseTree.get_params"]], "get_params() (wildboar.tree._base.basetreeclassifier method)": [[48, "wildboar.tree._base.BaseTreeClassifier.get_params"]], "get_params() (wildboar.tree._base.basetreeregressor method)": [[48, "wildboar.tree._base.BaseTreeRegressor.get_params"]], "predict() (wildboar.tree._base.basetreeclassifier method)": [[48, "wildboar.tree._base.BaseTreeClassifier.predict"]], "predict() (wildboar.tree._base.basetreeregressor method)": [[48, "wildboar.tree._base.BaseTreeRegressor.predict"]], "predict_proba() (wildboar.tree._base.basetreeclassifier method)": [[48, "wildboar.tree._base.BaseTreeClassifier.predict_proba"]], "score() (wildboar.tree._base.basetreeclassifier method)": [[48, "wildboar.tree._base.BaseTreeClassifier.score"]], "score() (wildboar.tree._base.basetreeregressor method)": [[48, "wildboar.tree._base.BaseTreeRegressor.score"]], "set_params() (wildboar.tree._base.basetree method)": [[48, "wildboar.tree._base.BaseTree.set_params"]], "set_params() (wildboar.tree._base.basetreeclassifier method)": [[48, "wildboar.tree._base.BaseTreeClassifier.set_params"]], "set_params() (wildboar.tree._base.basetreeregressor method)": [[48, "wildboar.tree._base.BaseTreeRegressor.set_params"]], "wildboar.tree._base": [[48, "module-wildboar.tree._base"]], "proximitytreeclassifier (class in wildboar.tree._ptree)": [[49, "wildboar.tree._ptree.ProximityTreeClassifier"]], "apply() (wildboar.tree._ptree.proximitytreeclassifier method)": [[49, "wildboar.tree._ptree.ProximityTreeClassifier.apply"]], "decision_path() (wildboar.tree._ptree.proximitytreeclassifier method)": [[49, "wildboar.tree._ptree.ProximityTreeClassifier.decision_path"]], "fit() (wildboar.tree._ptree.proximitytreeclassifier method)": [[49, "wildboar.tree._ptree.ProximityTreeClassifier.fit"]], "get_metadata_routing() (wildboar.tree._ptree.proximitytreeclassifier method)": [[49, "wildboar.tree._ptree.ProximityTreeClassifier.get_metadata_routing"]], "get_params() (wildboar.tree._ptree.proximitytreeclassifier method)": [[49, "wildboar.tree._ptree.ProximityTreeClassifier.get_params"]], "predict() (wildboar.tree._ptree.proximitytreeclassifier method)": [[49, "wildboar.tree._ptree.ProximityTreeClassifier.predict"]], "predict_proba() (wildboar.tree._ptree.proximitytreeclassifier method)": [[49, "wildboar.tree._ptree.ProximityTreeClassifier.predict_proba"]], "score() (wildboar.tree._ptree.proximitytreeclassifier method)": [[49, "wildboar.tree._ptree.ProximityTreeClassifier.score"]], "set_params() (wildboar.tree._ptree.proximitytreeclassifier method)": [[49, "wildboar.tree._ptree.ProximityTreeClassifier.set_params"]], "wildboar.tree._ptree": [[49, "module-wildboar.tree._ptree"]], "basefeaturetreeclassifier (class in wildboar.tree._tree)": [[50, "wildboar.tree._tree.BaseFeatureTreeClassifier"]], "basefeaturetreeregressor (class in wildboar.tree._tree)": [[50, "wildboar.tree._tree.BaseFeatureTreeRegressor"]], "extrashapelettreeclassifier (class in wildboar.tree._tree)": [[50, "wildboar.tree._tree.ExtraShapeletTreeClassifier"]], "extrashapelettreeregressor (class in wildboar.tree._tree)": [[50, "wildboar.tree._tree.ExtraShapeletTreeRegressor"]], "intervaltreeclassifier (class in wildboar.tree._tree)": [[50, "wildboar.tree._tree.IntervalTreeClassifier"]], "intervaltreeregressor (class in wildboar.tree._tree)": [[50, "wildboar.tree._tree.IntervalTreeRegressor"]], "pivottreeclassifier (class in wildboar.tree._tree)": [[50, "wildboar.tree._tree.PivotTreeClassifier"]], "rockettreeclassifier (class in wildboar.tree._tree)": [[50, "wildboar.tree._tree.RocketTreeClassifier"]], "rockettreeregressor (class in wildboar.tree._tree)": [[50, "wildboar.tree._tree.RocketTreeRegressor"]], "shapelettreeclassifier (class in wildboar.tree._tree)": [[50, "wildboar.tree._tree.ShapeletTreeClassifier"]], "shapelettreeregressor (class in wildboar.tree._tree)": [[50, "wildboar.tree._tree.ShapeletTreeRegressor"]], "apply() (wildboar.tree._tree.basefeaturetreeclassifier method)": [[50, "wildboar.tree._tree.BaseFeatureTreeClassifier.apply"]], "apply() (wildboar.tree._tree.basefeaturetreeregressor method)": [[50, "wildboar.tree._tree.BaseFeatureTreeRegressor.apply"]], "apply() (wildboar.tree._tree.extrashapelettreeclassifier method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeClassifier.apply"]], "apply() (wildboar.tree._tree.extrashapelettreeregressor method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeRegressor.apply"]], "apply() (wildboar.tree._tree.intervaltreeclassifier method)": [[50, "wildboar.tree._tree.IntervalTreeClassifier.apply"]], "apply() (wildboar.tree._tree.intervaltreeregressor method)": [[50, "wildboar.tree._tree.IntervalTreeRegressor.apply"]], "apply() (wildboar.tree._tree.pivottreeclassifier method)": [[50, "wildboar.tree._tree.PivotTreeClassifier.apply"]], "apply() (wildboar.tree._tree.rockettreeclassifier method)": [[50, "wildboar.tree._tree.RocketTreeClassifier.apply"]], "apply() (wildboar.tree._tree.rockettreeregressor method)": [[50, "wildboar.tree._tree.RocketTreeRegressor.apply"]], "apply() (wildboar.tree._tree.shapelettreeclassifier method)": [[50, "wildboar.tree._tree.ShapeletTreeClassifier.apply"]], "apply() (wildboar.tree._tree.shapelettreeregressor method)": [[50, "wildboar.tree._tree.ShapeletTreeRegressor.apply"]], "decision_path() (wildboar.tree._tree.basefeaturetreeclassifier method)": [[50, "wildboar.tree._tree.BaseFeatureTreeClassifier.decision_path"]], "decision_path() (wildboar.tree._tree.basefeaturetreeregressor method)": [[50, "wildboar.tree._tree.BaseFeatureTreeRegressor.decision_path"]], "decision_path() (wildboar.tree._tree.extrashapelettreeclassifier method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeClassifier.decision_path"]], "decision_path() (wildboar.tree._tree.extrashapelettreeregressor method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeRegressor.decision_path"]], "decision_path() (wildboar.tree._tree.intervaltreeclassifier method)": [[50, "wildboar.tree._tree.IntervalTreeClassifier.decision_path"]], "decision_path() (wildboar.tree._tree.intervaltreeregressor method)": [[50, "wildboar.tree._tree.IntervalTreeRegressor.decision_path"]], "decision_path() (wildboar.tree._tree.pivottreeclassifier method)": [[50, "wildboar.tree._tree.PivotTreeClassifier.decision_path"]], "decision_path() (wildboar.tree._tree.rockettreeclassifier method)": [[50, "wildboar.tree._tree.RocketTreeClassifier.decision_path"]], "decision_path() (wildboar.tree._tree.rockettreeregressor method)": [[50, "wildboar.tree._tree.RocketTreeRegressor.decision_path"]], "decision_path() (wildboar.tree._tree.shapelettreeclassifier method)": [[50, "wildboar.tree._tree.ShapeletTreeClassifier.decision_path"]], "decision_path() (wildboar.tree._tree.shapelettreeregressor method)": [[50, "wildboar.tree._tree.ShapeletTreeRegressor.decision_path"]], "fit() (wildboar.tree._tree.basefeaturetreeclassifier method)": [[50, "wildboar.tree._tree.BaseFeatureTreeClassifier.fit"]], "fit() (wildboar.tree._tree.basefeaturetreeregressor method)": [[50, "wildboar.tree._tree.BaseFeatureTreeRegressor.fit"]], "fit() (wildboar.tree._tree.extrashapelettreeclassifier method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeClassifier.fit"]], "fit() (wildboar.tree._tree.extrashapelettreeregressor method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeRegressor.fit"]], "fit() (wildboar.tree._tree.intervaltreeclassifier method)": [[50, "wildboar.tree._tree.IntervalTreeClassifier.fit"]], "fit() (wildboar.tree._tree.intervaltreeregressor method)": [[50, "wildboar.tree._tree.IntervalTreeRegressor.fit"]], "fit() (wildboar.tree._tree.pivottreeclassifier method)": [[50, "wildboar.tree._tree.PivotTreeClassifier.fit"]], "fit() (wildboar.tree._tree.rockettreeclassifier method)": [[50, "wildboar.tree._tree.RocketTreeClassifier.fit"]], "fit() (wildboar.tree._tree.rockettreeregressor method)": [[50, "wildboar.tree._tree.RocketTreeRegressor.fit"]], "fit() (wildboar.tree._tree.shapelettreeclassifier method)": [[50, "wildboar.tree._tree.ShapeletTreeClassifier.fit"]], "fit() (wildboar.tree._tree.shapelettreeregressor method)": [[50, "wildboar.tree._tree.ShapeletTreeRegressor.fit"]], "get_metadata_routing() (wildboar.tree._tree.basefeaturetreeclassifier method)": [[50, "wildboar.tree._tree.BaseFeatureTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._tree.basefeaturetreeregressor method)": [[50, "wildboar.tree._tree.BaseFeatureTreeRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._tree.extrashapelettreeclassifier method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._tree.extrashapelettreeregressor method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._tree.intervaltreeclassifier method)": [[50, "wildboar.tree._tree.IntervalTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._tree.intervaltreeregressor method)": [[50, "wildboar.tree._tree.IntervalTreeRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._tree.pivottreeclassifier method)": [[50, "wildboar.tree._tree.PivotTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._tree.rockettreeclassifier method)": [[50, "wildboar.tree._tree.RocketTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._tree.rockettreeregressor method)": [[50, "wildboar.tree._tree.RocketTreeRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._tree.shapelettreeclassifier method)": [[50, "wildboar.tree._tree.ShapeletTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._tree.shapelettreeregressor method)": [[50, "wildboar.tree._tree.ShapeletTreeRegressor.get_metadata_routing"]], "get_params() (wildboar.tree._tree.basefeaturetreeclassifier method)": [[50, "wildboar.tree._tree.BaseFeatureTreeClassifier.get_params"]], "get_params() (wildboar.tree._tree.basefeaturetreeregressor method)": [[50, "wildboar.tree._tree.BaseFeatureTreeRegressor.get_params"]], "get_params() (wildboar.tree._tree.extrashapelettreeclassifier method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeClassifier.get_params"]], "get_params() (wildboar.tree._tree.extrashapelettreeregressor method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeRegressor.get_params"]], "get_params() (wildboar.tree._tree.intervaltreeclassifier method)": [[50, "wildboar.tree._tree.IntervalTreeClassifier.get_params"]], "get_params() (wildboar.tree._tree.intervaltreeregressor method)": [[50, "wildboar.tree._tree.IntervalTreeRegressor.get_params"]], "get_params() (wildboar.tree._tree.pivottreeclassifier method)": [[50, "wildboar.tree._tree.PivotTreeClassifier.get_params"]], "get_params() (wildboar.tree._tree.rockettreeclassifier method)": [[50, "wildboar.tree._tree.RocketTreeClassifier.get_params"]], "get_params() (wildboar.tree._tree.rockettreeregressor method)": [[50, "wildboar.tree._tree.RocketTreeRegressor.get_params"]], "get_params() (wildboar.tree._tree.shapelettreeclassifier method)": [[50, "wildboar.tree._tree.ShapeletTreeClassifier.get_params"]], "get_params() (wildboar.tree._tree.shapelettreeregressor method)": [[50, "wildboar.tree._tree.ShapeletTreeRegressor.get_params"]], "predict() (wildboar.tree._tree.basefeaturetreeclassifier method)": [[50, "wildboar.tree._tree.BaseFeatureTreeClassifier.predict"]], "predict() (wildboar.tree._tree.basefeaturetreeregressor method)": [[50, "wildboar.tree._tree.BaseFeatureTreeRegressor.predict"]], "predict() (wildboar.tree._tree.extrashapelettreeclassifier method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeClassifier.predict"]], "predict() (wildboar.tree._tree.extrashapelettreeregressor method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeRegressor.predict"]], "predict() (wildboar.tree._tree.intervaltreeclassifier method)": [[50, "wildboar.tree._tree.IntervalTreeClassifier.predict"]], "predict() (wildboar.tree._tree.intervaltreeregressor method)": [[50, "wildboar.tree._tree.IntervalTreeRegressor.predict"]], "predict() (wildboar.tree._tree.pivottreeclassifier method)": [[50, "wildboar.tree._tree.PivotTreeClassifier.predict"]], "predict() (wildboar.tree._tree.rockettreeclassifier method)": [[50, "wildboar.tree._tree.RocketTreeClassifier.predict"]], "predict() (wildboar.tree._tree.rockettreeregressor method)": [[50, "wildboar.tree._tree.RocketTreeRegressor.predict"]], "predict() (wildboar.tree._tree.shapelettreeclassifier method)": [[50, "wildboar.tree._tree.ShapeletTreeClassifier.predict"]], "predict() (wildboar.tree._tree.shapelettreeregressor method)": [[50, "wildboar.tree._tree.ShapeletTreeRegressor.predict"]], "predict_proba() (wildboar.tree._tree.basefeaturetreeclassifier method)": [[50, "wildboar.tree._tree.BaseFeatureTreeClassifier.predict_proba"]], "predict_proba() (wildboar.tree._tree.extrashapelettreeclassifier method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeClassifier.predict_proba"]], "predict_proba() (wildboar.tree._tree.intervaltreeclassifier method)": [[50, "wildboar.tree._tree.IntervalTreeClassifier.predict_proba"]], "predict_proba() (wildboar.tree._tree.pivottreeclassifier method)": [[50, "wildboar.tree._tree.PivotTreeClassifier.predict_proba"]], "predict_proba() (wildboar.tree._tree.rockettreeclassifier method)": [[50, "wildboar.tree._tree.RocketTreeClassifier.predict_proba"]], "predict_proba() (wildboar.tree._tree.shapelettreeclassifier method)": [[50, "wildboar.tree._tree.ShapeletTreeClassifier.predict_proba"]], "score() (wildboar.tree._tree.basefeaturetreeclassifier method)": [[50, "wildboar.tree._tree.BaseFeatureTreeClassifier.score"]], "score() (wildboar.tree._tree.basefeaturetreeregressor method)": [[50, "wildboar.tree._tree.BaseFeatureTreeRegressor.score"]], "score() (wildboar.tree._tree.extrashapelettreeclassifier method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeClassifier.score"]], "score() (wildboar.tree._tree.extrashapelettreeregressor method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeRegressor.score"]], "score() (wildboar.tree._tree.intervaltreeclassifier method)": [[50, "wildboar.tree._tree.IntervalTreeClassifier.score"]], "score() (wildboar.tree._tree.intervaltreeregressor method)": [[50, "wildboar.tree._tree.IntervalTreeRegressor.score"]], "score() (wildboar.tree._tree.pivottreeclassifier method)": [[50, "wildboar.tree._tree.PivotTreeClassifier.score"]], "score() (wildboar.tree._tree.rockettreeclassifier method)": [[50, "wildboar.tree._tree.RocketTreeClassifier.score"]], "score() (wildboar.tree._tree.rockettreeregressor method)": [[50, "wildboar.tree._tree.RocketTreeRegressor.score"]], "score() (wildboar.tree._tree.shapelettreeclassifier method)": [[50, "wildboar.tree._tree.ShapeletTreeClassifier.score"]], "score() (wildboar.tree._tree.shapelettreeregressor method)": [[50, "wildboar.tree._tree.ShapeletTreeRegressor.score"]], "set_params() (wildboar.tree._tree.basefeaturetreeclassifier method)": [[50, "wildboar.tree._tree.BaseFeatureTreeClassifier.set_params"]], "set_params() (wildboar.tree._tree.basefeaturetreeregressor method)": [[50, "wildboar.tree._tree.BaseFeatureTreeRegressor.set_params"]], "set_params() (wildboar.tree._tree.extrashapelettreeclassifier method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeClassifier.set_params"]], "set_params() (wildboar.tree._tree.extrashapelettreeregressor method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeRegressor.set_params"]], "set_params() (wildboar.tree._tree.intervaltreeclassifier method)": [[50, "wildboar.tree._tree.IntervalTreeClassifier.set_params"]], "set_params() (wildboar.tree._tree.intervaltreeregressor method)": [[50, "wildboar.tree._tree.IntervalTreeRegressor.set_params"]], "set_params() (wildboar.tree._tree.pivottreeclassifier method)": [[50, "wildboar.tree._tree.PivotTreeClassifier.set_params"]], "set_params() (wildboar.tree._tree.rockettreeclassifier method)": [[50, "wildboar.tree._tree.RocketTreeClassifier.set_params"]], "set_params() (wildboar.tree._tree.rockettreeregressor method)": [[50, "wildboar.tree._tree.RocketTreeRegressor.set_params"]], "set_params() (wildboar.tree._tree.shapelettreeclassifier method)": [[50, "wildboar.tree._tree.ShapeletTreeClassifier.set_params"]], "set_params() (wildboar.tree._tree.shapelettreeregressor method)": [[50, "wildboar.tree._tree.ShapeletTreeRegressor.set_params"]], "wildboar.tree._tree": [[50, "module-wildboar.tree._tree"]], "extrashapelettreeclassifier (class in wildboar.tree)": [[51, "wildboar.tree.ExtraShapeletTreeClassifier"]], "extrashapelettreeregressor (class in wildboar.tree)": [[51, "wildboar.tree.ExtraShapeletTreeRegressor"]], "intervaltreeclassifier (class in wildboar.tree)": [[51, "wildboar.tree.IntervalTreeClassifier"]], "intervaltreeregressor (class in wildboar.tree)": [[51, "wildboar.tree.IntervalTreeRegressor"]], "pivottreeclassifier (class in wildboar.tree)": [[51, "wildboar.tree.PivotTreeClassifier"]], "proximitytreeclassifier (class in wildboar.tree)": [[51, "wildboar.tree.ProximityTreeClassifier"]], "rockettreeclassifier (class in wildboar.tree)": [[51, "wildboar.tree.RocketTreeClassifier"]], "rockettreeregressor (class in wildboar.tree)": [[51, "wildboar.tree.RocketTreeRegressor"]], "shapelettreeclassifier (class in wildboar.tree)": [[51, "wildboar.tree.ShapeletTreeClassifier"]], "shapelettreeregressor (class in wildboar.tree)": [[51, "wildboar.tree.ShapeletTreeRegressor"]], "apply() (wildboar.tree.extrashapelettreeclassifier method)": [[51, "wildboar.tree.ExtraShapeletTreeClassifier.apply"]], "apply() (wildboar.tree.extrashapelettreeregressor method)": [[51, "wildboar.tree.ExtraShapeletTreeRegressor.apply"]], "apply() (wildboar.tree.intervaltreeclassifier method)": [[51, "wildboar.tree.IntervalTreeClassifier.apply"]], "apply() (wildboar.tree.intervaltreeregressor method)": [[51, "wildboar.tree.IntervalTreeRegressor.apply"]], "apply() (wildboar.tree.pivottreeclassifier method)": [[51, "wildboar.tree.PivotTreeClassifier.apply"]], "apply() (wildboar.tree.proximitytreeclassifier method)": [[51, "wildboar.tree.ProximityTreeClassifier.apply"]], "apply() (wildboar.tree.rockettreeclassifier method)": [[51, "wildboar.tree.RocketTreeClassifier.apply"]], "apply() (wildboar.tree.rockettreeregressor method)": [[51, "wildboar.tree.RocketTreeRegressor.apply"]], "apply() (wildboar.tree.shapelettreeclassifier method)": [[51, "wildboar.tree.ShapeletTreeClassifier.apply"]], "apply() (wildboar.tree.shapelettreeregressor method)": [[51, "wildboar.tree.ShapeletTreeRegressor.apply"]], "decision_path() (wildboar.tree.extrashapelettreeclassifier method)": [[51, "wildboar.tree.ExtraShapeletTreeClassifier.decision_path"]], "decision_path() (wildboar.tree.extrashapelettreeregressor method)": [[51, "wildboar.tree.ExtraShapeletTreeRegressor.decision_path"]], "decision_path() (wildboar.tree.intervaltreeclassifier method)": [[51, "wildboar.tree.IntervalTreeClassifier.decision_path"]], "decision_path() (wildboar.tree.intervaltreeregressor method)": [[51, "wildboar.tree.IntervalTreeRegressor.decision_path"]], "decision_path() (wildboar.tree.pivottreeclassifier method)": [[51, "wildboar.tree.PivotTreeClassifier.decision_path"]], "decision_path() (wildboar.tree.proximitytreeclassifier method)": [[51, "wildboar.tree.ProximityTreeClassifier.decision_path"]], "decision_path() (wildboar.tree.rockettreeclassifier method)": [[51, "wildboar.tree.RocketTreeClassifier.decision_path"]], "decision_path() (wildboar.tree.rockettreeregressor method)": [[51, "wildboar.tree.RocketTreeRegressor.decision_path"]], "decision_path() (wildboar.tree.shapelettreeclassifier method)": [[51, "wildboar.tree.ShapeletTreeClassifier.decision_path"]], "decision_path() (wildboar.tree.shapelettreeregressor method)": [[51, "wildboar.tree.ShapeletTreeRegressor.decision_path"]], "fit() (wildboar.tree.extrashapelettreeclassifier method)": [[51, "wildboar.tree.ExtraShapeletTreeClassifier.fit"]], "fit() (wildboar.tree.extrashapelettreeregressor method)": [[51, "wildboar.tree.ExtraShapeletTreeRegressor.fit"]], "fit() (wildboar.tree.intervaltreeclassifier method)": [[51, "wildboar.tree.IntervalTreeClassifier.fit"]], "fit() (wildboar.tree.intervaltreeregressor method)": [[51, "wildboar.tree.IntervalTreeRegressor.fit"]], "fit() (wildboar.tree.pivottreeclassifier method)": [[51, "wildboar.tree.PivotTreeClassifier.fit"]], "fit() (wildboar.tree.proximitytreeclassifier method)": [[51, "wildboar.tree.ProximityTreeClassifier.fit"]], "fit() (wildboar.tree.rockettreeclassifier method)": [[51, "wildboar.tree.RocketTreeClassifier.fit"]], "fit() (wildboar.tree.rockettreeregressor method)": [[51, "wildboar.tree.RocketTreeRegressor.fit"]], "fit() (wildboar.tree.shapelettreeclassifier method)": [[51, "wildboar.tree.ShapeletTreeClassifier.fit"]], "fit() (wildboar.tree.shapelettreeregressor method)": [[51, "wildboar.tree.ShapeletTreeRegressor.fit"]], "get_metadata_routing() (wildboar.tree.extrashapelettreeclassifier method)": [[51, "wildboar.tree.ExtraShapeletTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree.extrashapelettreeregressor method)": [[51, "wildboar.tree.ExtraShapeletTreeRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree.intervaltreeclassifier method)": [[51, "wildboar.tree.IntervalTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree.intervaltreeregressor method)": [[51, "wildboar.tree.IntervalTreeRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree.pivottreeclassifier method)": [[51, "wildboar.tree.PivotTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree.proximitytreeclassifier method)": [[51, "wildboar.tree.ProximityTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree.rockettreeclassifier method)": [[51, "wildboar.tree.RocketTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree.rockettreeregressor method)": [[51, "wildboar.tree.RocketTreeRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree.shapelettreeclassifier method)": [[51, "wildboar.tree.ShapeletTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree.shapelettreeregressor method)": [[51, "wildboar.tree.ShapeletTreeRegressor.get_metadata_routing"]], "get_params() (wildboar.tree.extrashapelettreeclassifier method)": [[51, "wildboar.tree.ExtraShapeletTreeClassifier.get_params"]], "get_params() (wildboar.tree.extrashapelettreeregressor method)": [[51, "wildboar.tree.ExtraShapeletTreeRegressor.get_params"]], "get_params() (wildboar.tree.intervaltreeclassifier method)": [[51, "wildboar.tree.IntervalTreeClassifier.get_params"]], "get_params() (wildboar.tree.intervaltreeregressor method)": [[51, "wildboar.tree.IntervalTreeRegressor.get_params"]], "get_params() (wildboar.tree.pivottreeclassifier method)": [[51, "wildboar.tree.PivotTreeClassifier.get_params"]], "get_params() (wildboar.tree.proximitytreeclassifier method)": [[51, "wildboar.tree.ProximityTreeClassifier.get_params"]], "get_params() (wildboar.tree.rockettreeclassifier method)": [[51, "wildboar.tree.RocketTreeClassifier.get_params"]], "get_params() (wildboar.tree.rockettreeregressor method)": [[51, "wildboar.tree.RocketTreeRegressor.get_params"]], "get_params() (wildboar.tree.shapelettreeclassifier method)": [[51, "wildboar.tree.ShapeletTreeClassifier.get_params"]], "get_params() (wildboar.tree.shapelettreeregressor method)": [[51, "wildboar.tree.ShapeletTreeRegressor.get_params"]], "predict() (wildboar.tree.extrashapelettreeclassifier method)": [[51, "wildboar.tree.ExtraShapeletTreeClassifier.predict"]], "predict() (wildboar.tree.extrashapelettreeregressor method)": [[51, "wildboar.tree.ExtraShapeletTreeRegressor.predict"]], "predict() (wildboar.tree.intervaltreeclassifier method)": [[51, "wildboar.tree.IntervalTreeClassifier.predict"]], "predict() (wildboar.tree.intervaltreeregressor method)": [[51, "wildboar.tree.IntervalTreeRegressor.predict"]], "predict() (wildboar.tree.pivottreeclassifier method)": [[51, "wildboar.tree.PivotTreeClassifier.predict"]], "predict() (wildboar.tree.proximitytreeclassifier method)": [[51, "wildboar.tree.ProximityTreeClassifier.predict"]], "predict() (wildboar.tree.rockettreeclassifier method)": [[51, "wildboar.tree.RocketTreeClassifier.predict"]], "predict() (wildboar.tree.rockettreeregressor method)": [[51, "wildboar.tree.RocketTreeRegressor.predict"]], "predict() (wildboar.tree.shapelettreeclassifier method)": [[51, "wildboar.tree.ShapeletTreeClassifier.predict"]], "predict() (wildboar.tree.shapelettreeregressor method)": [[51, "wildboar.tree.ShapeletTreeRegressor.predict"]], "predict_proba() (wildboar.tree.extrashapelettreeclassifier method)": [[51, "wildboar.tree.ExtraShapeletTreeClassifier.predict_proba"]], "predict_proba() (wildboar.tree.intervaltreeclassifier method)": [[51, "wildboar.tree.IntervalTreeClassifier.predict_proba"]], "predict_proba() (wildboar.tree.pivottreeclassifier method)": [[51, "wildboar.tree.PivotTreeClassifier.predict_proba"]], "predict_proba() (wildboar.tree.proximitytreeclassifier method)": [[51, "wildboar.tree.ProximityTreeClassifier.predict_proba"]], "predict_proba() (wildboar.tree.rockettreeclassifier method)": [[51, "wildboar.tree.RocketTreeClassifier.predict_proba"]], "predict_proba() (wildboar.tree.shapelettreeclassifier method)": [[51, "wildboar.tree.ShapeletTreeClassifier.predict_proba"]], "score() (wildboar.tree.extrashapelettreeclassifier method)": [[51, "wildboar.tree.ExtraShapeletTreeClassifier.score"]], "score() (wildboar.tree.extrashapelettreeregressor method)": [[51, "wildboar.tree.ExtraShapeletTreeRegressor.score"]], "score() (wildboar.tree.intervaltreeclassifier method)": [[51, "wildboar.tree.IntervalTreeClassifier.score"]], "score() (wildboar.tree.intervaltreeregressor method)": [[51, "wildboar.tree.IntervalTreeRegressor.score"]], "score() (wildboar.tree.pivottreeclassifier method)": [[51, "wildboar.tree.PivotTreeClassifier.score"]], "score() (wildboar.tree.proximitytreeclassifier method)": [[51, "wildboar.tree.ProximityTreeClassifier.score"]], "score() (wildboar.tree.rockettreeclassifier method)": [[51, "wildboar.tree.RocketTreeClassifier.score"]], "score() (wildboar.tree.rockettreeregressor method)": [[51, "wildboar.tree.RocketTreeRegressor.score"]], "score() (wildboar.tree.shapelettreeclassifier method)": [[51, "wildboar.tree.ShapeletTreeClassifier.score"]], "score() (wildboar.tree.shapelettreeregressor method)": [[51, "wildboar.tree.ShapeletTreeRegressor.score"]], "set_params() (wildboar.tree.extrashapelettreeclassifier method)": [[51, "wildboar.tree.ExtraShapeletTreeClassifier.set_params"]], "set_params() (wildboar.tree.extrashapelettreeregressor method)": [[51, "wildboar.tree.ExtraShapeletTreeRegressor.set_params"]], "set_params() (wildboar.tree.intervaltreeclassifier method)": [[51, "wildboar.tree.IntervalTreeClassifier.set_params"]], "set_params() (wildboar.tree.intervaltreeregressor method)": [[51, "wildboar.tree.IntervalTreeRegressor.set_params"]], "set_params() (wildboar.tree.pivottreeclassifier method)": [[51, "wildboar.tree.PivotTreeClassifier.set_params"]], "set_params() (wildboar.tree.proximitytreeclassifier method)": [[51, "wildboar.tree.ProximityTreeClassifier.set_params"]], "set_params() (wildboar.tree.rockettreeclassifier method)": [[51, "wildboar.tree.RocketTreeClassifier.set_params"]], "set_params() (wildboar.tree.rockettreeregressor method)": [[51, "wildboar.tree.RocketTreeRegressor.set_params"]], "set_params() (wildboar.tree.shapelettreeclassifier method)": [[51, "wildboar.tree.ShapeletTreeClassifier.set_params"]], "set_params() (wildboar.tree.shapelettreeregressor method)": [[51, "wildboar.tree.ShapeletTreeRegressor.set_params"]], "wildboar.tree": [[51, "module-wildboar.tree"]], "run_in_parallel() (in module wildboar.utils._parallel)": [[52, "wildboar.utils._parallel.run_in_parallel"]], "wildboar.utils._parallel": [[52, "module-wildboar.utils._parallel"]], "assert_exhaustive_parameter_checks() (in module wildboar.utils._testing)": [[53, "wildboar.utils._testing.assert_exhaustive_parameter_checks"]], "assert_parameter_checks() (in module wildboar.utils._testing)": [[53, "wildboar.utils._testing.assert_parameter_checks"]], "wildboar.utils._testing": [[53, "module-wildboar.utils._testing"]], "array_or_scalar() (in module wildboar.utils.decorators)": [[54, "wildboar.utils.decorators.array_or_scalar"]], "singleton() (in module wildboar.utils.decorators)": [[54, "wildboar.utils.decorators.singleton"]], "unstable() (in module wildboar.utils.decorators)": [[54, "wildboar.utils.decorators.unstable"]], "wildboar.utils.decorators": [[54, "module-wildboar.utils.decorators"]], "check_estimator() (in module wildboar.utils.estimator_checks)": [[55, "wildboar.utils.estimator_checks.check_estimator"]], "wildboar.utils.estimator_checks": [[55, "module-wildboar.utils.estimator_checks"]], "check_x_y() (in module wildboar.utils)": [[56, "wildboar.utils.check_X_y"]], "check_array() (in module wildboar.utils)": [[56, "wildboar.utils.check_array"]], "wildboar.utils": [[56, "module-wildboar.utils"]], "midpointnormalize (class in wildboar.utils.plot)": [[57, "wildboar.utils.plot.MidpointNormalize"]], "autoscale() (wildboar.utils.plot.midpointnormalize method)": [[57, "wildboar.utils.plot.MidpointNormalize.autoscale"]], "autoscale_none() (wildboar.utils.plot.midpointnormalize method)": [[57, "wildboar.utils.plot.MidpointNormalize.autoscale_None"]], "plot_frequency_domain() (in module wildboar.utils.plot)": [[57, "wildboar.utils.plot.plot_frequency_domain"]], "plot_time_domain() (in module wildboar.utils.plot)": [[57, "wildboar.utils.plot.plot_time_domain"]], "process_value() (wildboar.utils.plot.midpointnormalize static method)": [[57, "wildboar.utils.plot.MidpointNormalize.process_value"]], "scaled() (wildboar.utils.plot.midpointnormalize method)": [[57, "wildboar.utils.plot.MidpointNormalize.scaled"]], "wildboar.utils.plot": [[57, "module-wildboar.utils.plot"]], "check_x_y() (in module wildboar.utils.validation)": [[58, "wildboar.utils.validation.check_X_y"]], "check_array() (in module wildboar.utils.validation)": [[58, "wildboar.utils.validation.check_array"]], "check_classification_targets() (in module wildboar.utils.validation)": [[58, "wildboar.utils.validation.check_classification_targets"]], "check_option() (in module wildboar.utils.validation)": [[58, "wildboar.utils.validation.check_option"]], "check_type() (in module wildboar.utils.validation)": [[58, "wildboar.utils.validation.check_type"]], "wildboar.utils.validation": [[58, "module-wildboar.utils.validation"]], "get_variable_length() (in module wildboar.utils.variable_len)": [[59, "wildboar.utils.variable_len.get_variable_length"]], "is_end_of_series() (in module wildboar.utils.variable_len)": [[59, "wildboar.utils.variable_len.is_end_of_series"]], "is_variable_length() (in module wildboar.utils.variable_len)": [[59, "wildboar.utils.variable_len.is_variable_length"]], "wildboar.utils.variable_len": [[59, "module-wildboar.utils.variable_len"]], "wildboar.version": [[60, "module-wildboar.version"]]}}) \ No newline at end of file +Search.setIndex({"docnames": ["api/index", "api/wildboar/annotate/_motifs/index", "api/wildboar/annotate/_segment/index", "api/wildboar/annotate/index", "api/wildboar/base/index", "api/wildboar/datasets/_filter/index", "api/wildboar/datasets/_repository/index", "api/wildboar/datasets/index", "api/wildboar/datasets/outlier/index", "api/wildboar/datasets/preprocess/index", "api/wildboar/distance/_distance/index", "api/wildboar/distance/_matrix_profile/index", "api/wildboar/distance/_multi_metric/index", "api/wildboar/distance/_neighbors/index", "api/wildboar/distance/dtw/index", "api/wildboar/distance/index", "api/wildboar/ensemble/_ensemble/index", "api/wildboar/ensemble/index", "api/wildboar/explain/_importance/index", "api/wildboar/explain/counterfactual/_helper/index", "api/wildboar/explain/counterfactual/_nn/index", "api/wildboar/explain/counterfactual/_proto/index", "api/wildboar/explain/counterfactual/_sf/index", "api/wildboar/explain/counterfactual/index", "api/wildboar/explain/index", "api/wildboar/index", "api/wildboar/linear_model/_hydra/index", "api/wildboar/linear_model/_rocket/index", "api/wildboar/linear_model/_shapelet/index", "api/wildboar/linear_model/_transform/index", "api/wildboar/linear_model/index", "api/wildboar/metrics/_cluster/index", "api/wildboar/metrics/_counterfactual/index", "api/wildboar/metrics/index", "api/wildboar/model_selection/_cv/index", "api/wildboar/model_selection/_outlier/index", "api/wildboar/model_selection/index", "api/wildboar/transform/_base/index", "api/wildboar/transform/_conv/index", "api/wildboar/transform/_diff/index", "api/wildboar/transform/_hydra/index", "api/wildboar/transform/_interval/index", "api/wildboar/transform/_matrix_profile/index", "api/wildboar/transform/_pivot/index", "api/wildboar/transform/_rocket/index", "api/wildboar/transform/_sax/index", "api/wildboar/transform/_shapelet/index", "api/wildboar/transform/index", "api/wildboar/tree/_base/index", "api/wildboar/tree/_ptree/index", "api/wildboar/tree/_tree/index", "api/wildboar/tree/index", "api/wildboar/utils/_parallel/index", "api/wildboar/utils/_testing/index", "api/wildboar/utils/decorators/index", "api/wildboar/utils/estimator_checks/index", "api/wildboar/utils/index", "api/wildboar/utils/plot/index", "api/wildboar/utils/validation/index", "api/wildboar/utils/variable_len/index", "api/wildboar/version/index", "examples", "examples/hydra", "guide", "guide/annotate", "guide/basics", "guide/datasets", "guide/datasets/preprocess", "guide/datasets/repositories", "guide/glossary", "guide/metrics", "guide/metrics/distance", "guide/metrics/elastic", "guide/supervised", "guide/supervised/ensemble", "guide/supervised/transform", "guide/supervised/trees", "guide/unsupervised", "guide/unsupervised/outlier", "guide/unsupervised/outlier/generation", "index", "more/whatsnew", "quickstart", "quickstart/getting-started", "quickstart/install"], "filenames": ["api/index.rst", "api/wildboar/annotate/_motifs/index.rst", "api/wildboar/annotate/_segment/index.rst", "api/wildboar/annotate/index.rst", "api/wildboar/base/index.rst", "api/wildboar/datasets/_filter/index.rst", "api/wildboar/datasets/_repository/index.rst", "api/wildboar/datasets/index.rst", "api/wildboar/datasets/outlier/index.rst", "api/wildboar/datasets/preprocess/index.rst", "api/wildboar/distance/_distance/index.rst", "api/wildboar/distance/_matrix_profile/index.rst", "api/wildboar/distance/_multi_metric/index.rst", "api/wildboar/distance/_neighbors/index.rst", "api/wildboar/distance/dtw/index.rst", "api/wildboar/distance/index.rst", "api/wildboar/ensemble/_ensemble/index.rst", "api/wildboar/ensemble/index.rst", "api/wildboar/explain/_importance/index.rst", "api/wildboar/explain/counterfactual/_helper/index.rst", "api/wildboar/explain/counterfactual/_nn/index.rst", "api/wildboar/explain/counterfactual/_proto/index.rst", "api/wildboar/explain/counterfactual/_sf/index.rst", "api/wildboar/explain/counterfactual/index.rst", "api/wildboar/explain/index.rst", "api/wildboar/index.rst", "api/wildboar/linear_model/_hydra/index.rst", "api/wildboar/linear_model/_rocket/index.rst", "api/wildboar/linear_model/_shapelet/index.rst", "api/wildboar/linear_model/_transform/index.rst", "api/wildboar/linear_model/index.rst", "api/wildboar/metrics/_cluster/index.rst", "api/wildboar/metrics/_counterfactual/index.rst", "api/wildboar/metrics/index.rst", "api/wildboar/model_selection/_cv/index.rst", "api/wildboar/model_selection/_outlier/index.rst", "api/wildboar/model_selection/index.rst", "api/wildboar/transform/_base/index.rst", "api/wildboar/transform/_conv/index.rst", "api/wildboar/transform/_diff/index.rst", "api/wildboar/transform/_hydra/index.rst", "api/wildboar/transform/_interval/index.rst", "api/wildboar/transform/_matrix_profile/index.rst", "api/wildboar/transform/_pivot/index.rst", "api/wildboar/transform/_rocket/index.rst", "api/wildboar/transform/_sax/index.rst", "api/wildboar/transform/_shapelet/index.rst", "api/wildboar/transform/index.rst", "api/wildboar/tree/_base/index.rst", "api/wildboar/tree/_ptree/index.rst", "api/wildboar/tree/_tree/index.rst", "api/wildboar/tree/index.rst", "api/wildboar/utils/_parallel/index.rst", "api/wildboar/utils/_testing/index.rst", "api/wildboar/utils/decorators/index.rst", "api/wildboar/utils/estimator_checks/index.rst", "api/wildboar/utils/index.rst", "api/wildboar/utils/plot/index.rst", "api/wildboar/utils/validation/index.rst", "api/wildboar/utils/variable_len/index.rst", "api/wildboar/version/index.rst", "examples.rst", "examples/hydra.ipynb", "guide.rst", "guide/annotate.rst", "guide/basics.rst", "guide/datasets.rst", "guide/datasets/preprocess.rst", "guide/datasets/repositories.rst", "guide/glossary.rst", "guide/metrics.rst", "guide/metrics/distance.rst", "guide/metrics/elastic.rst", "guide/supervised.rst", "guide/supervised/ensemble.rst", "guide/supervised/transform.rst", "guide/supervised/trees.rst", "guide/unsupervised.rst", "guide/unsupervised/outlier.rst", "guide/unsupervised/outlier/generation.rst", "index.rst", "more/whatsnew.rst", "quickstart.rst", "quickstart/getting-started.rst", "quickstart/install.rst"], "titles": ["wildboar", "wildboar.annotate._motifs", "wildboar.annotate._segment", "wildboar.annotate", "wildboar.base", "wildboar.datasets._filter", "wildboar.datasets._repository", "wildboar.datasets", "wildboar.datasets.outlier", "wildboar.datasets.preprocess", "wildboar.distance._distance", "wildboar.distance._matrix_profile", "wildboar.distance._multi_metric", "wildboar.distance._neighbors", "wildboar.distance.dtw", "wildboar.distance", "wildboar.ensemble._ensemble", "wildboar.ensemble", "wildboar.explain._importance", "wildboar.explain.counterfactual._helper", "wildboar.explain.counterfactual._nn", "wildboar.explain.counterfactual._proto", "wildboar.explain.counterfactual._sf", "wildboar.explain.counterfactual", "wildboar.explain", "wildboar", "wildboar.linear_model._hydra", "wildboar.linear_model._rocket", "wildboar.linear_model._shapelet", "wildboar.linear_model._transform", "wildboar.linear_model", "wildboar.metrics._cluster", "wildboar.metrics._counterfactual", "wildboar.metrics", "wildboar.model_selection._cv", "wildboar.model_selection._outlier", "wildboar.model_selection", "wildboar.transform._base", "wildboar.transform._conv", "wildboar.transform._diff", "wildboar.transform._hydra", "wildboar.transform._interval", "wildboar.transform._matrix_profile", "wildboar.transform._pivot", "wildboar.transform._rocket", "wildboar.transform._sax", "wildboar.transform._shapelet", "wildboar.transform", "wildboar.tree._base", "wildboar.tree._ptree", "wildboar.tree._tree", "wildboar.tree", "wildboar.utils._parallel", "wildboar.utils._testing", "wildboar.utils.decorators", "wildboar.utils.estimator_checks", "wildboar.utils", "wildboar.utils.plot", "wildboar.utils.validation", "wildboar.utils.variable_len", "wildboar.version", "Examples", "Convolution transforms", "User guide", "Annotate", "Time series", "Datasets", "Pre-processing", "Repositories", "Glossary", "Metrics", "Distance", "Elastic metrics", "Supervised learning", "Ensemble estimators", "Transform-based estimators", "Tree-based estimators", "Unsupervised learning", "Outlier detection", "Outlier detection benchmarks", "Wildboar", "What\u2019s new", "Quickstart", "Getting started", "Install wildboar"], "terms": {"librari": [0, 25, 80], "tempor": [0, 22, 23, 25, 65, 80, 83], "machin": [0, 25, 70, 80], "learn": [0, 14, 25, 29, 39, 40, 47, 48, 50, 55, 56, 58, 62, 69, 80, 81], "includ": [0, 1, 3, 8, 11, 15, 23, 25, 56, 58, 71, 76, 80, 81, 83], "numer": [0, 23, 25, 56, 58, 80, 83], "algorithm": [0, 8, 13, 14, 15, 22, 23, 25, 62, 65, 67, 70, 80, 81], "seamlessli": [0, 25, 80, 83], "integr": [0, 25, 68, 71, 80], "them": [0, 8, 25, 57, 65, 67, 68, 80], "scikit": [0, 25, 29, 39, 40, 47, 48, 50, 55, 56, 58, 62, 69, 80, 81, 83], "iseo": [0, 25, 65, 67, 80], "boolean": [0, 14, 25, 59, 80], "indic": [0, 7, 10, 14, 15, 16, 17, 19, 23, 25, 32, 33, 48, 49, 50, 51, 59, 69, 80], "valu": [0, 4, 6, 7, 8, 9, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 62, 65, 66, 67, 68, 69, 71, 74, 80, 81, 83], "i": [0, 1, 2, 3, 4, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 54, 55, 56, 57, 58, 59, 62, 65, 66, 67, 68, 69, 70, 71, 73, 74, 79, 80, 81, 83, 84], "end": [0, 18, 24, 25, 48, 49, 50, 51, 56, 58, 65, 67, 69, 80], "sequenc": [0, 9, 25, 56, 57, 58, 65, 67, 70, 80], "time": [0, 1, 2, 3, 4, 9, 10, 11, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 30, 31, 32, 33, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 55, 56, 57, 58, 59, 62, 66, 67, 68, 69, 70, 71, 73, 74, 75, 79, 80], "seri": [0, 1, 2, 3, 4, 9, 10, 11, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 30, 31, 32, 33, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 55, 56, 58, 59, 62, 66, 67, 68, 69, 70, 71, 73, 74, 75, 79, 80], "see": [0, 3, 7, 8, 10, 13, 15, 19, 23, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 62, 71, 80, 81], "section": [0, 3, 7, 18, 24, 80], "user": [0, 3, 4, 7, 8, 10, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 68, 71, 79, 80, 83, 84], "guid": [0, 3, 4, 7, 8, 10, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 80], "more": [0, 3, 7, 8, 10, 13, 15, 16, 17, 18, 23, 24, 31, 32, 33, 43, 46, 47, 49, 50, 51, 56, 58, 62, 68, 70, 71, 79, 80, 81, 83], "detail": [0, 3, 7, 8, 15, 39, 47, 71, 80, 81], "exampl": [0, 3, 7, 8, 13, 14, 15, 16, 17, 19, 21, 23, 35, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 57, 59, 62, 65, 66, 67, 68, 71, 80], "motif": [0, 1, 3, 11, 15, 80], "find": [0, 1, 2, 3, 10, 15, 66, 80, 81, 84], "segment": [0, 2, 3, 80], "chang": [0, 2, 3, 7, 14, 16, 17, 19, 22, 23, 32, 33, 50, 51, 65, 66, 68, 71, 80], "regim": [0, 2, 3, 80], "all": [0, 1, 3, 4, 6, 7, 8, 10, 11, 13, 15, 16, 17, 18, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 39, 40, 44, 46, 47, 48, 50, 51, 53, 55, 56, 57, 58, 66, 67, 68, 70, 71, 80, 81, 83, 84], "estim": [0, 4, 8, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 53, 55, 56, 58, 63, 66, 69, 71, 73, 79, 80, 81, 83], "baseestim": [0, 4, 39, 47, 53, 80], "counterfactualmixin": [0, 4, 80], "mixin": [0, 4, 16, 29, 39, 41, 43, 44, 46, 47, 48, 50, 80], "explainermixin": [0, 4, 80], "is_counterfactu": [0, 4, 21, 80], "check": [0, 4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 53, 55, 56, 58, 67, 69, 80], "is_explain": [0, 4, 80], "an": [0, 4, 8, 10, 13, 15, 16, 17, 21, 26, 30, 32, 33, 34, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 54, 56, 58, 65, 66, 68, 69, 71, 73, 74, 79, 80, 81, 84], "load": [0, 6, 7, 62, 68, 80], "from": [0, 1, 3, 6, 7, 8, 14, 16, 17, 19, 21, 22, 23, 26, 27, 28, 29, 30, 32, 33, 35, 36, 40, 41, 42, 44, 45, 46, 47, 48, 49, 50, 51, 54, 57, 59, 62, 66, 67, 68, 70, 71, 79, 80, 81, 83], "import": [0, 7, 14, 16, 17, 18, 24, 35, 36, 40, 41, 42, 44, 46, 47, 48, 49, 50, 51, 57, 59, 62, 65, 66, 67, 68, 71, 79, 80, 83], "load_dataset": [0, 7, 41, 47, 49, 51, 62, 66, 67, 68, 71, 80, 83], "x": [0, 1, 2, 3, 4, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 59, 62, 65, 66, 67, 68, 70, 71, 79, 80, 83], "y": [0, 4, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 34, 35, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 62, 66, 67, 68, 70, 71, 79, 80, 83], "gunpoint": [0, 7, 41, 47, 49, 51, 66, 67, 68, 80], "shape": [0, 1, 2, 3, 4, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 57, 65, 66, 67, 69, 70, 71, 80, 83], "200": [0, 7, 66, 80], "60": [0, 7, 66, 71, 80], "bundl": [0, 6, 7, 66, 68, 79, 80], "handl": [0, 6, 7, 66, 80], "jsonrepositori": [0, 6, 7, 68, 80], "A": [0, 4, 5, 6, 7, 8, 10, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 57, 65, 66, 67, 68, 69, 70, 71, 79, 80, 83], "repositori": [0, 6, 7, 66, 80, 83], "collect": [0, 6, 7, 19, 23, 41, 47, 68, 73, 79, 80, 83, 84], "npbundl": [0, 6, 7, 80], "numpi": [0, 6, 7, 16, 17, 18, 24, 26, 30, 37, 40, 41, 44, 47, 50, 51, 65, 67, 68, 69, 71, 80, 81, 83, 84], "binari": [0, 6, 7, 8, 16, 17, 58, 79, 80, 84], "file": [0, 6, 7, 68, 80, 84], "clear_cach": [0, 7, 80], "clear": [0, 7, 80], "cach": [0, 6, 7, 66, 80], "delet": [0, 7, 80], "get_bundl": [0, 6, 7, 80], "get": [0, 4, 6, 7, 9, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 67, 80], "get_repositori": [0, 7, 80], "name": [0, 4, 6, 7, 9, 10, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 58, 66, 67, 68, 70, 71, 80, 83], "install_repositori": [0, 7, 68, 80], "instal": [0, 7, 66, 79, 80], "list_bundl": [0, 7, 68, 80], "list": [0, 1, 3, 5, 6, 7, 10, 15, 16, 17, 18, 19, 23, 24, 27, 28, 29, 30, 32, 33, 41, 43, 46, 47, 48, 49, 50, 51, 53, 54, 55, 56, 58, 66, 68, 71, 79, 80, 81], "specifi": [0, 6, 7, 16, 17, 18, 24, 32, 33, 43, 46, 47, 50, 51, 57, 66, 67, 68, 70, 71, 79, 80, 83, 84], "list_collect": [0, 7, 80], "list_dataset": [0, 7, 68, 80], "list_repositori": [0, 7, 68, 80], "kei": [0, 6, 7, 10, 15, 16, 17, 19, 23, 32, 33, 41, 43, 46, 47, 49, 50, 51, 58, 68, 80], "gener": [0, 7, 8, 13, 14, 15, 16, 17, 18, 19, 20, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 40, 41, 44, 46, 47, 48, 49, 50, 51, 55, 66, 79, 80, 83], "load_gun_point": [0, 7, 40, 41, 44, 47, 48, 49, 50, 51, 57, 66, 80], "load_synthetic_control": [0, 7, 16, 17, 80, 83], "synthetic_control": [0, 7, 80, 83], "load_two_lead_ecg": [0, 7, 14, 16, 17, 35, 36, 42, 47, 71, 80, 83], "twoleadecg": [0, 7, 66, 68, 71, 80, 83], "refresh_repositori": [0, 7, 68, 80], "refresh": [0, 6, 7, 68, 80], "set_cache_dir": [0, 7, 68, 80], "global": [0, 7, 20, 22, 23, 32, 33, 41, 47, 68, 80], "directori": [0, 7, 68, 80, 84], "synthet": [0, 8, 79, 80], "us": [0, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 35, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 54, 56, 57, 58, 62, 66, 67, 68, 69, 70, 71, 75, 79, 80, 81, 83, 84], "density_outli": [0, 8, 80], "densitii": [0, 8, 80], "emmott_outli": [0, 8, 79, 80], "difficulti": [0, 8, 79, 80], "kmeans_outli": [0, 8, 80], "k": [0, 8, 13, 15, 16, 17, 18, 20, 23, 24, 49, 51, 74, 79, 80, 81], "mean": [0, 7, 8, 9, 10, 13, 14, 15, 16, 17, 20, 22, 23, 26, 27, 28, 29, 30, 31, 32, 33, 37, 40, 41, 44, 46, 47, 48, 49, 50, 51, 67, 70, 71, 80, 81, 83], "majority_outli": [0, 8, 80], "label": [0, 4, 6, 7, 8, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 42, 47, 48, 49, 50, 51, 56, 57, 58, 66, 68, 73, 78, 80, 83], "major": [0, 8, 14, 68, 78, 80], "inlier": [0, 8, 16, 17, 34, 36, 79, 80], "minority_outli": [0, 8, 79, 80], "fraction": [0, 1, 2, 3, 8, 11, 14, 15, 16, 17, 18, 22, 23, 24, 32, 33, 34, 36, 42, 47, 48, 49, 50, 51, 79, 80], "minor": [0, 8, 68, 78, 80, 81], "maxabs_scal": [0, 9, 67, 80], "scale": [0, 8, 9, 16, 17, 26, 30, 40, 44, 45, 47, 57, 62, 67, 70, 79, 80], "each": [0, 2, 3, 4, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 59, 62, 65, 67, 68, 69, 70, 71, 80, 83], "its": [0, 9, 11, 15, 41, 42, 47, 56, 57, 58, 66, 80, 84], "maximum": [0, 1, 3, 9, 13, 14, 15, 16, 17, 18, 24, 34, 36, 41, 44, 46, 47, 49, 50, 51, 57, 62, 67, 69, 71, 80], "absolut": [0, 9, 32, 33, 67, 80], "minmax_scal": [0, 9, 45, 47, 66, 67, 80], "along": [0, 9, 18, 24, 26, 30, 67, 80], "dimens": [0, 9, 14, 26, 30, 32, 33, 42, 47, 56, 58, 65, 66, 67, 69, 71, 80, 81, 83], "named_preprocess": [0, 9, 80], "preprocessor": [0, 9, 67, 80], "standard": [0, 9, 16, 17, 21, 26, 30, 40, 41, 47, 62, 67, 80, 83], "truncat": [0, 9, 67, 80], "shortest": [0, 9, 67, 80], "fast": [0, 13, 15, 26, 30, 40, 44, 46, 47, 70, 80], "comput": [0, 1, 2, 3, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 31, 32, 33, 42, 43, 47, 48, 49, 50, 51, 62, 70, 71, 75, 80, 81], "The": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 53, 54, 55, 56, 57, 58, 59, 62, 63, 65, 66, 67, 68, 69, 70, 71, 79, 80, 81, 83, 84], "modul": [0, 15, 23, 66, 67, 79, 80, 81, 83], "pair": [0, 1, 3, 7, 11, 15, 16, 17, 32, 33, 43, 46, 47, 49, 50, 51, 58, 80], "pairwis": [0, 15, 80], "between": [0, 1, 3, 9, 10, 13, 14, 15, 19, 22, 23, 31, 32, 33, 38, 46, 47, 67, 70, 71, 79, 80, 83], "subsequ": [0, 1, 3, 10, 11, 15, 16, 17, 42, 44, 47, 62, 80, 81], "kmean": [0, 13, 15, 80, 81], "cluster": [0, 8, 13, 15, 79, 80, 81], "support": [0, 8, 10, 13, 15, 16, 17, 22, 23, 32, 33, 41, 44, 50, 51, 65, 66, 67, 68, 70, 79, 80, 81, 83], "weight": [0, 13, 14, 15, 16, 17, 26, 27, 28, 29, 30, 32, 33, 40, 43, 47, 48, 49, 50, 51, 70, 80], "kmedoid": [0, 13, 15, 80, 81], "kneighborsclassifi": [0, 13, 15, 80, 81], "classifi": [0, 8, 13, 15, 16, 17, 20, 22, 23, 24, 27, 28, 29, 30, 40, 47, 49, 50, 51, 55, 62, 74, 80, 81, 83], "implement": [0, 13, 14, 15, 16, 17, 18, 22, 23, 24, 27, 30, 32, 33, 40, 41, 44, 47, 62, 67, 68, 70, 71, 74, 79, 80, 81, 83], "nearest": [0, 11, 13, 15, 20, 21, 23, 80], "neighbor": [0, 11, 13, 15, 20, 21, 23, 80, 81], "matrix_profil": [0, 1, 2, 3, 11, 15, 80], "matrix": [0, 1, 2, 3, 11, 14, 15, 16, 17, 19, 21, 23, 27, 28, 29, 30, 42, 47, 48, 49, 50, 51, 71, 80, 83], "profil": [0, 1, 2, 3, 11, 15, 42, 47, 80], "paired_dist": [0, 10, 15, 71, 80, 81], "th": [0, 10, 15, 16, 17, 32, 33, 80], "paired_subsequence_dist": [0, 10, 15, 71, 80], "minimum": [0, 1, 3, 6, 7, 9, 10, 14, 15, 16, 17, 18, 24, 41, 44, 46, 47, 49, 50, 51, 56, 58, 68, 70, 71, 80], "paired_subsequence_match": [0, 10, 15, 80], "match": [0, 1, 3, 10, 11, 15, 21, 68, 70, 71, 80, 81], "subsequnc": [0, 10, 15, 80], "pairwise_dist": [0, 10, 15, 70, 71, 80, 81], "pairwise_subsequence_dist": [0, 10, 15, 70, 71, 80], "subsequence_match": [0, 1, 3, 10, 15, 71, 80], "align": [0, 14, 18, 21, 24, 32, 33, 80], "sever": [0, 14, 48, 49, 50, 51, 70, 80, 81, 83], "ddtw_distanc": [0, 14, 80], "deriv": [0, 14, 16, 32, 33, 70, 80], "dynam": [0, 14, 16, 17, 49, 50, 51, 70, 71, 80], "warp": [0, 13, 14, 15, 49, 51, 70, 71, 80], "dtw_align": [0, 14, 80], "dtw_averag": [0, 14, 80], "barycent": [0, 13, 14, 15, 80], "averag": [0, 14, 16, 17, 32, 33, 62, 80], "dba": [0, 14, 80], "dtw_distanc": [0, 14, 80], "dtw_envelop": [0, 14, 80], "envelop": [0, 14, 80], "lb_keogh": [0, 14, 80], "dtw_lb_keogh": [0, 14, 80], "lower": [0, 8, 10, 14, 15, 16, 17, 32, 33, 43, 44, 46, 47, 49, 50, 51, 57, 71, 80], "bound": [0, 14, 16, 17, 34, 36, 43, 46, 47, 49, 50, 51, 71, 80], "dtw_map": [0, 14, 80], "optim": [0, 14, 71, 80, 81, 84], "path": [0, 14, 22, 23, 48, 49, 50, 51, 68, 80, 84], "two": [0, 13, 14, 15, 16, 17, 26, 30, 40, 41, 43, 46, 47, 49, 50, 51, 57, 62, 68, 70, 71, 76, 80, 81, 83], "given": [0, 2, 3, 8, 10, 11, 13, 14, 15, 16, 17, 18, 24, 26, 27, 28, 29, 30, 38, 45, 47, 48, 49, 50, 51, 69, 73, 80], "jeong_weight": [0, 14, 80], "describ": [0, 8, 14, 22, 23, 40, 47, 62, 66, 68, 71, 80, 81], "jeong": [0, 14, 80], "et": [0, 1, 2, 3, 8, 11, 14, 15, 16, 17, 40, 47, 49, 51, 62, 79, 80, 81], "al": [0, 1, 2, 3, 8, 11, 14, 15, 16, 17, 40, 47, 49, 51, 62, 79, 80, 81], "2011": [0, 14, 80], "r4bf7d056babf": [0, 14, 80], "1": [0, 1, 2, 3, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 56, 57, 58, 59, 62, 65, 66, 67, 68, 69, 70, 71, 79, 80, 83, 84], "_": [0, 14, 80], "wddtw_distanc": [0, 14, 80], "wdtw_align": [0, 14, 80], "wdtw_distanc": [0, 14, 80], "method": [0, 4, 8, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 55, 62, 63, 74, 80, 81, 83], "classif": [0, 8, 13, 14, 15, 16, 17, 26, 27, 28, 29, 30, 32, 33, 35, 36, 40, 44, 46, 47, 48, 49, 50, 51, 58, 76, 79, 80, 83], "regress": [0, 8, 16, 17, 29, 30, 48, 49, 50, 51, 75, 79, 80, 83], "detect": [0, 8, 17, 71, 80], "baggingclassifi": [0, 16, 17, 80, 81], "bag": [0, 16, 17, 80], "baggingregressor": [0, 16, 17, 80, 81], "regressor": [0, 16, 17, 24, 27, 28, 29, 30, 48, 50, 51, 55, 74, 80], "basebag": [0, 16, 17, 80], "extrashapelettreesclassifi": [0, 16, 17, 80], "extrem": [0, 16, 17, 80], "random": [0, 8, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 33, 34, 35, 36, 37, 40, 41, 43, 44, 46, 47, 49, 50, 51, 62, 74, 75, 80, 83], "shapelet": [0, 1, 3, 10, 11, 15, 16, 17, 18, 21, 22, 23, 24, 28, 30, 44, 46, 47, 50, 51, 76, 80, 83], "extrashapelettreesregressor": [0, 16, 17, 80, 81], "intervalforestclassifi": [0, 16, 17, 80], "interv": [0, 8, 16, 17, 18, 24, 32, 33, 41, 45, 47, 50, 51, 79, 80, 83], "intervalforestregressor": [0, 16, 17, 80], "isolationshapeletforest": [0, 16, 17, 80], "isol": [0, 16, 17, 80, 84], "forest": [0, 8, 16, 17, 22, 23, 49, 51, 80, 83], "pivotforestclassifi": [0, 16, 17, 80], "proximityforestclassifi": [0, 16, 17, 74, 80], "proxim": [0, 16, 17, 19, 23, 32, 33, 49, 51, 80], "rocketforestclassifi": [0, 16, 17, 80, 81], "rocket": [0, 16, 17, 27, 30, 44, 47, 80, 83], "rocketforestregressor": [0, 16, 17, 80, 81], "shapeletforestclassifi": [0, 16, 17, 62, 74, 80, 81, 83], "shapeletforestembed": [0, 16, 17, 80], "shapeletforestregressor": [0, 16, 17, 74, 80, 81], "explan": [0, 4, 18, 19, 20, 21, 22, 23, 24, 32, 33, 80], "amplitudeimport": [0, 18, 24, 80], "equi": [0, 18, 24, 80], "probabl": [0, 4, 8, 13, 15, 16, 17, 18, 21, 24, 43, 44, 47, 48, 49, 50, 51, 80], "amplitud": [0, 18, 24, 57, 80], "intervalimport": [0, 18, 24, 80, 83], "shapeletimport": [0, 18, 24, 80], "plot_import": [0, 18, 24, 80], "plot": [0, 4, 18, 20, 21, 22, 23, 24, 67, 80, 83], "boxplot": [0, 18, 24, 80], "kneighborscounterfactu": [0, 20, 23, 80, 81], "fit": [0, 4, 8, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 62, 66, 75, 80, 81, 83], "prototypecounterfactu": [0, 21, 23, 80], "model": [0, 8, 16, 17, 21, 23, 26, 27, 28, 29, 30, 36, 48, 50, 51, 75, 79, 80], "agnost": [0, 2, 3, 21, 23, 80], "approach": [0, 21, 23, 26, 30, 40, 47, 66, 79, 80, 83, 84], "construct": [0, 8, 21, 23, 32, 33, 45, 47, 50, 51, 56, 58, 62, 74, 79, 80], "shapeletforestcounterfactu": [0, 22, 23, 80], "singl": [0, 13, 15, 16, 17, 19, 23, 26, 30, 32, 33, 37, 40, 44, 47, 48, 49, 50, 51, 54, 62, 65, 68, 69, 71, 80, 81], "sampl": [0, 4, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 39, 40, 41, 42, 43, 44, 45, 47, 48, 49, 50, 51, 56, 57, 58, 65, 66, 67, 68, 69, 71, 76, 79, 80, 81, 83], "linear": [0, 30, 80], "both": [0, 8, 10, 11, 14, 15, 30, 38, 47, 56, 58, 62, 65, 67, 68, 70, 71, 76, 79, 80], "hydraclassifi": [0, 26, 30, 40, 47, 75, 80, 81], "dictionari": [0, 6, 7, 16, 17, 21, 22, 23, 26, 30, 40, 43, 46, 47, 49, 50, 51, 58, 68, 80, 81], "convolut": [0, 16, 17, 26, 30, 38, 40, 44, 47, 50, 51, 75, 80, 81], "kernel": [0, 8, 16, 17, 26, 27, 28, 29, 30, 38, 40, 44, 47, 48, 50, 51, 62, 75, 79, 80], "randomshapeletclassifi": [0, 28, 30, 80], "randomshapeletregressor": [0, 28, 30, 80], "rocketclassifi": [0, 27, 30, 75, 80, 81], "rocketregressor": [0, 27, 30, 75, 80, 81], "evalu": [0, 16, 17, 21, 22, 23, 32, 33, 50, 51, 55, 62, 66, 80, 83], "compactness_scor": [0, 32, 33, 80], "compact": [0, 32, 33, 80], "score": [0, 4, 8, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 48, 49, 50, 51, 62, 79, 80, 83], "plausability_scor": [0, 32, 33, 80], "plausibl": [0, 32, 33, 80], "proximity_scor": [0, 32, 33, 80], "redudancy_scor": [0, 32, 33, 80], "redud": [0, 32, 33, 80], "relative_proximity_scor": [0, 32, 33, 80], "rel": [0, 13, 15, 32, 33, 71, 80], "silhouette_sampl": [0, 31, 33, 80], "silhouett": [0, 31, 33, 80], "coeffici": [0, 16, 17, 27, 28, 29, 30, 31, 33, 48, 50, 51, 80], "silhouette_scor": [0, 31, 33, 80], "validity_scor": [0, 32, 33, 80], "valid": [0, 7, 19, 23, 26, 30, 32, 33, 34, 36, 48, 49, 50, 51, 56, 65, 66, 68, 80, 81], "select": [0, 8, 10, 13, 15, 19, 23, 31, 33, 36, 41, 46, 47, 66, 67, 79, 80, 81, 83, 84], "repeatedoutliersplit": [0, 34, 36, 80], "repeat": [0, 18, 24, 34, 36, 80], "cross": [0, 26, 30, 34, 36, 80], "outlier_train_test_split": [0, 16, 17, 35, 36, 80], "train": [0, 6, 7, 13, 15, 16, 17, 32, 33, 34, 35, 36, 44, 47, 48, 49, 50, 51, 66, 67, 68, 80, 83], "test": [0, 7, 13, 15, 16, 17, 26, 27, 28, 29, 30, 32, 33, 34, 35, 36, 48, 49, 50, 51, 53, 55, 59, 66, 67, 68, 71, 74, 80, 83], "split": [0, 7, 16, 17, 26, 30, 34, 35, 36, 48, 49, 50, 51, 62, 68, 70, 80, 83], "raw": [0, 47, 80], "tabular": [0, 47, 80], "represent": [0, 16, 17, 47, 50, 51, 62, 75, 79, 80, 83], "difftransform": [0, 39, 40, 47, 62, 80], "featuretransform": [0, 41, 47, 80], "number": [0, 1, 2, 3, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 56, 57, 58, 62, 66, 69, 71, 80, 83], "featur": [0, 16, 17, 27, 28, 29, 30, 37, 41, 44, 47, 48, 50, 51, 54, 62, 66, 67, 75, 80, 81, 84], "hydratransform": [0, 40, 47, 62, 80, 81], "intervaltransform": [0, 8, 41, 47, 79, 80, 81], "emb": [0, 41, 47, 80], "per": [0, 8, 18, 22, 23, 24, 26, 30, 40, 41, 43, 47, 80], "matrixprofiletransform": [0, 42, 47, 80], "paa": [0, 45, 47, 80], "peicewis": [0, 45, 47, 80], "aggreg": [0, 22, 23, 45, 47, 80], "approxim": [0, 8, 45, 47, 80], "pivottransform": [0, 43, 47, 80, 81], "pivot": [0, 8, 16, 17, 43, 47, 49, 50, 51, 74, 80], "proximitytransform": [0, 43, 47, 80], "condit": [0, 43, 47, 80], "randomshapelettransform": [0, 46, 47, 80, 81], "tranform": [0, 46, 47, 80], "rockettransform": [0, 44, 47, 62, 80, 81, 83], "sax": [0, 18, 24, 32, 33, 45, 47, 80], "symbol": [0, 45, 47, 80], "convolv": [0, 26, 30, 38, 47, 80], "appli": [0, 7, 8, 38, 47, 48, 49, 50, 51, 62, 66, 80], "1d": [0, 38, 47, 56, 58, 69, 71, 80], "over": [0, 16, 17, 18, 24, 32, 33, 38, 43, 46, 47, 49, 50, 51, 70, 80, 81, 83], "piecewice_aggregate_approxim": [0, 45, 47, 80], "symbolic_aggregate_approxim": [0, 45, 47, 80], "extrashapelettreeclassifi": [0, 50, 51, 76, 80], "extra": [0, 4, 6, 7, 18, 20, 21, 22, 23, 24, 50, 51, 68, 71, 80], "extrashapelettreeregressor": [0, 50, 51, 76, 80, 81], "intervaltreeclassifi": [0, 50, 51, 80], "intervaltreeregressor": [0, 50, 51, 80], "pivottreeclassifi": [0, 50, 51, 80], "proximitytreeclassifi": [0, 49, 51, 80, 81], "branch": [0, 49, 51, 74, 80], "rockettreeclassifi": [0, 50, 51, 80, 81], "rockettreeregressor": [0, 50, 51, 80, 81], "shapelettreeclassifi": [0, 48, 49, 50, 51, 76, 80, 81], "shapelettreeregressor": [0, 16, 17, 50, 51, 76, 80, 81], "check_arrai": [0, 56, 58, 80], "input": [0, 4, 8, 10, 11, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 27, 28, 29, 30, 31, 33, 35, 36, 38, 39, 42, 43, 45, 47, 48, 49, 50, 51, 56, 57, 58, 59, 62, 69, 71, 80, 83], "check_x_i": [0, 56, 58, 80], "mp": [1, 3, 11, 15], "none": [1, 2, 3, 4, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 53, 54, 55, 56, 57, 58, 68, 71], "window": [1, 2, 3, 11, 13, 14, 15, 18, 24, 32, 33, 42, 45, 47, 68, 70, 84], "auto": [1, 3, 13, 15, 16, 17, 20, 21, 23, 43, 47, 49, 51], "exclud": [1, 2, 3, 10, 11, 15, 42, 47], "0": [1, 2, 3, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 26, 27, 28, 29, 30, 34, 35, 36, 38, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 62, 65, 66, 67, 68, 70, 71, 79, 83, 84], "2": [1, 2, 3, 8, 11, 14, 15, 16, 17, 18, 19, 20, 23, 24, 27, 28, 29, 30, 34, 35, 36, 38, 41, 42, 44, 47, 48, 49, 50, 51, 56, 58, 59, 62, 65, 66, 68, 69, 70, 71, 83], "max_dist": [1, 3], "best": [1, 3, 10, 15, 16, 17, 19, 21, 23, 27, 28, 29, 30, 46, 47, 48, 50, 51, 71], "max_neighbour": [1, 3], "10": [1, 3, 10, 15, 16, 17, 18, 24, 26, 27, 28, 29, 30, 41, 43, 44, 46, 47, 49, 50, 51, 57, 62, 71, 84], "min_neighbour": [1, 3], "max_motif": [1, 3], "return_dist": [1, 3, 10, 15], "fals": [1, 2, 3, 7, 10, 11, 14, 15, 16, 17, 18, 21, 22, 23, 24, 28, 30, 32, 33, 45, 47, 55, 56, 57, 58, 65, 66, 68, 83], "sourc": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 83], "paramet": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 62, 66, 67, 68, 70, 71, 79, 81, 83], "arrai": [1, 2, 3, 4, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 54, 56, 57, 58, 59, 65, 67, 68, 69, 71, 83], "like": [1, 2, 3, 4, 8, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 69], "n_sampl": [1, 2, 3, 4, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 65, 66, 67, 69, 71, 81, 83], "n_timestep": [1, 2, 3, 4, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 32, 33, 35, 36, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 65, 66, 67, 69, 71, 83], "ndarrai": [1, 2, 3, 4, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 54, 56, 58, 59, 67, 83], "profile_s": [1, 2, 3, 11, 15], "option": [1, 2, 3, 4, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 66, 68, 71, 79, 83, 84], "int": [1, 2, 3, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 30, 31, 32, 33, 34, 35, 36, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 49, 50, 51, 52, 56, 57, 58, 66, 71, 79], "float": [1, 2, 3, 4, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 38, 41, 42, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 59, 65, 66, 70], "size": [1, 2, 3, 9, 10, 11, 13, 14, 15, 16, 17, 18, 22, 23, 24, 26, 30, 31, 32, 33, 34, 35, 36, 40, 41, 42, 44, 45, 46, 47, 66, 83], "math": [1, 3, 10, 15, 71], "ceil": [1, 3, 10, 15, 50, 51], "exact": [1, 2, 3, 10, 11, 13, 14, 15, 16, 17, 18, 24, 26, 30, 37, 40, 42, 44, 47], "exclus": [1, 2, 3, 10, 11, 15, 42, 47], "zone": [1, 3, 10, 11, 15, 42, 47], "str": [1, 3, 5, 6, 7, 8, 9, 10, 13, 15, 16, 17, 18, 19, 23, 24, 26, 30, 31, 32, 33, 41, 43, 45, 46, 47, 49, 50, 51, 54, 56, 57, 58, 66], "distanc": [1, 2, 3, 8, 16, 17, 18, 22, 23, 24, 25, 31, 32, 33, 43, 46, 47, 49, 50, 51, 70, 74, 76, 81], "neighbour": [1, 3], "return": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 54, 55, 56, 57, 58, 59, 66, 67, 68, 69, 71, 79, 81, 83], "bool": [1, 2, 3, 4, 7, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 34, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 53, 54, 55, 56, 57, 58, 59], "main": [1, 3, 66, 83], "motif_indici": [1, 3], "indici": [1, 3, 10, 15, 34, 36], "motif_dist": [1, 3], "refer": [1, 2, 3, 8, 11, 14, 15, 16, 17, 20, 21, 22, 23, 26, 30, 32, 33, 40, 41, 44, 46, 47, 49, 51, 71, 80], "yeh": [1, 3, 11, 15], "c": [1, 3, 11, 15, 16, 17, 56, 58, 70, 83, 84], "m": [1, 3, 11, 14, 15, 32, 33, 70, 71, 84], "2016": [1, 3, 11, 15], "similar": [1, 3, 11, 15, 19, 23, 42, 47, 67, 70, 71, 75, 83], "join": [1, 2, 3, 11, 15, 42, 47], "unifi": [1, 3, 11, 15], "view": [1, 3, 11, 15], "discord": [1, 3, 11, 15], "In": [1, 2, 3, 8, 11, 13, 14, 15, 16, 17, 22, 23, 26, 27, 28, 29, 30, 41, 47, 48, 49, 50, 51, 62, 65, 66, 67, 68, 70, 71, 73, 79, 81, 83], "ieee": [1, 3, 11, 15, 22, 23, 70], "16th": [1, 3, 11, 15], "intern": [1, 2, 3, 11, 14, 15, 16, 17, 22, 23, 50, 51, 70, 71], "confer": [1, 2, 3, 11, 14, 15, 22, 23, 70, 71], "data": [1, 2, 3, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 22, 23, 26, 27, 28, 29, 30, 31, 33, 35, 36, 39, 40, 41, 42, 43, 44, 45, 47, 48, 49, 50, 51, 56, 58, 66, 67, 68, 70, 71, 79], "mine": [1, 2, 3, 11, 15, 16, 17, 22, 23, 26, 30, 40, 41, 44, 47, 49, 51, 71], "icdm": [1, 3, 11, 15, 22, 23], "mpi": [2, 3, 11, 15], "n_segment": [2, 3], "boundri": [2, 3], "return_arc_curv": [2, 3], "If": [2, 3, 4, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 66, 68, 71, 79, 84], "index": [2, 3, 10, 11, 13, 14, 15, 16, 17, 18, 21, 24, 48, 49, 50, 51, 65, 69, 71], "must": [2, 3, 8, 14, 18, 24, 32, 33, 41, 44, 68, 70, 79, 84], "unless": [2, 3, 16, 17, 43, 46, 47, 48, 49, 50, 51, 56, 58, 68, 70], "identifi": [2, 3, 16, 17, 46, 47, 50, 51, 56, 58, 65, 68, 71, 83], "ignor": [2, 3, 10, 13, 14, 15, 16, 17, 18, 24, 32, 33, 34, 36, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 55, 65], "self": [2, 3, 4, 11, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 66], "region": [2, 3, 83], "around": [2, 3, 13, 15, 31, 33], "express": [2, 3, 8, 11, 15, 16, 17, 32, 33, 42, 47, 50, 51, 66, 68], "arc": [2, 3], "curv": [2, 3], "start": [2, 3, 10, 15, 18, 24], "arc_curv": [2, 3], "gharghabi": [2, 3], "shaghayegh": [2, 3], "2017": [2, 3], "viii": [2, 3], "domain": [2, 3, 57], "onlin": [2, 3], "semant": [2, 3], "superhuman": [2, 3], "perform": [2, 3, 13, 15, 16, 17, 32, 33, 41, 44, 47, 55, 56, 58, 62, 66, 67, 71, 75], "level": [2, 3], "proceed": [2, 3, 8, 70, 71, 79], "get_metadata_rout": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "metadata": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "rout": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "thi": [4, 6, 7, 8, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 55, 56, 58, 62, 66, 67, 71, 75, 80, 81, 83, 84], "object": [4, 8, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 34, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 55, 56, 57, 58, 66, 70, 71, 83], "pleas": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 62], "how": [4, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 83], "mechan": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "work": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 71, 81, 83, 84], "metadatarequest": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "encapsul": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "inform": [4, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 83], "get_param": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "deep": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "true": [4, 7, 10, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 34, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 54, 55, 56, 58, 59, 65, 66, 69, 70, 71], "default": [4, 7, 8, 10, 11, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 55, 56, 57, 58, 62, 66, 67, 68, 70, 71, 79, 81, 83], "contain": [4, 7, 8, 10, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 58, 59, 65, 68, 71], "subobject": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "ar": [4, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 34, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 53, 55, 56, 57, 58, 62, 65, 66, 67, 68, 70, 71, 73, 74, 76, 79, 81, 83, 84], "param": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "dict": [4, 5, 6, 7, 10, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 58, 66, 68], "map": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 73], "set_param": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "set": [4, 7, 8, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 34, 35, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 66, 68, 71, 81, 83, 84], "simpl": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 79, 84], "well": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 62], "nest": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "pipelin": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 62, 83], "latter": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "have": [4, 9, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 58, 65, 66, 67, 69, 70, 81, 83, 84], "form": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 83], "compon": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 68], "__": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "so": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 66, 83], "": [4, 8, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 58, 70, 71, 79, 83], "possibl": [4, 11, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 73, 84], "updat": [4, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "instanc": [4, 8, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 32, 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 55, 56, 58, 68], "counterfactu": [4, 24, 25, 32, 33, 81, 83], "explain": [4, 25, 32, 33, 81, 83], "term": [4, 16, 17, 20, 21, 22, 23, 44, 47, 69, 70], "close": [4, 20, 21, 22, 23, 56, 58], "desir": [4, 8, 19, 20, 21, 22, 23, 32, 33, 40, 47, 71, 79], "counterfact": [4, 20, 21, 22, 23], "closensess": [4, 20, 21, 22, 23], "fit_explain": [4, 18, 20, 21, 22, 23, 24], "kwarg": [4, 7, 18, 20, 21, 22, 23, 24], "argument": [4, 7, 16, 17, 18, 19, 20, 21, 22, 23, 24, 43, 46, 47, 49, 50, 51, 54, 68, 70, 71, 81, 83, 84], "ax": [4, 18, 20, 21, 22, 23, 24, 57, 67], "make_dict_filt": 5, "filter": [5, 7, 16, 17, 44, 47, 83], "make": [5, 56, 58, 62, 70], "new": [5, 7, 13, 15, 16, 17, 19, 20, 21, 22, 23, 34, 36, 55, 62, 67, 83, 84], "subject": 5, "op": 5, "verb": 5, "callabl": [5, 7, 9, 10, 15, 18, 19, 22, 23, 24, 26, 30, 31, 32, 33, 54], "make_filt": 5, "creat": [5, 7, 8, 16, 17, 21, 48, 49, 50, 51, 62, 65, 68, 84], "make_list_filt": 5, "base": [5, 6, 7, 8, 14, 16, 17, 18, 19, 23, 25, 26, 29, 30, 32, 33, 37, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51, 53, 68, 70, 81, 84], "string": [5, 7, 16, 17, 26, 30, 43, 46, 47, 49, 50, 51, 66, 67, 68], "make_str_filt": 5, "version": [6, 7, 13, 15, 16, 17, 19, 20, 22, 23, 27, 28, 29, 30, 39, 41, 42, 43, 45, 47, 48, 49, 50, 51, 68, 79, 83, 84], "tag": [6, 7, 55, 68], "descript": [6, 7, 8, 54, 68, 79], "uniqu": [6, 7, 32, 33, 68], "human": [6, 7], "readabl": [6, 7], "get_collect": [6, 7], "get_filenam": [6, 7], "ext": [6, 7], "extens": [6, 7, 68], "filenam": [6, 7], "archiv": [6, 7, 62], "zipfil": [6, 7], "sort": [6, 7, 16, 17], "zip": [6, 7, 66, 68], "n_training_sampl": [6, 7], "url": [6, 7, 68], "properti": [6, 7, 16, 17, 41, 44], "download_url": [6, 7], "templat": [6, 7], "download": [6, 7, 66, 68, 84], "wildboar_requir": [6, 7, 68], "requir": [6, 7, 8, 13, 14, 15, 16, 17, 26, 27, 28, 29, 30, 48, 49, 50, 51, 56, 58, 66, 68, 71, 79, 81, 84], "min": [6, 7, 9, 13, 14, 15, 50, 51, 57, 65, 71], "timeout": [6, 7, 68], "abstract": [6, 7, 21, 45], "util": [7, 8, 9, 16, 17, 25, 50, 51, 69, 71], "outlier": [7, 16, 17, 25, 32, 33, 34, 35, 36, 68], "preprocess": [7, 18, 24, 25, 45, 47, 62, 66, 67, 83], "cache_dir": [7, 68], "keep_last_vers": 7, "keep": [7, 16, 17, 27, 28, 29, 30, 48, 50, 51], "latest": [7, 68], "json": 7, "request": [7, 8, 66, 68, 71, 79, 84], "ucr": [7, 62, 66, 68, 71, 83], "tini": [7, 66, 68], "format": [7, 13, 15, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 68], "bake": [7, 83], "off": [7, 83], "create_cache_dir": 7, "progress": 7, "forc": [7, 56, 58, 66], "where": [7, 8, 10, 14, 15, 16, 17, 27, 28, 29, 30, 32, 33, 35, 36, 38, 41, 43, 46, 47, 48, 49, 50, 51, 57, 62, 65, 68, 70, 71, 81, 83, 84], "wildboar_cach": 7, "miss": [7, 65, 69], "show": [7, 14, 57, 62], "bar": 7, "while": [7, 16, 17, 48, 49, 50, 51, 66, 68, 83, 84], "re": [7, 13, 15, 16, 17, 66], "we": [7, 16, 17, 32, 33, 41, 43, 46, 47, 49, 50, 51, 55, 56, 57, 58, 62, 65, 66, 67, 68, 70, 71, 73, 79, 81, 83, 84], "can": [7, 8, 16, 17, 27, 28, 29, 30, 40, 47, 48, 49, 50, 51, 54, 57, 62, 65, 66, 67, 68, 69, 70, 71, 73, 79, 83, 84], "also": [7, 32, 33, 48, 49, 50, 51, 55, 62, 66, 69, 70, 71, 76, 79, 81, 83, 84], "ani": [7, 8, 48, 49, 50, 51, 68, 69, 70, 81], "newli": 7, "ad": [7, 16, 17, 50, 51], "still": [7, 84], "pend": 7, "dtype": [7, 13, 15, 56, 57, 58, 65, 66], "contigu": [7, 56, 58, 83], "merge_train_test": [7, 66, 68, 83], "return_extra": 7, "read": [7, 10, 13, 15, 16, 17, 23, 31, 32, 33, 43, 46, 47, 49, 50, 51, 71, 83], "type": [7, 56, 57, 58, 76, 83], "_preprocess": 7, "take": [7, 41, 47, 48, 49, 50, 51, 68, 70], "np": [7, 8, 13, 14, 15, 16, 17, 18, 20, 23, 24, 32, 33, 41, 43, 46, 47, 49, 50, 51, 56, 57, 58, 59, 65, 67, 71], "ensur": [7, 19, 23, 34, 36, 56, 58, 68], "memori": [7, 16, 17, 56, 58, 71, 81, 83], "merg": [7, 49, 51, 68, 70], "exist": [7, 34, 36, 66, 81, 83], "partit": [7, 13, 15, 62, 83], "alreadi": [7, 66, 84], "4": [7, 8, 14, 16, 17, 18, 24, 40, 41, 44, 45, 47, 59, 62, 65, 70, 71, 79, 81], "x_train": [7, 16, 17, 35, 36, 62, 66, 68, 83], "x_test": [7, 16, 17, 35, 36, 62, 66, 68, 83], "y_train": [7, 16, 17, 35, 36, 62, 66, 68, 83], "y_test": [7, 16, 17, 35, 36, 62, 66, 68, 83], "syntheticcontrol": [7, 66, 68], "600": [7, 66], "origin": [7, 16, 17, 18, 19, 23, 24, 26, 30, 32, 33, 37, 44, 47, 56, 58, 62, 81, 83], "preserv": [7, 56, 57, 58, 83], "specif": [7, 16, 17, 43, 46, 47, 49, 50, 51, 55, 56, 58, 66, 67, 68, 81, 84], "doe": [7, 8, 34, 36, 40, 47, 71, 83], "shown": [7, 18, 24], "onli": [7, 11, 14, 15, 16, 17, 18, 19, 22, 23, 24, 48, 49, 50, 51, 56, 58, 62, 66, 67, 68, 70, 71, 81, 83, 84], "yield": [7, 34, 36, 55, 67], "those": 7, "which": [7, 8, 13, 14, 15, 16, 17, 20, 21, 23, 26, 27, 28, 29, 30, 32, 33, 41, 47, 48, 49, 50, 51, 62, 66, 68, 69, 70, 71, 79, 81, 83, 84], "f": [7, 8, 16, 17, 26, 30, 40, 41, 47, 49, 51, 54, 56, 58, 67, 70, 79, 83], "attribut": [7, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 37, 40, 44, 46, 47, 48, 49, 50, 51, 53, 66, 68, 74, 83], "comparison": [7, 66], "spec": 7, "conjunct": 7, "part": [7, 62, 66, 67, 68, 69, 71], "depend": [7, 8, 10, 11, 15, 41, 47, 65, 71, 83, 84], "tupl": [7, 14, 16, 17, 43, 46, 47, 49, 50, 51, 55, 58, 81], "last": [7, 67, 68, 71, 83], "element": [7, 16, 17, 38, 43, 46, 47, 49, 50, 51, 54, 59], "print": [7, 13, 15, 22, 23, 66, 83], "beef": [7, 66, 68], "470": [7, 66], "coffe": [7, 66, 68], "56": [7, 66], "286": [7, 66], "150": [7, 41, 47, 66], "1162": [7, 66], "82": [7, 66], "than": [7, 8, 10, 15, 16, 17, 20, 23, 50, 51, 57, 66, 69, 70, 71, 83], "call": [7, 16, 17, 27, 28, 29, 30, 48, 50, 51, 55, 68], "without": [7, 54, 62, 65, 68, 70], "reset": [7, 68], "root": [7, 18, 24], "n_outlier": [8, 34, 36, 79], "05": [8, 14, 16, 17, 21, 23, 34, 35, 36, 41, 47, 70, 79], "dbscan": 8, "ep": 8, "min_sampl": 8, "5": [8, 11, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 27, 30, 32, 33, 41, 44, 47, 50, 51, 57, 62, 70, 71, 79], "metric": [8, 10, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 43, 46, 47, 48, 49, 50, 51, 81], "euclidean": [8, 10, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 28, 30, 31, 32, 33, 46, 47, 50, 51, 70, 71], "max_ep": 8, "inf": [8, 56, 58], "random_st": [8, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 33, 34, 35, 36, 37, 40, 41, 43, 44, 46, 47, 49, 50, 51, 62], "densiti": 8, "fail": [8, 20, 23], "assign": [8, 13, 15, 79, 83], "By": [8, 16, 17, 18, 24, 26, 30, 40, 43, 45, 47, 49, 51, 56, 57, 58, 65, 68, 71, 79, 81, 83], "class": [8, 35, 68, 79, 83], "consid": [8, 10, 15, 16, 17, 32, 33, 35, 36, 49, 51, 83], "optic": 8, "when": [8, 11, 13, 15, 16, 17, 18, 22, 23, 24, 27, 28, 29, 30, 31, 33, 42, 45, 47, 48, 50, 51, 55, 56, 57, 58, 66, 68, 70, 71, 81, 83], "cluter": 8, "randomst": [8, 13, 14, 15, 16, 17, 18, 19, 20, 22, 23, 24, 26, 30, 31, 33, 34, 35, 36, 37, 40, 41, 43, 44, 46, 47, 49, 50, 51], "seed": [8, 16, 17, 18, 20, 23, 24, 26, 30, 37, 40, 41, 44, 46, 47, 49, 50, 51, 83], "x_outlier": [8, 79], "n_inlier": [8, 34, 36], "y_outlier": [8, 79], "labl": 8, "confusion_estim": 8, "difficulty_estim": 8, "transform": [8, 9, 13, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 32, 33, 50, 51, 55, 79, 81], "simplest": [8, 66, 79], "variat": [8, 79], "tight": [8, 79], "emmott": [8, 78], "2013": [8, 70, 79], "reliabl": [8, 83], "multiclass": [8, 58, 79], "For": [8, 10, 15, 16, 17, 27, 28, 29, 30, 37, 40, 41, 43, 44, 46, 47, 48, 49, 50, 51, 62, 66, 67, 68, 69, 71, 74, 75, 76, 81, 83, 84], "maxim": 8, "confus": [8, 79], "measur": [8, 16, 17, 32, 33, 43, 46, 47, 49, 50, 51, 70, 81], "digit": 8, "rang": [8, 16, 17, 43, 46, 47, 48, 49, 50, 51, 67, 71, 79], "accord": [8, 10, 11, 15, 16, 17, 44, 45, 47, 50, 51, 57, 68, 79], "final": [8, 16, 17, 55, 62], "either": [8, 14, 35, 36, 46, 47, 48, 49, 50, 51, 58, 66, 68, 71, 79, 83], "dispers": [8, 79], "guarante": [8, 83], "error": [8, 16, 17, 56, 58], "rais": [8, 56, 58], "ha": [8, 16, 17, 32, 33, 41, 45, 47, 49, 50, 51, 54, 56, 57, 58, 62, 63, 65, 68, 70, 71, 81], "few": [8, 32, 33, 84], "n_class": [8, 13, 15, 16, 17, 48, 49, 50, 51], "predict_proba": [8, 13, 15, 16, 17, 48, 49, 50, 51], "logist": [8, 79], "rbf": [8, 79], "befor": [8, 13, 15, 26, 30, 81, 84], "otherwis": [8, 16, 17, 20, 23, 32, 33, 56, 58], "suppli": [8, 18, 19, 23, 24], "hardest": [8, 79], "point": [8, 14, 48, 50, 51, 66, 68, 70, 79, 83], "quantiz": [8, 79], "should": [8, 16, 32, 33, 35, 36, 67, 68, 70, 83], "len": [8, 10, 13, 15, 18, 24], "denot": [8, 35, 36, 67, 70, 71], "simpler": 8, "multipl": [8, 16, 17, 18, 24, 43, 46, 47, 50, 51, 65, 68, 71, 79, 81, 83], "e": [8, 14, 16, 17, 22, 23, 32, 33, 50, 51, 56, 58, 65, 66, 67, 68, 70, 71, 79, 83, 84], "g": [8, 13, 14, 15, 21, 23, 26, 30, 40, 46, 47, 66, 67, 70, 71, 79, 83, 84], "would": [8, 16, 17, 27, 28, 29, 30, 43, 46, 47, 48, 49, 50, 51, 67], "mix": 8, "easi": [8, 57, 66], "difficult": [8, 79], "16": [8, 79], "3": [8, 14, 16, 17, 41, 44, 47, 56, 58, 59, 62, 65, 67, 69, 70, 71, 79, 81], "percentil": [8, 16, 17, 79], "procedur": 8, "effect": [8, 16, 17, 45, 47, 49, 51, 56, 58, 81], "closest": [8, 13, 15, 21, 32, 33], "facil": 8, "locat": [8, 68, 71, 84], "thei": [8, 16, 17, 43, 47, 48, 49, 50, 51, 68, 71], "distribut": [8, 16, 17, 26, 30, 40, 44, 45, 47, 48, 49, 50, 51, 66, 84], "among": [8, 21], "avail": [8, 68, 76], "suffici": 8, "fewer": [8, 32, 33], "mai": [8, 16, 17, 27, 28, 29, 30, 48, 50, 51, 81], "note": [8, 11, 14, 15, 16, 17, 22, 23, 27, 28, 29, 30, 31, 32, 33, 34, 36, 40, 41, 47, 48, 50, 51, 57, 67, 71], "packag": [8, 66, 79, 84], "networkx": [8, 79], "da": [8, 70, 79], "dietterich": [8, 79], "t": [8, 13, 15, 16, 17, 26, 27, 28, 29, 30, 32, 33, 40, 41, 42, 44, 46, 47, 48, 49, 50, 51, 56, 58, 70, 71, 79, 81, 84], "fern": [8, 79], "wong": [8, 79], "w": [8, 13, 14, 15, 16, 17, 26, 27, 28, 29, 30, 48, 49, 50, 51, 66, 68, 79], "systemat": [8, 79], "anomali": [8, 35, 36, 79], "benchmark": [8, 66, 75, 78], "real": [8, 16, 17, 65, 70, 79], "acm": [8, 70, 71, 79], "sigkdd": [8, 71, 79], "workshop": [8, 79], "pp": [8, 71, 79], "21": [8, 79], "n_cluster": [8, 13, 15], "farther": 8, "other": [8, 13, 15, 20, 23, 34, 36, 62, 66, 68, 71, 79, 83], "satisfi": [8, 70], "constraint": [8, 53], "allow": [8, 41, 47, 48, 49, 50, 51, 55, 56, 58, 68, 79, 81, 83], "n_dim": [9, 10, 11, 15, 32, 33, 35, 36, 42, 47, 48, 49, 50, 51, 65, 66, 67, 69, 71, 81, 83], "max": [9, 14, 50, 51, 57, 70, 71], "result": [9, 16, 17, 19, 21, 23, 35, 36, 38, 46, 47, 48, 49, 50, 51, 56, 57, 58, 59, 62, 67, 70, 79, 81], "zero": [9, 16, 17, 26, 30, 40, 44, 47, 48, 49, 50, 51, 67, 70, 83], "unit": [9, 26, 30, 40, 47, 67, 70, 83], "deviat": [9, 14, 26, 30, 40, 41, 47, 79], "n_shortest": 9, "dim": [10, 11, 15, 67, 71, 81], "warn": [10, 15, 56, 58, 81], "metric_param": [10, 13, 15, 16, 17, 18, 23, 24, 28, 30, 31, 32, 33, 43, 46, 47, 49, 50, 51, 70, 71, 81], "n_job": [10, 11, 13, 15, 16, 17, 26, 27, 28, 29, 30, 37, 40, 41, 42, 43, 44, 46, 47, 52, 62], "broadcast": [10, 11, 15, 19, 23, 71], "full": [10, 15, 32, 33, 41, 47, 66, 71, 81, 83], "_metric": [10, 15, 23, 32, 33], "about": [10, 13, 15, 16, 17, 23, 31, 32, 33, 41, 43, 44, 46, 47, 49, 50, 51, 56, 58, 71, 83], "parallel": [10, 13, 15, 16, 17, 26, 30, 37, 40, 44, 46, 47, 52], "job": [10, 11, 13, 15, 16, 17, 26, 30, 37, 40, 42, 44, 46, 47, 52], "ndim": [10, 15, 56, 58, 83], "scalar": [10, 15, 54, 57, 71], "return_index": [10, 11, 14, 15, 71], "m_timestep": [10, 14, 15], "search": [10, 15, 48, 49, 50, 51, 70], "_subsequence_metr": [10, 15], "mani": [10, 15, 16, 17, 56, 58, 62, 67, 71], "equal": [10, 15, 16, 17, 43, 47, 48, 49, 50, 51, 65, 66, 70, 79], "good": [10, 15, 22, 23, 32, 33, 79], "first": [10, 11, 14, 15, 16, 17, 40, 43, 46, 47, 49, 50, 51, 56, 58, 68, 69, 71, 79, 84], "run": [10, 13, 15, 16, 17, 22, 23, 26, 30, 37, 40, 44, 46, 47, 55, 66, 67, 84], "dist": [10, 15, 50, 51, 71], "minumum": [10, 15, 57], "posit": [10, 13, 15, 16, 17, 18, 22, 23, 24, 26, 30, 37, 40, 44, 47, 62, 70], "threshold": [10, 15, 16, 17, 18, 21, 22, 23, 24, 45, 50, 51, 74, 76, 81], "max_match": [10, 15], "less": [10, 15, 16, 17, 50, 51, 66, 67, 83], "behaviour": [10, 15], "order": [10, 15, 16, 17, 26, 30, 32, 33, 39, 40, 47, 48, 49, 50, 51, 56, 57, 58, 65, 71, 83], "occurr": [10, 15], "top": [10, 15, 18, 24], "length": [10, 15, 16, 17, 50, 51, 54, 56, 58, 59, 67, 69, 70], "below": [10, 15, 68], "n_match": [10, 15], "x_sampl": [10, 15, 71], "y_sampl": [10, 15, 71], "n_subsequ": [10, 15, 71], "yn_timestep": [10, 11, 15], "closer": [10, 15, 21, 32, 33], "treshold": [10, 15], "trivial": [10, 11, 15], "vicin": [10, 15], "within": [10, 15, 71], "timestep": [10, 15, 32, 33, 44, 47, 56, 58, 65, 66, 67, 69, 71, 83], "anoth": [10, 15, 68, 79], "higher": [10, 15], "everi": [11, 15, 48, 49, 50, 51, 56, 58, 71], "subsequenec": [11, 15], "xn_timestep": [11, 15], "second": [11, 14, 15, 16, 17, 43, 46, 47, 49, 50, 51, 68, 71], "8": [13, 14, 15, 26, 30, 40, 41, 47, 57, 62, 81], "r": [13, 14, 15, 16, 17, 21, 23, 26, 27, 28, 29, 30, 41, 43, 46, 47, 48, 49, 50, 51, 70, 84], "init": [13, 14, 15], "n_init": [13, 15], "max_it": [13, 15, 21, 23], "300": [13, 15, 83], "tol": [13, 14, 15], "001": [13, 15, 70], "verbos": [13, 14, 15, 16, 17, 21, 22, 23, 84], "dtw": [13, 15, 20, 21, 23, 25, 46, 47, 49, 50, 51, 70, 71, 81], "softdtw": [13, 15], "penalti": [13, 14, 15, 70], "tradit": [13, 15, 62, 67, 70, 79, 81], "initi": [13, 14, 15, 21, 68], "randomli": [13, 15, 41, 46, 47, 76], "centroid": [13, 15, 81], "iter": [13, 15, 26, 30, 34, 36, 66], "toler": [13, 15, 32, 33, 70], "declar": [13, 15, 68], "converg": [13, 15], "consecut": [13, 15], "diagnost": [13, 15], "messag": [13, 15, 56, 58], "dure": [13, 15, 22, 23], "determin": [13, 15, 16, 17, 19, 22, 23, 26, 27, 28, 29, 30, 31, 33, 34, 36, 41, 47, 48, 50, 51, 68, 79], "n_iter_": [13, 15], "cluster_centers_": [13, 15], "center": [13, 15], "labels_": [13, 15], "univari": [13, 15, 31, 33, 65, 69, 71, 83], "Not": [13, 15, 16, 17], "fit_predict": [13, 15, 16, 17], "n_featur": [13, 15, 16, 17, 26, 27, 28, 29, 30, 39, 42, 43, 45, 47, 48, 49, 50, 51], "present": [13, 15, 16, 17, 68], "api": [13, 15, 16, 17, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 65, 80, 81, 83], "consist": [13, 15, 16, 17, 22, 23, 27, 28, 29, 30, 48, 50, 51, 62, 71], "convent": [13, 15, 16, 17, 55, 56, 58, 66, 74, 83], "int64": [13, 15], "fit_transform": [13, 15, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47], "fit_param": [13, 15, 39, 42, 43, 45, 47], "n_output": [13, 15, 16, 17, 26, 27, 28, 29, 30, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "target": [13, 15, 16, 17, 21, 23, 39, 42, 43, 45, 47, 48, 49, 50, 51, 58, 84], "unsupervis": [13, 15, 16, 17, 39, 42, 43, 45, 47], "addit": [13, 15, 39, 42, 43, 45, 47, 66, 69, 71, 83], "x_new": [13, 15, 39, 42, 43, 45, 47], "n_features_new": [13, 15, 39, 42, 43, 45, 47], "predict": [13, 15, 16, 17, 21, 22, 23, 26, 27, 28, 29, 30, 31, 32, 33, 48, 49, 50, 51, 62, 75], "belong": [13, 15, 83], "set_output": [13, 15, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47], "output": [13, 15, 16, 17, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 56, 58, 62, 71, 83], "introduc": [13, 15, 16, 17, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 50, 51, 62, 63, 81], "panda": [13, 15, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47], "configur": [13, 15, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 71, 75, 83, 84], "datafram": [13, 15, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47], "unchang": [13, 14, 15, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47], "space": [13, 15, 21, 38, 47, 57, 62, 71], "30": [13, 15, 70, 71, 83], "0001": [13, 15], "smallest": [13, 15], "pam": [13, 15], "medoid": [13, 15, 20, 23, 81], "core": [13, 15, 16, 17, 26, 30, 37, 40, 41, 43, 44, 47], "integ": [13, 15, 16, 17, 26, 30, 37, 40, 44, 47, 57, 79], "medoid_indices_": [13, 15], "n_neighbor": [13, 15, 81], "classes_": [13, 15, 16, 17, 21, 23, 48, 49, 50, 51], "shapel": [13, 15], "known": [13, 15], "multivarait": [13, 15], "kneighborclassifi": [13, 15], "multivari": [13, 15, 22, 23, 31, 33, 65, 67, 69, 83], "sample_weight": [13, 14, 15, 16, 17, 26, 27, 28, 29, 30, 32, 33, 48, 49, 50, 51], "accuraci": [13, 15, 16, 17, 26, 27, 28, 29, 30, 32, 33, 48, 49, 50, 51], "multi": [13, 15, 16, 17, 26, 27, 28, 29, 30, 41, 47, 48, 49, 50, 51, 56, 58, 79], "subset": [13, 15, 16, 17, 26, 27, 28, 29, 30, 31, 33, 48, 49, 50, 51], "harsh": [13, 15, 16, 17, 26, 27, 28, 29, 30, 48, 49, 50, 51], "sinc": [13, 15, 16, 17, 19, 23, 26, 27, 28, 29, 30, 41, 47, 48, 49, 50, 51, 67, 71, 79, 83], "you": [13, 15, 16, 17, 26, 27, 28, 29, 30, 48, 49, 50, 51, 81, 83, 84], "correctli": [13, 15, 16, 17, 26, 27, 28, 29, 30, 48, 49, 50, 51, 81], "x_timestep": [14, 71], "y_timestep": [14, 71], "out": [14, 16, 17, 83], "vector": [14, 56, 58], "penal": 14, "store": [14, 16, 17, 66], "instead": [14, 16, 17, 27, 28, 29, 30, 34, 36, 48, 50, 51, 62, 71, 75, 83], "mm": 14, "max_stabl": 14, "learning_r": 14, "decai": 14, "9": [14, 26, 30, 40, 41, 47, 62, 68], "1e": [14, 32, 33], "max_epoch": 14, "50": [14, 66, 71], "return_cost": 14, "control": [14, 16, 17, 18, 22, 23, 24, 26, 30, 37, 40, 43, 44, 47, 84], "exp": [14, 16, 17, 50, 51], "influenc": [14, 16, 17, 27, 28, 29, 30, 48, 50, 51], "much": [14, 32, 33, 81], "contribut": 14, "ssg": 14, "minim": 14, "equival": 14, "stochast": 14, "subgradi": 14, "epoch": 14, "lowest": [14, 62], "cost": [14, 22, 23, 70, 71], "rate": 14, "minmum": 14, "runtim": 14, "pseudo": [14, 19, 22, 23], "dataset": [14, 16, 17, 18, 24, 25, 26, 30, 35, 36, 37, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 56, 57, 58, 62, 65, 67, 68, 71, 79], "27442791e": 14, "01": [14, 41, 47], "19807473e": 14, "02": [14, 41, 47], "77490053e": 14, "60441308e": 14, "31930140e": 14, "17437783e": 14, "43925941e": 14, "60983434e": 14, "72118437e": 14, "7": [14, 16, 17, 41, 44, 47, 62, 71], "73352049e": 14, "56701557e": 14, "53269314e": 14, "33366128e": 14, "09010828e": 14, "97539989e": 14, "71443248e": 14, "42492836e": 14, "71408958e": 14, "82518334e": 14, "35671953e": 14, "26442901e": 14, "38342948e": 14, "11248815e": 14, "99355168e": 14, "00": [14, 41, 47], "08588712e": 14, "35954194e": 14, "78345146e": 14, "41023092e": 14, "99915956e": 14, "82717462e": 14, "71687181e": 14, "55819192e": 14, "28805337e": 14, "06653283e": 14, "25159669e": 14, "02389872e": 14, "39410523e": 14, "34687887e": 14, "03": 14, "98654485e": 14, "85832342e": 14, "6": [14, 41, 47, 62, 65, 70, 71, 83], "56436416e": 14, "25302660e": 14, "77697444e": 14, "24606299e": 14, "76357782e": 14, "27083874e": 14, "44590342e": 14, "64184026e": 14, "03608265e": 14, "13964118e": 14, "33595675e": 14, "09954847e": 14, "61924171e": 14, "47433305e": 14, "29583168e": 14, "00425122e": 14, "80524683e": 14, "70210329e": 14, "40259039e": 14, "59657389e": 14, "52170730e": 14, "54666287e": 14, "93690730e": 14, "23968406e": 14, "upper": [14, 16, 17, 34, 36, 43, 44, 46, 47, 49, 50, 51, 71], "keogh": [14, 71], "2002": 14, "28th": 14, "veri": [14, 62, 67, 70], "larg": [14, 57, 66, 70, 74], "same": [14, 16, 17, 18, 24, 32, 33, 48, 49, 50, 51, 57, 62, 67, 68, 70, 71, 81, 83], "min_dist": 14, "cumul": 14, "step": [14, 62, 66, 67, 83], "precomput": [14, 16, 17, 27, 28, 29, 30, 48, 50, 51], "x_indic": 14, "y_indic": 14, "provid": [14, 21, 41, 44, 68, 70, 83, 84], "n": [14, 71, 79, 83], "omitaomu": 14, "o": [14, 16, 17, 21, 49, 51, 71], "2021": [14, 32, 33], "pattern": [14, 70, 79], "recognit": 14, "44": 14, "2231": 14, "2240": 14, "diagon": 14, "raec1aca773": 14, "n_estim": [16, 17], "max_sampl": [16, 17], "bootstrap": [16, 17], "oob_scor": [16, 17], "class_weight": [16, 17, 26, 27, 28, 29, 30, 49, 50, 51], "warm_start": [16, 17], "base_estim": [16, 17, 81], "deprec": [16, 17, 19, 23, 41, 47, 49, 50, 51, 81], "meta": [16, 17], "draw": [16, 17], "drawn": [16, 17], "replac": [16, 17, 32, 33, 68, 84], "balanc": [16, 17, 26, 30, 49, 50, 51], "associ": [16, 17, 26, 30, 49, 50, 51], "invers": [16, 17, 49, 50, 51], "proport": [16, 17, 49, 50, 51], "frequenc": [16, 17, 49, 50, 51, 57], "reus": [16, 17, 67, 83], "solut": [16, 17], "previou": [16, 17, 67], "add": [16, 17, 22, 23, 55, 57, 81], "just": [16, 17, 65, 84], "whole": [16, 17], "resampl": [16, 17, 18, 24, 26, 30, 37, 44, 47], "been": [16, 17, 41, 47, 57, 70, 81], "remov": [16, 17, 19, 23, 50, 51, 54, 81], "base_estimator_": [16, 17], "grow": [16, 17], "estimators_samples_": [16, 17], "member": [16, 17], "reduc": [16, 17, 41, 47, 66], "footprint": [16, 17], "thu": [16, 17], "fetch": [16, 17, 84], "slower": [16, 17, 71], "expect": [16, 17, 27, 28, 29, 30, 42, 47, 48, 50, 51, 67, 79, 83], "decision_funct": [16, 17, 32, 33], "decis": [16, 17, 22, 23, 48, 49, 50, 51, 74], "function": [16, 17, 22, 40, 41, 62, 66, 67, 68, 70, 71, 83], "spars": [16, 17, 48, 49, 50, 51, 56, 58, 62], "matric": [16, 17], "accept": [16, 17, 26, 30, 40, 47, 56, 58, 66, 67, 68, 71, 83], "column": [16, 17, 56, 58, 68, 69], "correspond": [16, 17, 26, 30, 32, 33, 48, 49, 50, 51, 62], "appear": [16, 17], "special": [16, 17, 83], "case": [16, 17, 70], "build": [16, 17, 49, 51, 83], "highest": [16, 17, 62], "do": [16, 17, 48, 49, 50, 51, 70, 71, 81, 84], "resort": [16, 17], "vote": [16, 17], "predict_log_proba": [16, 17], "log": [16, 17, 41, 47, 81], "p": [16, 17, 20, 21, 22, 23, 32, 33, 70, 71], "repres": [16, 17, 65, 69, 70, 75], "100": [16, 17, 18, 21, 23, 24, 43, 47, 49, 51, 57, 66], "defin": [16, 17, 27, 28, 29, 30, 39, 43, 45, 46, 47, 48, 49, 50, 51, 68], "frac": [16, 17, 27, 28, 29, 30, 48, 50, 51], "u": [16, 17, 27, 28, 29, 30, 48, 50, 51], "v": [16, 17, 27, 28, 29, 30, 48, 50, 51, 68, 70], "residu": [16, 17, 27, 28, 29, 30, 48, 50, 51], "sum": [16, 17, 27, 28, 29, 30, 48, 50, 51], "squar": [16, 17, 18, 24, 27, 28, 29, 30, 48, 50, 51], "y_true": [16, 17, 27, 28, 29, 30, 48, 50, 51], "y_pred": [16, 17, 27, 28, 29, 30, 48, 50, 51], "total": [16, 17, 27, 28, 29, 30, 48, 50, 51], "neg": [16, 17, 27, 28, 29, 30, 48, 49, 50, 51], "becaus": [16, 17, 27, 28, 29, 30, 48, 50, 51], "arbitrarili": [16, 17, 27, 28, 29, 30, 48, 50, 51], "wors": [16, 17, 27, 28, 29, 30, 48, 50, 51], "constant": [16, 17, 27, 28, 29, 30, 48, 50, 51], "alwai": [16, 17, 20, 23, 27, 28, 29, 30, 34, 36, 48, 50, 51, 70], "disregard": [16, 17, 27, 28, 29, 30, 48, 50, 51], "some": [16, 17, 27, 28, 29, 30, 48, 50, 51, 55, 56, 58, 65, 66, 69, 84], "n_samples_fit": [16, 17, 27, 28, 29, 30, 48, 50, 51], "multioutput": [16, 17, 27, 28, 29, 30, 48, 50, 51], "uniform_averag": [16, 17, 27, 28, 29, 30, 48, 50, 51], "23": [16, 17, 27, 28, 29, 30, 48, 50, 51], "r2_score": [16, 17, 27, 28, 29, 30, 48, 50, 51], "except": [16, 17, 27, 28, 29, 30, 48, 50, 51, 68, 79], "multioutputregressor": [16, 17, 27, 28, 29, 30, 48, 50, 51], "baseforestclassifi": 16, "estimator_param": 16, "max_depth": [16, 17, 48, 49, 50, 51], "min_samples_split": [16, 17, 48, 49, 50, 51], "min_samples_leaf": [16, 17, 48, 49, 50, 51, 81], "min_impurity_decreas": [16, 17, 48, 49, 50, 51], "criterion": [16, 17, 49, 50, 51, 81], "entropi": [16, 17, 49, 50, 51], "tree": [16, 17, 25, 74, 81], "baseforestregressor": 16, "squared_error": [16, 17, 50, 51], "baseshapeletforestclassifi": 16, "n_shapelet": [16, 17, 18, 24, 28, 30, 46, 47, 50, 51, 81], "log2": [16, 17, 18, 24, 32, 33, 41, 45, 47, 50, 51, 81], "min_shapelet_s": [16, 17, 18, 21, 23, 24, 28, 30, 46, 47, 50, 51], "max_shapelet_s": [16, 17, 18, 21, 23, 24, 28, 30, 46, 47, 50, 51], "directli": [16, 62, 68], "baseshapeletforestregressor": 16, "depth": [16, 17, 49, 50, 51, 84], "expand": [16, 17, 50, 51], "until": [16, 17, 50, 51], "leav": [16, 17, 48, 49, 50, 51], "pure": [16, 17, 50, 51], "node": [16, 17, 44, 47, 48, 49, 50, 51], "leaf": [16, 17, 48, 49, 50, 51], "impur": [16, 17, 49, 50, 51], "decreas": [16, 17, 49, 50, 51], "larger": [16, 17, 32, 33, 50, 51, 57, 69, 83], "grid": [16, 17, 43, 46, 47, 49, 50, 51], "mandatori": [16, 17, 43, 46, 47, 49, 50, 51], "one": [16, 17, 18, 24, 40, 43, 46, 47, 49, 50, 51, 54, 62, 66, 71, 74, 83], "specifii": [16, 17, 43, 46, 47, 49, 50, 51], "give": [16, 17, 18, 24, 43, 46, 47, 49, 50, 51, 75], "follow": [16, 17, 39, 41, 43, 44, 46, 47, 49, 50, 51, 66, 67, 68, 70, 71, 83, 84], "min_r": [16, 17, 43, 46, 47, 49, 50, 51], "max_r": [16, 17, 43, 46, 47, 49, 50, 51], "num_r": [16, 17, 43, 46, 47, 49, 50, 51], "gini": [16, 17, 49, 50, 51], "scaled_euclidean": [16, 17, 50, 51, 70, 71], "y_hat": [16, 17], "mse": [16, 17, 50, 51, 81], "wa": [16, 17, 19, 23, 50, 51, 81], "v1": [16, 17, 50, 51, 66, 68], "forestmixin": 16, "n_interv": [16, 17, 18, 24, 32, 33, 41, 45, 47, 50, 51, 81], "sqrt": [16, 17, 18, 24, 32, 33, 41, 45, 47, 50, 51], "fix": [16, 17, 41, 47, 50, 51, 81], "summar": [16, 17, 41, 47, 50, 51], "mean_var_std": [16, 17], "sample_s": [16, 17, 31, 33, 41, 47, 50, 51], "min_siz": [16, 17, 41, 44, 47, 50, 51, 81], "max_siz": [16, 17, 41, 44, 47, 50, 51, 81], "contamin": [16, 17, 35, 36], "strategi": [16, 17, 26, 30, 34, 36, 40, 44, 45, 47], "offset": [16, 17], "offset_": [16, 17], "model_select": [16, 17, 25, 62, 83], "sklearn": [16, 17, 31, 33, 40, 47, 56, 58, 62, 79, 83], "balanced_accuracy_scor": [16, 17], "test_siz": [16, 17, 34, 35, 36, 83], "anomalies_train_s": [16, 17, 35, 36], "8674": [16, 17], "n_pivot": [16, 17, 43, 47, 49, 50, 51], "pivot_sampl": [16, 17, 49, 51], "metric_sampl": [16, 17, 43, 47, 49, 51], "metric_factori": [16, 17, 49, 51, 81], "uniform": [16, 17, 43, 44, 45, 47, 49, 51, 67, 71], "parameter": [16, 17, 49, 51], "suggest": [16, 17, 49, 51, 62], "luca": [16, 17, 49, 51], "2019": [16, 17, 41, 47, 49, 51, 84], "2020": [16, 17, 20, 21, 22, 23, 32, 33, 44, 47, 49, 51, 62], "custom": [16, 17, 41, 47, 49, 51], "combin": [16, 17, 21, 41, 47, 49, 51, 62], "sub": [16, 17, 49, 51], "benjamin": [16, 17, 49, 51], "ahm": [16, 17, 49, 51], "shifaz": [16, 17, 49, 51], "charlott": [16, 17, 49, 51], "pelleti": [16, 17, 49, 51], "lachlan": [16, 17, 49, 51], "neill": [16, 17, 49, 51], "nayyar": [16, 17, 49, 51], "zaidi": [16, 17, 49, 51], "bart": [16, 17, 49, 51], "goethal": [16, 17, 49, 51], "fran\u00e7oi": [16, 17, 44, 47, 49, 51], "petitjean": [16, 17, 44, 47, 49, 51], "geoffrei": [16, 17, 44, 47, 49, 51], "webb": [16, 17, 26, 30, 40, 44, 47, 49, 51], "scalabl": [16, 17, 49, 51], "knowledg": [16, 17, 20, 22, 23, 26, 30, 32, 33, 40, 41, 44, 47, 49, 51, 70, 71], "discoveri": [16, 17, 26, 30, 40, 41, 44, 47, 49, 51, 71], "n_kernel": [16, 17, 26, 27, 30, 40, 44, 47, 50, 51, 62], "normal": [16, 17, 18, 24, 26, 27, 28, 29, 30, 35, 36, 40, 44, 45, 47, 50, 51, 57, 62, 67, 70, 81], "sampling_param": [16, 17, 26, 27, 30, 40, 44, 47, 50, 51], "kernel_s": [16, 17, 26, 27, 30, 38, 40, 44, 47, 50, 51, 81], "bias_prob": [16, 17, 27, 30, 44, 47, 50, 51], "normalize_prob": [16, 17, 27, 30, 44, 47, 50, 51], "padding_prob": [16, 17, 27, 30, 44, 47, 50, 51], "11": [16, 17, 44, 47, 62], "13": [16, 17, 44, 47, 62], "bia": [16, 17, 38, 44, 47], "pad": [16, 17, 38, 44, 47, 62], "processor": [16, 17, 46, 47, 84], "alpha": [16, 17, 26, 27, 28, 29, 30, 50, 51, 57], "current": [16, 17, 21, 50, 51, 66, 67, 68, 81, 84], "ab": [16, 17, 50, 51], "toward": [16, 17, 21, 50, 51, 55], "increas": [16, 17, 50, 51], "independeth": [16, 17, 50, 51], "sparse_output": [16, 17], "high": [16, 17], "dimension": [16, 17], "fall": [16, 17, 70, 83], "lead": [16, 17, 81], "code": [16, 17, 67, 71, 81], "ones": [16, 17], "csr": [16, 17], "bin": [18, 24, 45, 47, 57, 79, 84], "n_bin": [18, 24, 32, 33, 45, 47], "n_repeat": [18, 24], "discret": [18, 24, 26, 30, 57, 79], "permut": [18, 24], "show_bin": [18, 24], "show_grid": [18, 24], "scorer": [18, 24, 26, 30], "were": [18, 24, 69], "annot": [18, 24, 25], "axi": [18, 24, 48, 49, 50, 51, 54, 56, 58, 67, 71], "mappabl": [18, 24], "scalarmapp": [18, 24], "colorbar": [18, 24], "specici": [18, 24], "least": [18, 24, 56, 58], "importances_": [18, 24], "components_": [18, 24], "permuteimport": 18, "kernel_scal": [18, 24], "25": [18, 24, 49, 51, 70, 79], "train_x": [19, 23], "train_i": [19, 23], "valid_scor": [19, 23], "method_arg": [19, 23], "basecounterfactu": [19, 23], "infer": [19, 23], "most": [19, 23, 65, 69, 79, 84], "appropri": [19, 23, 69], "_counterfactu": [19, 23], "renam": [19, 23, 41, 47, 81], "success": [19, 23], "stabl": [19, 23, 35, 36, 65], "x_counterfactu": [19, 23, 32, 33], "wdtw": [20, 23, 70, 71, 81], "karlsson": [20, 22, 23, 32, 33], "reban": [20, 22, 23, 32, 33], "j": [20, 22, 23, 32, 33, 71], "papapetr": [20, 22, 23, 32, 33], "gioni": [20, 22, 23, 32, 33], "local": [20, 22, 23, 32, 33], "tweak": [20, 22, 23, 32, 33], "system": [20, 22, 23, 32, 33, 66, 68, 84], "62": [20, 22, 23, 32, 33], "1671": [20, 22, 23, 32, 33], "1700": [20, 22, 23, 32, 33], "explainer_": [20, 23], "dynamictimewarptransform": 21, "gamma": 21, "move": [21, 49, 51, 70], "euclideantransform": 21, "knearestprototypesampl": 21, "prototype_indici": 21, "metric_transform": 21, "prototyp": 21, "new_counterfactu": 21, "nearest_index": 21, "sample_mov": 21, "sampla": 21, "knearestshapeletprototypesampl": 21, "shapeletprototypesampl": 21, "metrictransform": 21, "predictevalu": 21, "probabilityevalu": 21, "step_siz": [21, 23], "n_prototyp": [21, 23], "samsten": [21, 23], "isak": [21, 23], "estimator_": [21, 23], "partitions_": [21, 23], "prototypesampl": [21, 23], "target_": [21, 23], "targetevalu": [21, 23], "prototype_indic": 21, "helper": 21, "wai": [21, 67, 81], "abc": 21, "inherit": 21, "_o": 21, "sample_shapelet": 21, "uniformprototypesampl": 21, "uniformli": [21, 45, 47, 50, 51], "weighteddynamictimewarptransform": 21, "epsilon": [22, 23, 70, 81], "batch_siz": [22, 23], "max_path": [22, 23], "cosin": [22, 23, 70, 71], "manhattan": [22, 23, 70, 71], "degre": [22, 23], "batch": [22, 23, 52], "candid": [22, 23, 32, 33], "subsampl": [22, 23], "stdout": [22, 23], "execut": [22, 23, 52], "differ": [22, 23, 26, 30, 32, 33, 34, 36, 40, 47, 68, 69, 70, 71, 81, 83], "revers": [22, 23], "2018": [22, 23], "via": [22, 23], "irrevers": [22, 23], "paths_": [22, 23], "x_true": 23, "normalized_euclidean": [23, 32, 33, 70, 71], "ensembl": [25, 62, 79, 81, 83], "linear_model": [25, 62, 75, 81, 83], "variable_len": [25, 56, 58, 69], "n_group": [26, 30, 40, 47, 62], "64": [26, 30, 40, 47, 62, 66, 84], "fit_intercept": [26, 27, 28, 29, 30], "cv": [26, 27, 28, 29, 30], "group": [26, 30, 34, 36, 40, 47, 62, 75], "sampler": [26, 30, 40, 47], "half": [26, 30, 62, 71], "n_alpha": [26, 30], "try": [26, 30, 54, 62, 84], "whether": [26, 30, 56, 57, 58], "calcul": [26, 30, 31, 33, 45], "intercept": [26, 30], "signatur": [26, 30], "class_label": [26, 30], "dempster": [26, 30, 40, 44, 47, 81], "schmidt": [26, 30, 40, 46, 47], "d": [26, 30, 32, 33, 40, 41, 47, 66, 68, 70, 71], "2023": [26, 30, 40, 47, 62, 81], "hydra": [26, 30, 40, 47], "compet": [26, 30, 40, 47], "accur": [26, 30, 40, 44, 47, 73], "10000": [27, 30, 62], "gcv_mode": [27, 28, 29, 30], "1000": [28, 30, 44, 46, 47], "basetransformclassifi": 29, "basetransformestim": 29, "basetransformregressor": 29, "transformridgecv": 29, "transformridgeclassifiercv": 29, "conveni": [31, 33, 83], "wrapper": [31, 33, 54], "nativ": [31, 32, 33, 40, 47, 81], "x_factual": [32, 33], "atol": [32, 33], "08": [32, 33], "n_timetep": [32, 33], "overlap": [32, 33, 41, 47], "counterfacut": [32, 33], "factual": [32, 33], "x_plausibl": [32, 33], "y_plausibl": [32, 33], "y_counterfactu": [32, 33], "typic": [32, 33, 71, 83], "m_sampl": [32, 33], "localoutlierfactor": [32, 33], "individu": [32, 33, 67], "plausabl": [32, 33], "incic": [32, 33], "better": [32, 33], "delanei": [32, 33], "green": [32, 33], "kean": [32, 33], "arxiv": [32, 33, 46, 47], "2009": [32, 33], "13211v2": [32, 33], "redund": [32, 33], "impact": [32, 33], "non": [32, 33, 41, 47, 56, 58, 71], "x_nativ": [32, 33], "y_nativ": [32, 33], "captur": [32, 33, 83], "n_nativ": [32, 33], "n_counterfactu": [32, 33], "avareg": [32, 33], "smyth": [32, 33], "b": [32, 33, 71], "interpret": [32, 33, 41, 47], "divers": [32, 33], "2101": [32, 33], "09056v1": [32, 33], "y_predict": [32, 33], "correct": [32, 33, 53, 73], "n_split": [34, 36], "shuffl": [34, 36, 83], "total_n_outli": [34, 36], "psudo": [34, 35, 36], "contrari": [34, 36], "fold": [34, 36], "insert": [34, 36], "repeatedli": [34, 36, 66, 83], "get_n_split": [34, 36], "compat": [34, 36, 37, 40, 41, 43, 44, 46, 47], "train_idx": [34, 36], "test_idx": [34, 36], "normal_class": [35, 36], "state": [35, 36, 43, 47, 67, 75], "anomal": [35, 36], "train_test_split": [35, 36, 62, 83], "baseattributetransform": [37, 40, 41, 43, 44, 46, 47], "engin": [37, 70], "embedding_": [37, 40, 44, 46, 47], "embed": [37, 40, 41, 43, 44, 46, 47, 75], "underli": [37, 40, 44, 46, 47], "n_dimens": [37, 40, 41, 43, 44, 46, 47, 56, 58], "dilat": [38, 47, 62], "stride": [38, 47], "implicit": [38, 47], "side": [38, 47], "output_s": [38, 47], "floor": [38, 47], "get_feature_names_out": [39, 47], "automat": [39, 47, 84], "wrap": [39, 47, 54], "develop": [39, 47, 81, 84], "onetoonefeaturemixin": [39, 47], "classnameprefixfeaturesoutmixin": [39, 47], "help": [39, 47], "descret": [40, 47], "make_pipelin": [40, 47, 62, 83], "make_union": [40, 47, 62], "dempster_hydra": [40, 47], "32": [40, 47, 62, 66], "catch22": [41, 47], "_summar": [41, 47], "x_t": [41, 47], "19633603e": [41, 47], "51047206e": [41, 47], "90000000e": [41, 47], "80000000e": [41, 47], "48441896e": [41, 47], "73293560e": [41, 47], "21476510e": [41, 47], "70000000e": [41, 47], "00000000e": [41, 47], "70502518e": [41, 47], "60000000e": [41, 47], "42857143e": [41, 47], "26666667e": [41, 47], "89974643e": [41, 47], "31570726e": [41, 47], "50000000e": [41, 47], "90873852e": [41, 47], "47311800e": [41, 47], "intervalmixin": 41, "It": [41, 83], "_get_gener": [41, 44], "mean_var_slop": [41, 47, 50, 51], "possibli": [41, 47], "slope": [41, 47], "paralel": [41, 47], "releas": [41, 47], "lock": [41, 47], "gil": [41, 47], "As": [41, 47, 66, 68, 70, 71, 83], "varianc": [41, 47, 67, 70, 83], "suit": [41, 47, 55, 71, 81], "futur": [41, 47, 66, 81], "downstream": [41, 47], "project": [41, 47, 84], "own": [41, 47], "cython": [41, 47, 71], "lubba": [41, 47], "carl": [41, 47], "h": [41, 47], "sarab": [41, 47], "sethi": [41, 47], "philip": [41, 47], "knaut": [41, 47], "simon": [41, 47], "schultz": [41, 47], "ben": [41, 47], "fulcher": [41, 47], "nick": [41, 47], "jone": [41, 47], "canon": [41, 47], "characterist": [41, 47], "33": [41, 47], "1821": [41, 47], "1852": [41, 47], "15": [41, 47], "timepoint": [41, 47], "std": [41, 47, 70], "12": [41, 47, 62, 71, 84], "matrixprofil": [42, 47], "pivotmixin": 43, "rocketmixin": 44, "angu": [44, 47], "exception": [44, 47], "34": [44, 47, 71, 83], "1454": [44, 47], "1495": [44, 47], "51333333": [44, 47], "11526939": [44, 47], "47333333": [44, 47], "04712544": [44, 47], "24": [44, 47], "82912261": [44, 47], "52666667": [44, 47], "26611524": [44, 47], "54": [44, 47, 71], "98047216": [44, 47], "81260641": [44, 47], "54666667": [44, 47], "71210092": [44, 47], "35333333": [44, 47], "28841158": [44, 47], "25333333": [44, 47], "82203705": [44, 47], "72938203": [44, 47], "45333333": [44, 47], "53756324": [44, 47], "24666667": [44, 47], "8380654": [44, 47], "68666667": [44, 47], "80533684": [44, 47], "26": [44, 47, 67], "41709413": [44, 47], "65634235": [44, 47], "66": [44, 47], "94724793": [44, 47], "32666667": [44, 47], "85575661": [44, 47], "67630249": [44, 47], "piecewic": 45, "get_threshold": 45, "suitabl": 45, "normalbin": 45, "assum": [45, 47, 57, 65, 67, 68, 69], "uniformbin": 45, "wistuba": [46, 47], "martin": [46, 47], "josif": [46, 47], "grabocka": [46, 47], "lar": [46, 47], "thiem": [46, 47], "ultra": [46, 47], "preprint": [46, 47], "1503": [46, 47], "05018": [46, 47], "2015": [46, 47], "load_gunpoint": [46, 47], "erp": [46, 47, 70, 71, 81], "min_g": [46, 47], "max_g": [46, 47], "shapeletmixin": [46, 81], "estiom": 46, "basetre": 48, "check_input": [48, 49, 50, 51], "bypass": [48, 49, 50, 51], "sure": [48, 49, 50, 51, 56, 58], "your": [48, 49, 50, 51, 81, 84], "up": [48, 49, 50, 51, 84], "node_count": [48, 49, 50, 51], "tree_": [48, 49, 50, 51], "equvival": [48, 49, 50, 51], "decision_path": [48, 49, 50, 51], "n_node": [48, 49, 50, 51], "nonzero": [48, 49, 50, 51, 65], "travers": [48, 49, 50, 51], "basetreeclassifi": 48, "child": [48, 49, 50, 51], "net": [48, 49, 50, 51], "carri": [48, 49, 50, 51], "don": [48, 49, 50, 51, 84], "know": [48, 49, 50, 51], "what": [48, 49, 50, 51, 79], "basetreeregressor": 48, "msm": [49, 51, 70, 71, 81], "min_c": [49, 51], "max_c": [49, 51], "num_c": [49, 51], "20": [49, 51, 71], "basefeaturetreeclassifi": 50, "basefeaturetreeregressor": 50, "scaled_dtw": [50, 51, 70, 71], "structur": [50, 51], "n_classes_": [50, 51], "run_in_parallel": 52, "parallel_arg": 52, "assert_exhaustive_parameter_check": 53, "assert": 53, "ok": 53, "assert_parameter_check": 53, "skip": [53, 55], "extend": 53, "array_or_scalar": 54, "optional_f": 54, "squeez": 54, "item": 54, "singleton": 54, "recursivlei": 54, "unwrap": 54, "Such": 54, "unstabl": 54, "stabil": 54, "beta": 54, "unsat": 54, "check_estim": 55, "generate_onli": 55, "skip_scikit": 55, "adher": 55, "deleg": [55, 56, 58], "monkei": 55, "patch": 55, "relat": [55, 70], "silent": 55, "tailor": 55, "copi": [56, 58, 71], "ensure_2d": [56, 58], "ensure_ts_arrai": [56, 58], "allow_3d": [56, 58], "allow_nd": [56, 58], "force_all_finit": [56, 58], "multi_output": [56, 58], "ensure_min_sampl": [56, 58], "ensure_min_timestep": [56, 58], "ensure_min_dim": [56, 58], "allow_eo": [56, 58], "y_numer": [56, 58], "y_contigu": [56, 58], "2d": [56, 58, 69, 71, 83], "3d": [56, 58, 69, 71, 83], "finit": [56, 58], "varial": [56, 58], "report": [56, 58, 71], "ravel_1d": [56, 58], "input_nam": [56, 58], "convert": [56, 57, 58, 66, 79], "never": [56, 58, 62, 70], "empti": [56, 58], "attempt": [56, 58], "failur": [56, 58], "convers": [56, 58], "fortran": [56, 58], "style": [56, 58], "noth": [56, 58], "layout": [56, 58], "kept": [56, 58], "trigger": [56, 58], "might": [56, 58], "ravel": [56, 58], "neither": [56, 58], "eo": [56, 58, 59, 65, 67, 69], "nan": [56, 58, 65, 69, 81], "pd": [56, 58], "na": [56, 58], "cannot": [56, 58], "infinit": [56, 58], "row": [56, 58, 69], "disabl": [56, 58, 83], "reject": [56, 58], "enforc": [56, 58], "pass": [56, 58, 71, 79, 81], "midpointnorm": 57, "vmin": 57, "vmax": 57, "midpoint": 57, "normalis": 57, "autoscal": 57, "autoscale_non": 57, "static": 57, "process_valu": 57, "homogen": 57, "effici": [57, 81], "mask": 57, "is_scalar": 57, "byte": 57, "smaller": 57, "float32": 57, "float64": 57, "place": 57, "oper": [57, 66, 67, 68, 83, 84], "greatli": 57, "improv": [57, 66], "speed": 57, "plot_frequency_domain": 57, "jitter": 57, "sample_spac": 57, "cmap": 57, "dark2": 57, "freqenc": 57, "matplotlib": [57, 67], "line": [57, 84], "colormap": 57, "plot_time_domain": 57, "linewidth": 57, "zorder": 57, "show_legend": 57, "opac": 57, "width": 57, "color": 57, "legend": 57, "check_classification_target": 58, "valueerror": 58, "check_opt": 58, "option_valu": 58, "check_typ": 58, "target_typ": 58, "variabl": [59, 69, 84], "get_variable_length": 59, "lenght": 59, "is_end_of_seri": [59, 69], "wise": [59, 67, 83], "is_variable_length": 59, "wildboar": [62, 63, 65, 66, 67, 68, 69, 70, 71, 76, 79, 81, 83], "dempsar": 62, "emploi": 62, "sligtli": 62, "manner": 62, "activ": [62, 84], "record": 62, "exponenti": 62, "Then": [62, 83], "had": 62, "stackingclassifi": 62, "ridgeclassifiercv": 62, "standardscal": 62, "sparsescal": 62, "purpos": [62, 71, 83], "motestrain": 62, "heavi": 62, "here": [62, 68, 84], "impos": 62, "account": 62, "sparsiti": 62, "rememb": 62, "count": 62, "cases": 62, "ridg": [62, 75], "x27": 62, "jupyt": 62, "environ": [62, 84], "rerun": 62, "cell": 62, "html": 62, "trust": [62, 83], "notebook": 62, "On": [62, 70], "github": [62, 84], "unabl": 62, "render": 62, "page": 62, "nbviewer": 62, "org": [62, 68, 84], "pipelinepipelin": 62, "hydratransformhydratransform": 62, "sparsescalersparsescal": 62, "ridgeclassifiercvridgeclassifiercv": 62, "9937106918238994": 62, "similarli": [62, 71], "scaler": 62, "rockettransformrockettransform": 62, "standardscalerstandardscal": 62, "paper": 62, "To": [62, 66, 67, 68, 69, 79, 84], "inflat": 62, "author": 62, "alloc": 62, "concaten": 62, "nth": 62, "hydra_diff": 62, "featureunion": 62, "transformer_list": 62, "featureunionfeatureunion": 62, "hydratransformhydratransformhydratransform": 62, "pipelinedifftransformdifftransform": 62, "9905660377358491": 62, "again": 62, "substitut": 62, "rocket_diff": 62, "5000": 62, "rockettransformrockettransformrockettransform": 62, "14": [62, 71], "limit": 62, "signific": 62, "intend": 63, "offer": [63, 66], "wherea": [65, 74], "context": 65, "multivaret": 65, "howev": [65, 66, 68, 71], "unequ": [65, 67, 70], "ieee754": 65, "treat": 65, "isnan": [65, 69], "wb": 65, "t1": 65, "t2": 65, "t3": 65, "vstack": 65, "pip": [66, 79, 84], "conda": 66, "advanc": 66, "previous": [66, 73, 81, 83], "entri": 66, "hope": 66, "One": [66, 67, 83], "drawback": 66, "asset": 66, "demand": [66, 68], "small": [66, 79], "experi": 66, "brows": 66, "688": 66, "43": 66, "kb": 66, "668": 66, "python": [66, 68, 71, 81, 83, 84], "bit": [66, 84], "conform": 66, "common": [66, 67, 69, 70, 84], "workflow": [66, 71], "comparis": 66, "explanatori": 66, "n_label": 66, "greater": 66, "exactli": [66, 69], "respect": [66, 68, 74], "chain": 66, "large_multivari": 66, "large_multiclass": 66, "0x7f262ce95d00": 66, "predefin": 67, "contrast": 67, "our": 67, "simplifi": [67, 83], "applic": 67, "enumer": [67, 84], "abov": [67, 70, 83], "snippet": [67, 83], "could": 67, "rewritten": 67, "crude": 67, "deal": 67, "longer": 67, "accomplish": [67, 71], "argmax": 67, "pyplot": 67, "plt": 67, "fig": 67, "subplot": 67, "nrow": 67, "scatter": 67, "arang": 67, "marker": 67, "set_ylabel": 67, "spokenarabicdigit": 67, "ucrmt": 67, "figur": 67, "loss": 67, "togeth": 68, "compos": 68, "written": 68, "letter": 68, "regular": 68, "alphanumer": 68, "charact": 68, "za": 68, "z0": 68, "revis": 68, "z": [68, 70], "exemplifi": 68, "hard": 68, "interfac": [68, 83], "endpoint": 68, "http": [68, 84], "www": 68, "repo": 68, "addition": 68, "offlin": 68, "disk": [68, 83], "localappdata": 68, "gnu": [68, 84], "linux": [68, 84], "xdg_cache_hom": 68, "unset": 68, "maco": [68, 84], "librarycach": 68, "fallback": 68, "long": 68, "session": 68, "func": [68, 71], "bundle_url": 68, "example1": 68, "altern": [68, 84], "remot": 68, "sha": 68, "sha1": 68, "hash": 68, "npy": 68, "npz": 68, "save": 68, "savez": 68, "dataset_nam": 68, "_train": 68, "_test": 68, "That": 68, "separ": [68, 79], "embrac": 69, "asarrai": 69, "produc": [69, 73], "rank": 69, "arr": 69, "shorter": [69, 70], "These": 70, "loos": 70, "obei": 70, "inequ": 70, "itself": 70, "distinct": 70, "gt": 70, "ne": 70, "symmetr": 70, "sai": 70, "triangl": [70, 71], "hold": [70, 83], "lt": 70, "shortcut": 70, "through": [70, 84], "three": [70, 71], "categori": [70, 83], "lp": 70, "norm": 70, "shift": 70, "distinguish": 70, "min_": 70, "notat": 70, "_elastic_": 70, "slide": 70, "need": [70, 71, 81, 84], "moreov": 70, "comment": 70, "undefin": 70, "mass": [70, 71], "minkowski": [70, 71], "chebyshev": [70, 71], "angular": [70, 71, 81], "phase": 70, "ddtw": [70, 71], "wddtw": [70, 71], "longest": 70, "lcss": [70, 71, 81], "edit": [70, 84], "gap": 70, "edr": [70, 71, 81], "twe": [70, 71, 81], "edit_penalti": 70, "stiff": [70, 71], "lambda": 70, "nu": 70, "hirschberg": 70, "1977": 70, "problem": [70, 79, 83], "journal": 70, "jacm": 70, "chen": 70, "l": 70, "ng": 70, "2004": 70, "marriag": 70, "thirtieth": 70, "\u00f6zsu": 70, "oria": 70, "2005": 70, "robust": [70, 81, 83], "trajectori": 70, "manag": 70, "stefan": 70, "athitso": 70, "transact": 70, "1425": 70, "1438": 70, "marteau": 70, "2008": 70, "adjust": 70, "analysi": 70, "intellig": 70, "31": [70, 83], "306": 70, "318": 70, "involv": [71, 83], "_euclidean": 71, "51158857": 71, "11514381": 71, "35905618": 71, "mirror": 71, "imag": 71, "halv": 71, "advis": 71, "tri": 71, "smart": 71, "85497117": 71, "96086309": 71, "18777928": 71, "00606825": 71, "23060212": 71, "27419835": 71, "64445581": 71, "38965963": 71, "79102936": 71, "59756098": 71, "47560976": 71, "64634146": 71, "08536585": 71, "03658537": 71, "13414634": 71, "09756098": 71, "25609756": 71, "12195122": 71, "76": 71, "20881199": 71, "73": 71, "62554784": 71, "88": 71, "5536877": 71, "27": 71, "49142159": 71, "56024904": 71, "24551102": 71, "45513015": 71, "81": 71, "60658533": 71, "06099416": 71, "multitud": 71, "reshap": 71, "48683192": 71, "60301954": 71, "34083722": 71, "35954558": 71, "sometim": 71, "_pairs_": 71, "elast": [71, 81], "50816474": 71, "3299048": 71, "55193242": 71, "interdimension": 71, "50507001": 71, "90920635": 71, "27646127": 71, "60041068": 71, "60786006": 71, "75645164": 71, "26677146": 71, "24823344": 71, "interest": 71, "slice": 71, "want": [71, 84], "avoid": [71, 84], "unwant": 71, "limits_": 71, "queri": 71, "le": 71, "counterpart": 71, "_threshold_": 71, "jag": 71, "66371456": 71, "11914265": 71, "13076667": 71, "99043671": 71, "73408875": 71, "84227457": 71, "2028058": 71, "85972633": 71, "85367621": 71, "86957415": 71, "64041732": 71, "33156061": 71, "56698045": 71, "99489626": 71, "6790517": 71, "16754772": 71, "10973127": 71, "50583639": 71, "def": 71, "pairwise_sd_ful": 71, "stack": 71, "21688671": 71, "83210644": 71, "50884094": 71, "18507116": 71, "11177626": 71, "15611733": 71, "21780536": 71, "13350353": 71, "09710811": 71, "75114125": 71, "13489775": 71, "09806374": 71, "idx": 71, "28": 71, "third": 71, "continu": [71, 83], "investig": 71, "particular": [71, 83], "task": [71, 74, 75, 79, 83], "cpu": 71, "inspect": 71, "theoret": 71, "complex": 71, "magnitud": 71, "97686": 71, "87686": 71, "98368": 71, "98282": 71, "11131": 71, "98268": 71, "95506": 71, "14157": 71, "96041": 71, "94631": 71, "83231": 71, "92207": 71, "55527": 71, "73285": 71, "55538": 71, "41892": 71, "40887": 71, "42778": 71, "00061": 71, "00104": 71, "00064": 71, "wlcss": 71, "00054": 71, "00091": 71, "00056": 71, "00030": 71, "00052": 71, "00032": 71, "00028": 71, "00048": 71, "00029": 71, "00021": 71, "00035": 71, "00022": 71, "00019": 71, "82372": 71, "49048": 71, "79202": 71, "66394": 71, "75967": 71, "67113": 71, "56287": 71, "61275": 71, "56196": 71, "text": 71, "49453": 71, "59627": 71, "49988": 71, "42765": 71, "58025": 71, "43553": 71, "42761": 71, "58982": 71, "43474": 71, "21051": 71, "33659": 71, "21757": 71, "06851": 71, "10321": 71, "07092": 71, "00216": 71, "00413": 71, "00226": 71, "00146": 71, "00278": 71, "00153": 71, "00102": 71, "00195": 71, "00107": 71, "00194": 71, "00106": 71, "00099": 71, "00190": 71, "00189": 71, "00103": 71, "00097": 71, "00185": 71, "00101": 71, "00096": 71, "00182": 71, "00100": 71, "00095": 71, "00181": 71, "00071": 71, "00136": 71, "00074": 71, "rakthanmanon": 71, "campana": 71, "mueen": 71, "batista": 71, "westov": 71, "zhu": 71, "q": 71, "zakaria": 71, "2012": 71, "august": 71, "trillion": 71, "under": [71, 84], "18th": 71, "262": 71, "270": 71, "goal": [73, 83], "unseen": [73, 83], "varieti": 74, "excel": 74, "baselin": 74, "highli": 74, "often": [75, 83], "art": 75, "emmott_label": 79, "primari": 79, "focu": [79, 83], "oppos": 79, "perhap": 79, "minority_label": 79, "majority_label": 79, "sophist": 79, "publish": 79, "randomforestclassifi": 79, "four": 79, "75": 79, "quantil": 79, "manual": [80, 84], "enhanc": 81, "someth": 81, "couldn": 81, "now": 81, "miscellan": 81, "didn": 81, "document": [81, 83, 84], "17": 81, "scipi": 81, "compar": 81, "3darrai": 81, "issu": [81, 84], "bug": 81, "incorrect": 81, "_distanc": 81, "distancemeasur": 81, "subsequencedistancemeasur": 81, "subsequencemetr": 81, "affect": 81, "cimport": 81, "constructor": 81, "incorrectli": 81, "drop": 81, "undeprec": 81, "old": 81, "migrat": 81, "framework": [81, 83], "forecast": 83, "unfamiliar": 83, "chronolog": 83, "logic": 83, "solv": 83, "concern": 83, "supervis": 83, "nomin": 83, "unlabel": 83, "essenti": [83, 84], "acquir": 83, "commun": 83, "access": [83, 84], "achiev": 83, "opt": 83, "prefer": 83, "irrespect": 83, "floodmodeling1": 83, "uea": 83, "extrins": 83, "tsereg": 83, "clf": 83, "experiment": 83, "clone": [83, 84], "screen": 83, "despit": 83, "even": 83, "tabluar_x": 83, "design": 83, "interoper": 83, "logisticregress": 83, "bad": 83, "practic": 83, "proper": 83, "reason": 83, "respons": 83, "break": 83, "reevalu": 83, "relianc": 83, "visual": [83, 84], "importance_": 83, "pickl": 83, "repr": 83, "dump": 83, "earlier": 83, "clf_": 83, "older": 83, "newer": 83, "vice": 83, "versa": 83, "secur": 83, "unpickl": 83, "There": 84, "offici": 84, "pypi": 84, "recommend": 84, "fastest": 84, "platform": 84, "built": 84, "write": 84, "due": 84, "mistak": 84, "incompat": 84, "19": 84, "conflict": 84, "strongli": 84, "virtual": 84, "venv": 84, "python3": 84, "folder": 84, "ceavet": 84, "outsid": 84, "scope": 84, "debian": 84, "apt": 84, "homebrew": 84, "brew": 84, "anaconda": 84, "miniconda": 84, "pull": 84, "process": 84, "git": 84, "com": 84, "isaksamsten": 84, "tool": 84, "studio": 84, "command": 84, "cmd": 84, "consol": 84, "distutils_use_sdk": 84, "program": 84, "x86": 84, "microsoft": 84, "buildtool": 84, "vc": 84, "auxiliari": 84, "vcvarsal": 84, "bat": 84, "x64": 84, "xcode": 84, "ubuntu": 84, "dev": 84, "txt": 84, "mode": 84, "eas": 84, "wildboar_build": 84, "architectur": 84}, "objects": {"": [[25, 0, 0, "-", "wildboar"]], "wildboar": [[3, 0, 0, "-", "annotate"], [4, 0, 0, "-", "base"], [7, 0, 0, "-", "datasets"], [15, 0, 0, "-", "distance"], [17, 0, 0, "-", "ensemble"], [24, 0, 0, "-", "explain"], [25, 1, 1, "", "iseos"], [30, 0, 0, "-", "linear_model"], [33, 0, 0, "-", "metrics"], [36, 0, 0, "-", "model_selection"], [47, 0, 0, "-", "transform"], [51, 0, 0, "-", "tree"], [56, 0, 0, "-", "utils"], [60, 0, 0, "-", "version"]], "wildboar.annotate": [[1, 0, 0, "-", "_motifs"], [2, 0, 0, "-", "_segment"], [3, 1, 1, "", "motifs"], [3, 1, 1, "", "segment"]], "wildboar.annotate._motifs": [[1, 1, 1, "", "motifs"]], "wildboar.annotate._segment": [[2, 1, 1, "", "segment"]], "wildboar.base": [[4, 2, 1, "", "BaseEstimator"], [4, 2, 1, "", "CounterfactualMixin"], [4, 2, 1, "", "ExplainerMixin"], [4, 1, 1, "", "is_counterfactual"], [4, 1, 1, "", "is_explainer"]], "wildboar.base.BaseEstimator": [[4, 3, 1, "", "get_metadata_routing"], [4, 3, 1, "", "get_params"], [4, 3, 1, "", "set_params"]], "wildboar.base.CounterfactualMixin": [[4, 3, 1, "", "score"]], "wildboar.base.ExplainerMixin": [[4, 3, 1, "", "fit_explain"], [4, 3, 1, "", "plot"]], "wildboar.datasets": [[7, 2, 1, "", "Bundle"], [7, 2, 1, "", "JSONRepository"], [7, 2, 1, "", "NpBundle"], [7, 2, 1, "", "Repository"], [5, 0, 0, "-", "_filter"], [6, 0, 0, "-", "_repository"], [7, 1, 1, "", "clear_cache"], [7, 1, 1, "", "get_bundles"], [7, 1, 1, "", "get_repository"], [7, 1, 1, "", "install_repository"], [7, 1, 1, "", "list_bundles"], [7, 1, 1, "", "list_collections"], [7, 1, 1, "", "list_datasets"], [7, 1, 1, "", "list_repositories"], [7, 1, 1, "", "load_dataset"], [7, 1, 1, "", "load_datasets"], [7, 1, 1, "", "load_gun_point"], [7, 1, 1, "", "load_synthetic_control"], [7, 1, 1, "", "load_two_lead_ecg"], [8, 0, 0, "-", "outlier"], [9, 0, 0, "-", "preprocess"], [7, 1, 1, "", "refresh_repositories"], [7, 1, 1, "", "set_cache_dir"]], "wildboar.datasets.Bundle": [[7, 3, 1, "", "get_collection"], [7, 3, 1, "", "get_filename"], [7, 3, 1, "", "list"], [7, 3, 1, "", "load"]], "wildboar.datasets.JSONRepository": [[7, 4, 1, "", "download_url"], [7, 3, 1, "", "get_bundle"], [7, 3, 1, "", "get_bundles"], [7, 4, 1, "", "name"], [7, 3, 1, "", "refresh"], [7, 4, 1, "", "version"], [7, 4, 1, "", "wildboar_requires"]], "wildboar.datasets.NpBundle": [[7, 3, 1, "", "get_collection"], [7, 3, 1, "", "get_filename"], [7, 3, 1, "", "list"], [7, 3, 1, "", "load"]], "wildboar.datasets.Repository": [[7, 4, 1, "", "download_url"], [7, 3, 1, "", "get_bundle"], [7, 3, 1, "", "get_bundles"], [7, 4, 1, "", "name"], [7, 3, 1, "", "refresh"], [7, 4, 1, "", "version"], [7, 4, 1, "", "wildboar_requires"]], "wildboar.datasets._filter": [[5, 1, 1, "", "make_dict_filter"], [5, 1, 1, "", "make_filter"], [5, 1, 1, "", "make_list_filter"], [5, 1, 1, "", "make_str_filter"]], "wildboar.datasets._repository": [[6, 2, 1, "", "Bundle"], [6, 2, 1, "", "JSONRepository"], [6, 2, 1, "", "NpBundle"], [6, 2, 1, "", "Repository"]], "wildboar.datasets._repository.Bundle": [[6, 3, 1, "", "get_collection"], [6, 3, 1, "", "get_filename"], [6, 3, 1, "", "list"], [6, 3, 1, "", "load"]], "wildboar.datasets._repository.JSONRepository": [[6, 4, 1, "", "download_url"], [6, 3, 1, "", "get_bundle"], [6, 3, 1, "", "get_bundles"], [6, 4, 1, "", "name"], [6, 3, 1, "", "refresh"], [6, 4, 1, "", "version"], [6, 4, 1, "", "wildboar_requires"]], "wildboar.datasets._repository.NpBundle": [[6, 3, 1, "", "get_collection"], [6, 3, 1, "", "get_filename"], [6, 3, 1, "", "list"], [6, 3, 1, "", "load"]], "wildboar.datasets._repository.Repository": [[6, 4, 1, "", "download_url"], [6, 3, 1, "", "get_bundle"], [6, 3, 1, "", "get_bundles"], [6, 4, 1, "", "name"], [6, 3, 1, "", "refresh"], [6, 4, 1, "", "version"], [6, 4, 1, "", "wildboar_requires"]], "wildboar.datasets.outlier": [[8, 1, 1, "", "density_outliers"], [8, 1, 1, "", "emmott_outliers"], [8, 1, 1, "", "kmeans_outliers"], [8, 1, 1, "", "majority_outliers"], [8, 1, 1, "", "minority_outliers"]], "wildboar.datasets.preprocess": [[9, 1, 1, "", "maxabs_scale"], [9, 1, 1, "", "minmax_scale"], [9, 1, 1, "", "named_preprocess"], [9, 1, 1, "", "standardize"], [9, 1, 1, "", "truncate"]], "wildboar.distance": [[15, 2, 1, "", "KMeans"], [15, 2, 1, "", "KMedoids"], [15, 2, 1, "", "KNeighborsClassifier"], [10, 0, 0, "-", "_distance"], [11, 0, 0, "-", "_matrix_profile"], [12, 0, 0, "-", "_multi_metric"], [13, 0, 0, "-", "_neighbors"], [14, 0, 0, "-", "dtw"], [15, 1, 1, "", "matrix_profile"], [15, 1, 1, "", "paired_distance"], [15, 1, 1, "", "paired_subsequence_distance"], [15, 1, 1, "", "paired_subsequence_match"], [15, 1, 1, "", "pairwise_distance"], [15, 1, 1, "", "pairwise_subsequence_distance"], [15, 1, 1, "", "subsequence_match"]], "wildboar.distance.KMeans": [[15, 3, 1, "", "fit"], [15, 3, 1, "", "fit_predict"], [15, 3, 1, "", "fit_transform"], [15, 3, 1, "", "get_metadata_routing"], [15, 3, 1, "", "get_params"], [15, 3, 1, "", "predict"], [15, 3, 1, "", "set_output"], [15, 3, 1, "", "set_params"], [15, 3, 1, "", "transform"]], "wildboar.distance.KMedoids": [[15, 3, 1, "", "fit"], [15, 3, 1, "", "fit_predict"], [15, 3, 1, "", "fit_transform"], [15, 3, 1, "", "get_metadata_routing"], [15, 3, 1, "", "get_params"], [15, 3, 1, "", "predict"], [15, 3, 1, "", "set_output"], [15, 3, 1, "", "set_params"], [15, 3, 1, "", "transform"]], "wildboar.distance.KNeighborsClassifier": [[15, 3, 1, "", "fit"], [15, 3, 1, "", "get_metadata_routing"], [15, 3, 1, "", "get_params"], [15, 3, 1, "", "predict"], [15, 3, 1, "", "predict_proba"], [15, 3, 1, "", "score"], [15, 3, 1, "", "set_params"]], "wildboar.distance._distance": [[10, 1, 1, "", "paired_distance"], [10, 1, 1, "", "paired_subsequence_distance"], [10, 1, 1, "", "paired_subsequence_match"], [10, 1, 1, "", "pairwise_distance"], [10, 1, 1, "", "pairwise_subsequence_distance"], [10, 1, 1, "", "subsequence_match"]], "wildboar.distance._matrix_profile": [[11, 1, 1, "", "matrix_profile"]], "wildboar.distance._neighbors": [[13, 2, 1, "", "KMeans"], [13, 2, 1, "", "KMedoids"], [13, 2, 1, "", "KNeighborsClassifier"]], "wildboar.distance._neighbors.KMeans": [[13, 3, 1, "", "fit"], [13, 3, 1, "", "fit_predict"], [13, 3, 1, "", "fit_transform"], [13, 3, 1, "", "get_metadata_routing"], [13, 3, 1, "", "get_params"], [13, 3, 1, "", "predict"], [13, 3, 1, "", "set_output"], [13, 3, 1, "", "set_params"], [13, 3, 1, "", "transform"]], "wildboar.distance._neighbors.KMedoids": [[13, 3, 1, "", "fit"], [13, 3, 1, "", "fit_predict"], [13, 3, 1, "", "fit_transform"], [13, 3, 1, "", "get_metadata_routing"], [13, 3, 1, "", "get_params"], [13, 3, 1, "", "predict"], [13, 3, 1, "", "set_output"], [13, 3, 1, "", "set_params"], [13, 3, 1, "", "transform"]], "wildboar.distance._neighbors.KNeighborsClassifier": [[13, 3, 1, "", "fit"], [13, 3, 1, "", "get_metadata_routing"], [13, 3, 1, "", "get_params"], [13, 3, 1, "", "predict"], [13, 3, 1, "", "predict_proba"], [13, 3, 1, "", "score"], [13, 3, 1, "", "set_params"]], "wildboar.distance.dtw": [[14, 1, 1, "", "ddtw_distance"], [14, 1, 1, "", "dtw_alignment"], [14, 1, 1, "", "dtw_average"], [14, 1, 1, "", "dtw_distance"], [14, 1, 1, "", "dtw_envelop"], [14, 1, 1, "", "dtw_lb_keogh"], [14, 1, 1, "", "dtw_mapping"], [14, 1, 1, "", "jeong_weight"], [14, 1, 1, "", "wddtw_distance"], [14, 1, 1, "", "wdtw_alignment"], [14, 1, 1, "", "wdtw_distance"]], "wildboar.ensemble": [[17, 2, 1, "", "BaggingClassifier"], [17, 2, 1, "", "BaggingRegressor"], [17, 2, 1, "", "BaseBagging"], [17, 2, 1, "", "ExtraShapeletTreesClassifier"], [17, 2, 1, "", "ExtraShapeletTreesRegressor"], [17, 2, 1, "", "IntervalForestClassifier"], [17, 2, 1, "", "IntervalForestRegressor"], [17, 2, 1, "", "IsolationShapeletForest"], [17, 2, 1, "", "PivotForestClassifier"], [17, 2, 1, "", "ProximityForestClassifier"], [17, 2, 1, "", "RocketForestClassifier"], [17, 2, 1, "", "RocketForestRegressor"], [17, 2, 1, "", "ShapeletForestClassifier"], [17, 2, 1, "", "ShapeletForestEmbedding"], [17, 2, 1, "", "ShapeletForestRegressor"], [16, 0, 0, "-", "_ensemble"]], "wildboar.ensemble.BaggingClassifier": [[17, 4, 1, "", "base_estimator_"], [17, 3, 1, "", "decision_function"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "predict_log_proba"], [17, 3, 1, "", "predict_proba"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.BaggingRegressor": [[17, 4, 1, "", "base_estimator_"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.BaseBagging": [[17, 4, 1, "", "base_estimator_"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.ExtraShapeletTreesClassifier": [[17, 4, 1, "", "base_estimator_"], [17, 3, 1, "", "decision_function"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "predict_log_proba"], [17, 3, 1, "", "predict_proba"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.ExtraShapeletTreesRegressor": [[17, 4, 1, "", "base_estimator_"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.IntervalForestClassifier": [[17, 4, 1, "", "base_estimator_"], [17, 3, 1, "", "decision_function"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "predict_log_proba"], [17, 3, 1, "", "predict_proba"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.IntervalForestRegressor": [[17, 4, 1, "", "base_estimator_"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.IsolationShapeletForest": [[17, 4, 1, "", "base_estimator_"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "fit_predict"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.PivotForestClassifier": [[17, 4, 1, "", "base_estimator_"], [17, 3, 1, "", "decision_function"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "predict_log_proba"], [17, 3, 1, "", "predict_proba"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.ProximityForestClassifier": [[17, 4, 1, "", "base_estimator_"], [17, 3, 1, "", "decision_function"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "predict_log_proba"], [17, 3, 1, "", "predict_proba"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.RocketForestClassifier": [[17, 4, 1, "", "base_estimator_"], [17, 3, 1, "", "decision_function"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "predict_log_proba"], [17, 3, 1, "", "predict_proba"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.RocketForestRegressor": [[17, 4, 1, "", "base_estimator_"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.ShapeletForestClassifier": [[17, 4, 1, "", "base_estimator_"], [17, 3, 1, "", "decision_function"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "predict_log_proba"], [17, 3, 1, "", "predict_proba"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.ShapeletForestEmbedding": [[17, 4, 1, "", "base_estimator_"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble.ShapeletForestRegressor": [[17, 4, 1, "", "base_estimator_"], [17, 4, 1, "", "estimators_samples_"], [17, 3, 1, "", "fit"], [17, 3, 1, "", "get_metadata_routing"], [17, 3, 1, "", "get_params"], [17, 3, 1, "", "predict"], [17, 3, 1, "", "score"], [17, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble": [[16, 2, 1, "", "BaggingClassifier"], [16, 2, 1, "", "BaggingRegressor"], [16, 2, 1, "", "BaseBagging"], [16, 2, 1, "", "BaseForestClassifier"], [16, 2, 1, "", "BaseForestRegressor"], [16, 2, 1, "", "BaseShapeletForestClassifier"], [16, 2, 1, "", "BaseShapeletForestRegressor"], [16, 2, 1, "", "ExtraShapeletTreesClassifier"], [16, 2, 1, "", "ExtraShapeletTreesRegressor"], [16, 2, 1, "", "ForestMixin"], [16, 2, 1, "", "IntervalForestClassifier"], [16, 2, 1, "", "IntervalForestRegressor"], [16, 2, 1, "", "IsolationShapeletForest"], [16, 2, 1, "", "PivotForestClassifier"], [16, 2, 1, "", "ProximityForestClassifier"], [16, 2, 1, "", "RocketForestClassifier"], [16, 2, 1, "", "RocketForestRegressor"], [16, 2, 1, "", "ShapeletForestClassifier"], [16, 2, 1, "", "ShapeletForestEmbedding"], [16, 2, 1, "", "ShapeletForestRegressor"]], "wildboar.ensemble._ensemble.BaggingClassifier": [[16, 4, 1, "", "base_estimator_"], [16, 3, 1, "", "decision_function"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "predict_log_proba"], [16, 3, 1, "", "predict_proba"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.BaggingRegressor": [[16, 4, 1, "", "base_estimator_"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.BaseBagging": [[16, 4, 1, "", "base_estimator_"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.BaseForestClassifier": [[16, 4, 1, "", "base_estimator_"], [16, 3, 1, "", "decision_function"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "predict_log_proba"], [16, 3, 1, "", "predict_proba"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.BaseForestRegressor": [[16, 4, 1, "", "base_estimator_"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.BaseShapeletForestClassifier": [[16, 4, 1, "", "base_estimator_"], [16, 3, 1, "", "decision_function"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "predict_log_proba"], [16, 3, 1, "", "predict_proba"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.BaseShapeletForestRegressor": [[16, 4, 1, "", "base_estimator_"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier": [[16, 4, 1, "", "base_estimator_"], [16, 3, 1, "", "decision_function"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "predict_log_proba"], [16, 3, 1, "", "predict_proba"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.ExtraShapeletTreesRegressor": [[16, 4, 1, "", "base_estimator_"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.IntervalForestClassifier": [[16, 4, 1, "", "base_estimator_"], [16, 3, 1, "", "decision_function"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "predict_log_proba"], [16, 3, 1, "", "predict_proba"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.IntervalForestRegressor": [[16, 4, 1, "", "base_estimator_"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.IsolationShapeletForest": [[16, 4, 1, "", "base_estimator_"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "fit_predict"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.PivotForestClassifier": [[16, 4, 1, "", "base_estimator_"], [16, 3, 1, "", "decision_function"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "predict_log_proba"], [16, 3, 1, "", "predict_proba"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.ProximityForestClassifier": [[16, 4, 1, "", "base_estimator_"], [16, 3, 1, "", "decision_function"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "predict_log_proba"], [16, 3, 1, "", "predict_proba"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.RocketForestClassifier": [[16, 4, 1, "", "base_estimator_"], [16, 3, 1, "", "decision_function"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "predict_log_proba"], [16, 3, 1, "", "predict_proba"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.RocketForestRegressor": [[16, 4, 1, "", "base_estimator_"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.ShapeletForestClassifier": [[16, 4, 1, "", "base_estimator_"], [16, 3, 1, "", "decision_function"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "predict_log_proba"], [16, 3, 1, "", "predict_proba"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.ShapeletForestEmbedding": [[16, 4, 1, "", "base_estimator_"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.ensemble._ensemble.ShapeletForestRegressor": [[16, 4, 1, "", "base_estimator_"], [16, 4, 1, "", "estimators_samples_"], [16, 3, 1, "", "fit"], [16, 3, 1, "", "get_metadata_routing"], [16, 3, 1, "", "get_params"], [16, 3, 1, "", "predict"], [16, 3, 1, "", "score"], [16, 3, 1, "", "set_params"]], "wildboar.explain": [[24, 2, 1, "", "AmplitudeImportance"], [24, 2, 1, "", "IntervalImportance"], [24, 2, 1, "", "ShapeletImportance"], [18, 0, 0, "-", "_importance"], [23, 0, 0, "-", "counterfactual"], [24, 1, 1, "", "plot_importances"]], "wildboar.explain.AmplitudeImportance": [[24, 3, 1, "", "fit_explain"], [24, 3, 1, "", "get_metadata_routing"], [24, 3, 1, "", "get_params"], [24, 3, 1, "", "plot"], [24, 3, 1, "", "set_params"]], "wildboar.explain.IntervalImportance": [[24, 3, 1, "", "fit_explain"], [24, 3, 1, "", "get_metadata_routing"], [24, 3, 1, "", "get_params"], [24, 3, 1, "", "plot"], [24, 3, 1, "", "set_params"]], "wildboar.explain.ShapeletImportance": [[24, 3, 1, "", "fit_explain"], [24, 3, 1, "", "get_metadata_routing"], [24, 3, 1, "", "get_params"], [24, 3, 1, "", "plot"], [24, 3, 1, "", "set_params"]], "wildboar.explain._importance": [[18, 2, 1, "", "AmplitudeImportance"], [18, 2, 1, "", "IntervalImportance"], [18, 2, 1, "", "PermuteImportance"], [18, 2, 1, "", "ShapeletImportance"], [18, 1, 1, "", "plot_importances"]], "wildboar.explain._importance.AmplitudeImportance": [[18, 3, 1, "", "fit_explain"], [18, 3, 1, "", "get_metadata_routing"], [18, 3, 1, "", "get_params"], [18, 3, 1, "", "plot"], [18, 3, 1, "", "set_params"]], "wildboar.explain._importance.IntervalImportance": [[18, 3, 1, "", "fit_explain"], [18, 3, 1, "", "get_metadata_routing"], [18, 3, 1, "", "get_params"], [18, 3, 1, "", "plot"], [18, 3, 1, "", "set_params"]], "wildboar.explain._importance.PermuteImportance": [[18, 3, 1, "", "get_metadata_routing"], [18, 3, 1, "", "get_params"], [18, 3, 1, "", "set_params"]], "wildboar.explain._importance.ShapeletImportance": [[18, 3, 1, "", "fit_explain"], [18, 3, 1, "", "get_metadata_routing"], [18, 3, 1, "", "get_params"], [18, 3, 1, "", "plot"], [18, 3, 1, "", "set_params"]], "wildboar.explain.counterfactual": [[23, 2, 1, "", "KNeighborsCounterfactual"], [23, 2, 1, "", "PrototypeCounterfactual"], [23, 2, 1, "", "ShapeletForestCounterfactual"], [19, 0, 0, "-", "_helper"], [20, 0, 0, "-", "_nn"], [21, 0, 0, "-", "_proto"], [22, 0, 0, "-", "_sf"], [23, 1, 1, "", "counterfactuals"], [23, 1, 1, "", "proximity"]], "wildboar.explain.counterfactual.KNeighborsCounterfactual": [[23, 3, 1, "", "fit_explain"], [23, 3, 1, "", "get_metadata_routing"], [23, 3, 1, "", "get_params"], [23, 3, 1, "", "plot"], [23, 3, 1, "", "score"], [23, 3, 1, "", "set_params"]], "wildboar.explain.counterfactual.PrototypeCounterfactual": [[23, 3, 1, "", "fit_explain"], [23, 3, 1, "", "get_metadata_routing"], [23, 3, 1, "", "get_params"], [23, 3, 1, "", "plot"], [23, 3, 1, "", "score"], [23, 3, 1, "", "set_params"]], "wildboar.explain.counterfactual.ShapeletForestCounterfactual": [[23, 3, 1, "", "fit_explain"], [23, 3, 1, "", "get_metadata_routing"], [23, 3, 1, "", "get_params"], [23, 3, 1, "", "plot"], [23, 3, 1, "", "score"], [23, 3, 1, "", "set_params"]], "wildboar.explain.counterfactual._helper": [[19, 1, 1, "", "counterfactuals"]], "wildboar.explain.counterfactual._nn": [[20, 2, 1, "", "KNeighborsCounterfactual"]], "wildboar.explain.counterfactual._nn.KNeighborsCounterfactual": [[20, 3, 1, "", "fit_explain"], [20, 3, 1, "", "get_metadata_routing"], [20, 3, 1, "", "get_params"], [20, 3, 1, "", "plot"], [20, 3, 1, "", "score"], [20, 3, 1, "", "set_params"]], "wildboar.explain.counterfactual._proto": [[21, 2, 1, "", "DynamicTimeWarpTransform"], [21, 2, 1, "", "EuclideanTransform"], [21, 2, 1, "", "KNearestPrototypeSampler"], [21, 2, 1, "", "KNearestShapeletPrototypeSampler"], [21, 2, 1, "", "MetricTransform"], [21, 2, 1, "", "PredictEvaluator"], [21, 2, 1, "", "ProbabilityEvaluator"], [21, 2, 1, "", "PrototypeCounterfactual"], [21, 2, 1, "", "PrototypeSampler"], [21, 2, 1, "", "ShapeletPrototypeSampler"], [21, 2, 1, "", "TargetEvaluator"], [21, 2, 1, "", "UniformPrototypeSampler"], [21, 2, 1, "", "WeightedDynamicTimeWarpTransform"]], "wildboar.explain.counterfactual._proto.DynamicTimeWarpTransform": [[21, 3, 1, "", "move"]], "wildboar.explain.counterfactual._proto.EuclideanTransform": [[21, 3, 1, "", "move"]], "wildboar.explain.counterfactual._proto.KNearestPrototypeSampler": [[21, 3, 1, "", "move"], [21, 3, 1, "", "nearest_index"], [21, 3, 1, "", "sample"], [21, 3, 1, "", "sample_move"]], "wildboar.explain.counterfactual._proto.KNearestShapeletPrototypeSampler": [[21, 3, 1, "", "move"], [21, 3, 1, "", "sample"], [21, 3, 1, "", "sample_move"]], "wildboar.explain.counterfactual._proto.MetricTransform": [[21, 3, 1, "", "move"]], "wildboar.explain.counterfactual._proto.PredictEvaluator": [[21, 3, 1, "", "is_counterfactual"]], "wildboar.explain.counterfactual._proto.ProbabilityEvaluator": [[21, 3, 1, "", "is_counterfactual"]], "wildboar.explain.counterfactual._proto.PrototypeCounterfactual": [[21, 3, 1, "", "fit_explain"], [21, 3, 1, "", "get_metadata_routing"], [21, 3, 1, "", "get_params"], [21, 3, 1, "", "plot"], [21, 3, 1, "", "score"], [21, 3, 1, "", "set_params"]], "wildboar.explain.counterfactual._proto.PrototypeSampler": [[21, 3, 1, "", "move"], [21, 3, 1, "", "sample"], [21, 3, 1, "", "sample_move"]], "wildboar.explain.counterfactual._proto.ShapeletPrototypeSampler": [[21, 3, 1, "", "move"], [21, 3, 1, "", "sample"], [21, 3, 1, "", "sample_move"], [21, 3, 1, "", "sample_shapelet"]], "wildboar.explain.counterfactual._proto.TargetEvaluator": [[21, 3, 1, "", "is_counterfactual"]], "wildboar.explain.counterfactual._proto.UniformPrototypeSampler": [[21, 3, 1, "", "move"], [21, 3, 1, "", "sample"], [21, 3, 1, "", "sample_move"]], "wildboar.explain.counterfactual._proto.WeightedDynamicTimeWarpTransform": [[21, 3, 1, "", "move"]], "wildboar.explain.counterfactual._sf": [[22, 2, 1, "", "ShapeletForestCounterfactual"]], "wildboar.explain.counterfactual._sf.ShapeletForestCounterfactual": [[22, 3, 1, "", "fit_explain"], [22, 3, 1, "", "get_metadata_routing"], [22, 3, 1, "", "get_params"], [22, 3, 1, "", "plot"], [22, 3, 1, "", "score"], [22, 3, 1, "", "set_params"]], "wildboar.linear_model": [[30, 2, 1, "", "HydraClassifier"], [30, 2, 1, "", "RandomShapeletClassifier"], [30, 2, 1, "", "RandomShapeletRegressor"], [30, 2, 1, "", "RocketClassifier"], [30, 2, 1, "", "RocketRegressor"], [26, 0, 0, "-", "_hydra"], [27, 0, 0, "-", "_rocket"], [28, 0, 0, "-", "_shapelet"], [29, 0, 0, "-", "_transform"]], "wildboar.linear_model.HydraClassifier": [[30, 3, 1, "", "get_metadata_routing"], [30, 3, 1, "", "get_params"], [30, 3, 1, "", "score"], [30, 3, 1, "", "set_params"]], "wildboar.linear_model.RandomShapeletClassifier": [[30, 3, 1, "", "get_metadata_routing"], [30, 3, 1, "", "get_params"], [30, 3, 1, "", "score"], [30, 3, 1, "", "set_params"]], "wildboar.linear_model.RandomShapeletRegressor": [[30, 3, 1, "", "get_metadata_routing"], [30, 3, 1, "", "get_params"], [30, 3, 1, "", "score"], [30, 3, 1, "", "set_params"]], "wildboar.linear_model.RocketClassifier": [[30, 3, 1, "", "get_metadata_routing"], [30, 3, 1, "", "get_params"], [30, 3, 1, "", "score"], [30, 3, 1, "", "set_params"]], "wildboar.linear_model.RocketRegressor": [[30, 3, 1, "", "get_metadata_routing"], [30, 3, 1, "", "get_params"], [30, 3, 1, "", "score"], [30, 3, 1, "", "set_params"]], "wildboar.linear_model._hydra": [[26, 2, 1, "", "HydraClassifier"]], "wildboar.linear_model._hydra.HydraClassifier": [[26, 3, 1, "", "get_metadata_routing"], [26, 3, 1, "", "get_params"], [26, 3, 1, "", "score"], [26, 3, 1, "", "set_params"]], "wildboar.linear_model._rocket": [[27, 2, 1, "", "RocketClassifier"], [27, 2, 1, "", "RocketRegressor"]], "wildboar.linear_model._rocket.RocketClassifier": [[27, 3, 1, "", "get_metadata_routing"], [27, 3, 1, "", "get_params"], [27, 3, 1, "", "score"], [27, 3, 1, "", "set_params"]], "wildboar.linear_model._rocket.RocketRegressor": [[27, 3, 1, "", "get_metadata_routing"], [27, 3, 1, "", "get_params"], [27, 3, 1, "", "score"], [27, 3, 1, "", "set_params"]], "wildboar.linear_model._shapelet": [[28, 2, 1, "", "RandomShapeletClassifier"], [28, 2, 1, "", "RandomShapeletRegressor"]], "wildboar.linear_model._shapelet.RandomShapeletClassifier": [[28, 3, 1, "", "get_metadata_routing"], [28, 3, 1, "", "get_params"], [28, 3, 1, "", "score"], [28, 3, 1, "", "set_params"]], "wildboar.linear_model._shapelet.RandomShapeletRegressor": [[28, 3, 1, "", "get_metadata_routing"], [28, 3, 1, "", "get_params"], [28, 3, 1, "", "score"], [28, 3, 1, "", "set_params"]], "wildboar.linear_model._transform": [[29, 2, 1, "", "BaseTransformClassifier"], [29, 2, 1, "", "BaseTransformEstimator"], [29, 2, 1, "", "BaseTransformRegressor"], [29, 2, 1, "", "TransformRidgeCV"], [29, 2, 1, "", "TransformRidgeClassifierCV"]], "wildboar.linear_model._transform.BaseTransformClassifier": [[29, 3, 1, "", "get_metadata_routing"], [29, 3, 1, "", "get_params"], [29, 3, 1, "", "score"], [29, 3, 1, "", "set_params"]], "wildboar.linear_model._transform.BaseTransformEstimator": [[29, 3, 1, "", "get_metadata_routing"], [29, 3, 1, "", "get_params"], [29, 3, 1, "", "set_params"]], "wildboar.linear_model._transform.BaseTransformRegressor": [[29, 3, 1, "", "get_metadata_routing"], [29, 3, 1, "", "get_params"], [29, 3, 1, "", "score"], [29, 3, 1, "", "set_params"]], "wildboar.linear_model._transform.TransformRidgeCV": [[29, 3, 1, "", "get_metadata_routing"], [29, 3, 1, "", "get_params"], [29, 3, 1, "", "score"], [29, 3, 1, "", "set_params"]], "wildboar.linear_model._transform.TransformRidgeClassifierCV": [[29, 3, 1, "", "get_metadata_routing"], [29, 3, 1, "", "get_params"], [29, 3, 1, "", "score"], [29, 3, 1, "", "set_params"]], "wildboar.metrics": [[31, 0, 0, "-", "_cluster"], [32, 0, 0, "-", "_counterfactual"], [33, 1, 1, "", "compactness_score"], [33, 1, 1, "", "plausability_score"], [33, 1, 1, "", "proximity_score"], [33, 1, 1, "", "redudancy_score"], [33, 1, 1, "", "relative_proximity_score"], [33, 1, 1, "", "silhouette_samples"], [33, 1, 1, "", "silhouette_score"], [33, 1, 1, "", "validity_score"]], "wildboar.metrics._cluster": [[31, 1, 1, "", "silhouette_samples"], [31, 1, 1, "", "silhouette_score"]], "wildboar.metrics._counterfactual": [[32, 1, 1, "", "compactness_score"], [32, 1, 1, "", "plausability_score"], [32, 1, 1, "", "proximity_score"], [32, 1, 1, "", "redudancy_score"], [32, 1, 1, "", "relative_proximity_score"], [32, 1, 1, "", "validity_score"]], "wildboar.model_selection": [[36, 2, 1, "", "RepeatedOutlierSplit"], [34, 0, 0, "-", "_cv"], [35, 0, 0, "-", "_outlier"], [36, 1, 1, "", "outlier_train_test_split"]], "wildboar.model_selection.RepeatedOutlierSplit": [[36, 3, 1, "", "get_n_splits"], [36, 3, 1, "", "split"]], "wildboar.model_selection._cv": [[34, 2, 1, "", "RepeatedOutlierSplit"]], "wildboar.model_selection._cv.RepeatedOutlierSplit": [[34, 3, 1, "", "get_n_splits"], [34, 3, 1, "", "split"]], "wildboar.model_selection._outlier": [[35, 1, 1, "", "outlier_train_test_split"]], "wildboar.transform": [[47, 2, 1, "", "DiffTransform"], [47, 2, 1, "", "FeatureTransform"], [47, 2, 1, "", "HydraTransform"], [47, 2, 1, "", "IntervalTransform"], [47, 2, 1, "", "MatrixProfileTransform"], [47, 2, 1, "", "PAA"], [47, 2, 1, "", "PivotTransform"], [47, 2, 1, "", "ProximityTransform"], [47, 2, 1, "", "RandomShapeletTransform"], [47, 2, 1, "", "RocketTransform"], [47, 2, 1, "", "SAX"], [37, 0, 0, "-", "_base"], [38, 0, 0, "-", "_conv"], [39, 0, 0, "-", "_diff"], [40, 0, 0, "-", "_hydra"], [41, 0, 0, "-", "_interval"], [42, 0, 0, "-", "_matrix_profile"], [43, 0, 0, "-", "_pivot"], [44, 0, 0, "-", "_rocket"], [45, 0, 0, "-", "_sax"], [46, 0, 0, "-", "_shapelet"], [47, 1, 1, "", "convolve"], [47, 1, 1, "", "piecewice_aggregate_approximation"], [47, 1, 1, "", "symbolic_aggregate_approximation"]], "wildboar.transform.DiffTransform": [[47, 3, 1, "", "fit_transform"], [47, 3, 1, "", "get_metadata_routing"], [47, 3, 1, "", "get_params"], [47, 3, 1, "", "set_output"], [47, 3, 1, "", "set_params"]], "wildboar.transform.FeatureTransform": [[47, 3, 1, "", "fit"], [47, 3, 1, "", "fit_transform"], [47, 3, 1, "", "get_metadata_routing"], [47, 3, 1, "", "get_params"], [47, 3, 1, "", "set_output"], [47, 3, 1, "", "set_params"], [47, 3, 1, "", "transform"]], "wildboar.transform.HydraTransform": [[47, 3, 1, "", "fit"], [47, 3, 1, "", "fit_transform"], [47, 3, 1, "", "get_metadata_routing"], [47, 3, 1, "", "get_params"], [47, 3, 1, "", "set_output"], [47, 3, 1, "", "set_params"], [47, 3, 1, "", "transform"]], "wildboar.transform.IntervalTransform": [[47, 3, 1, "", "fit"], [47, 3, 1, "", "fit_transform"], [47, 3, 1, "", "get_metadata_routing"], [47, 3, 1, "", "get_params"], [47, 3, 1, "", "set_output"], [47, 3, 1, "", "set_params"], [47, 3, 1, "", "transform"]], "wildboar.transform.MatrixProfileTransform": [[47, 3, 1, "", "fit"], [47, 3, 1, "", "fit_transform"], [47, 3, 1, "", "get_metadata_routing"], [47, 3, 1, "", "get_params"], [47, 3, 1, "", "set_output"], [47, 3, 1, "", "set_params"], [47, 3, 1, "", "transform"]], "wildboar.transform.PAA": [[47, 3, 1, "", "fit_transform"], [47, 3, 1, "", "get_metadata_routing"], [47, 3, 1, "", "get_params"], [47, 3, 1, "", "set_output"], [47, 3, 1, "", "set_params"]], "wildboar.transform.PivotTransform": [[47, 3, 1, "", "fit"], [47, 3, 1, "", "fit_transform"], [47, 3, 1, "", "get_metadata_routing"], [47, 3, 1, "", "get_params"], [47, 3, 1, "", "set_output"], [47, 3, 1, "", "set_params"], [47, 3, 1, "", "transform"]], "wildboar.transform.ProximityTransform": [[47, 3, 1, "", "fit_transform"], [47, 3, 1, "", "get_metadata_routing"], [47, 3, 1, "", "get_params"], [47, 3, 1, "", "set_output"], [47, 3, 1, "", "set_params"]], "wildboar.transform.RandomShapeletTransform": [[47, 3, 1, "", "fit"], [47, 3, 1, "", "fit_transform"], [47, 3, 1, "", "get_metadata_routing"], [47, 3, 1, "", "get_params"], [47, 3, 1, "", "set_output"], [47, 3, 1, "", "set_params"], [47, 3, 1, "", "transform"]], "wildboar.transform.RocketTransform": [[47, 3, 1, "", "fit"], [47, 3, 1, "", "fit_transform"], [47, 3, 1, "", "get_metadata_routing"], [47, 3, 1, "", "get_params"], [47, 3, 1, "", "set_output"], [47, 3, 1, "", "set_params"], [47, 3, 1, "", "transform"]], "wildboar.transform.SAX": [[47, 3, 1, "", "fit_transform"], [47, 3, 1, "", "get_metadata_routing"], [47, 3, 1, "", "get_params"], [47, 3, 1, "", "set_output"], [47, 3, 1, "", "set_params"]], "wildboar.transform._base": [[37, 2, 1, "", "BaseAttributeTransform"]], "wildboar.transform._base.BaseAttributeTransform": [[37, 3, 1, "", "fit"], [37, 3, 1, "", "fit_transform"], [37, 3, 1, "", "get_metadata_routing"], [37, 3, 1, "", "get_params"], [37, 3, 1, "", "set_output"], [37, 3, 1, "", "set_params"], [37, 3, 1, "", "transform"]], "wildboar.transform._conv": [[38, 1, 1, "", "convolve"]], "wildboar.transform._diff": [[39, 2, 1, "", "DiffTransform"]], "wildboar.transform._diff.DiffTransform": [[39, 3, 1, "", "fit_transform"], [39, 3, 1, "", "get_metadata_routing"], [39, 3, 1, "", "get_params"], [39, 3, 1, "", "set_output"], [39, 3, 1, "", "set_params"]], "wildboar.transform._hydra": [[40, 2, 1, "", "HydraTransform"]], "wildboar.transform._hydra.HydraTransform": [[40, 3, 1, "", "fit"], [40, 3, 1, "", "fit_transform"], [40, 3, 1, "", "get_metadata_routing"], [40, 3, 1, "", "get_params"], [40, 3, 1, "", "set_output"], [40, 3, 1, "", "set_params"], [40, 3, 1, "", "transform"]], "wildboar.transform._interval": [[41, 2, 1, "", "FeatureTransform"], [41, 2, 1, "", "IntervalMixin"], [41, 2, 1, "", "IntervalTransform"]], "wildboar.transform._interval.FeatureTransform": [[41, 3, 1, "", "fit"], [41, 3, 1, "", "fit_transform"], [41, 3, 1, "", "get_metadata_routing"], [41, 3, 1, "", "get_params"], [41, 3, 1, "", "set_output"], [41, 3, 1, "", "set_params"], [41, 3, 1, "", "transform"]], "wildboar.transform._interval.IntervalTransform": [[41, 3, 1, "", "fit"], [41, 3, 1, "", "fit_transform"], [41, 3, 1, "", "get_metadata_routing"], [41, 3, 1, "", "get_params"], [41, 3, 1, "", "set_output"], [41, 3, 1, "", "set_params"], [41, 3, 1, "", "transform"]], "wildboar.transform._matrix_profile": [[42, 2, 1, "", "MatrixProfileTransform"]], "wildboar.transform._matrix_profile.MatrixProfileTransform": [[42, 3, 1, "", "fit"], [42, 3, 1, "", "fit_transform"], [42, 3, 1, "", "get_metadata_routing"], [42, 3, 1, "", "get_params"], [42, 3, 1, "", "set_output"], [42, 3, 1, "", "set_params"], [42, 3, 1, "", "transform"]], "wildboar.transform._pivot": [[43, 2, 1, "", "PivotMixin"], [43, 2, 1, "", "PivotTransform"], [43, 2, 1, "", "ProximityTransform"]], "wildboar.transform._pivot.PivotTransform": [[43, 3, 1, "", "fit"], [43, 3, 1, "", "fit_transform"], [43, 3, 1, "", "get_metadata_routing"], [43, 3, 1, "", "get_params"], [43, 3, 1, "", "set_output"], [43, 3, 1, "", "set_params"], [43, 3, 1, "", "transform"]], "wildboar.transform._pivot.ProximityTransform": [[43, 3, 1, "", "fit_transform"], [43, 3, 1, "", "get_metadata_routing"], [43, 3, 1, "", "get_params"], [43, 3, 1, "", "set_output"], [43, 3, 1, "", "set_params"]], "wildboar.transform._rocket": [[44, 2, 1, "", "RocketMixin"], [44, 2, 1, "", "RocketTransform"]], "wildboar.transform._rocket.RocketTransform": [[44, 3, 1, "", "fit"], [44, 3, 1, "", "fit_transform"], [44, 3, 1, "", "get_metadata_routing"], [44, 3, 1, "", "get_params"], [44, 3, 1, "", "set_output"], [44, 3, 1, "", "set_params"], [44, 3, 1, "", "transform"]], "wildboar.transform._sax": [[45, 2, 1, "", "Binning"], [45, 2, 1, "", "NormalBinning"], [45, 2, 1, "", "PAA"], [45, 2, 1, "", "SAX"], [45, 2, 1, "", "UniformBinning"], [45, 1, 1, "", "piecewice_aggregate_approximation"], [45, 1, 1, "", "symbolic_aggregate_approximation"]], "wildboar.transform._sax.Binning": [[45, 3, 1, "", "get_thresholds"], [45, 3, 1, "", "scale"]], "wildboar.transform._sax.NormalBinning": [[45, 3, 1, "", "get_thresholds"], [45, 3, 1, "", "scale"]], "wildboar.transform._sax.PAA": [[45, 3, 1, "", "fit_transform"], [45, 3, 1, "", "get_metadata_routing"], [45, 3, 1, "", "get_params"], [45, 3, 1, "", "set_output"], [45, 3, 1, "", "set_params"]], "wildboar.transform._sax.SAX": [[45, 3, 1, "", "fit_transform"], [45, 3, 1, "", "get_metadata_routing"], [45, 3, 1, "", "get_params"], [45, 3, 1, "", "set_output"], [45, 3, 1, "", "set_params"]], "wildboar.transform._sax.UniformBinning": [[45, 3, 1, "", "get_thresholds"], [45, 3, 1, "", "scale"]], "wildboar.transform._shapelet": [[46, 2, 1, "", "RandomShapeletTransform"], [46, 2, 1, "", "ShapeletMixin"]], "wildboar.transform._shapelet.RandomShapeletTransform": [[46, 3, 1, "", "fit"], [46, 3, 1, "", "fit_transform"], [46, 3, 1, "", "get_metadata_routing"], [46, 3, 1, "", "get_params"], [46, 3, 1, "", "set_output"], [46, 3, 1, "", "set_params"], [46, 3, 1, "", "transform"]], "wildboar.tree": [[51, 2, 1, "", "ExtraShapeletTreeClassifier"], [51, 2, 1, "", "ExtraShapeletTreeRegressor"], [51, 2, 1, "", "IntervalTreeClassifier"], [51, 2, 1, "", "IntervalTreeRegressor"], [51, 2, 1, "", "PivotTreeClassifier"], [51, 2, 1, "", "ProximityTreeClassifier"], [51, 2, 1, "", "RocketTreeClassifier"], [51, 2, 1, "", "RocketTreeRegressor"], [51, 2, 1, "", "ShapeletTreeClassifier"], [51, 2, 1, "", "ShapeletTreeRegressor"], [48, 0, 0, "-", "_base"], [49, 0, 0, "-", "_ptree"], [50, 0, 0, "-", "_tree"]], "wildboar.tree.ExtraShapeletTreeClassifier": [[51, 3, 1, "", "apply"], [51, 3, 1, "", "decision_path"], [51, 3, 1, "", "fit"], [51, 3, 1, "", "get_metadata_routing"], [51, 3, 1, "", "get_params"], [51, 3, 1, "", "predict"], [51, 3, 1, "", "predict_proba"], [51, 3, 1, "", "score"], [51, 3, 1, "", "set_params"]], "wildboar.tree.ExtraShapeletTreeRegressor": [[51, 3, 1, "", "apply"], [51, 3, 1, "", "decision_path"], [51, 3, 1, "", "fit"], [51, 3, 1, "", "get_metadata_routing"], [51, 3, 1, "", "get_params"], [51, 3, 1, "", "predict"], [51, 3, 1, "", "score"], [51, 3, 1, "", "set_params"]], "wildboar.tree.IntervalTreeClassifier": [[51, 3, 1, "", "apply"], [51, 3, 1, "", "decision_path"], [51, 3, 1, "", "fit"], [51, 3, 1, "", "get_metadata_routing"], [51, 3, 1, "", "get_params"], [51, 3, 1, "", "predict"], [51, 3, 1, "", "predict_proba"], [51, 3, 1, "", "score"], [51, 3, 1, "", "set_params"]], "wildboar.tree.IntervalTreeRegressor": [[51, 3, 1, "", "apply"], [51, 3, 1, "", "decision_path"], [51, 3, 1, "", "fit"], [51, 3, 1, "", "get_metadata_routing"], [51, 3, 1, "", "get_params"], [51, 3, 1, "", "predict"], [51, 3, 1, "", "score"], [51, 3, 1, "", "set_params"]], "wildboar.tree.PivotTreeClassifier": [[51, 3, 1, "", "apply"], [51, 3, 1, "", "decision_path"], [51, 3, 1, "", "fit"], [51, 3, 1, "", "get_metadata_routing"], [51, 3, 1, "", "get_params"], [51, 3, 1, "", "predict"], [51, 3, 1, "", "predict_proba"], [51, 3, 1, "", "score"], [51, 3, 1, "", "set_params"]], "wildboar.tree.ProximityTreeClassifier": [[51, 3, 1, "", "apply"], [51, 3, 1, "", "decision_path"], [51, 3, 1, "", "fit"], [51, 3, 1, "", "get_metadata_routing"], [51, 3, 1, "", "get_params"], [51, 3, 1, "", "predict"], [51, 3, 1, "", "predict_proba"], [51, 3, 1, "", "score"], [51, 3, 1, "", "set_params"]], "wildboar.tree.RocketTreeClassifier": [[51, 3, 1, "", "apply"], [51, 3, 1, "", "decision_path"], [51, 3, 1, "", "fit"], [51, 3, 1, "", "get_metadata_routing"], [51, 3, 1, "", "get_params"], [51, 3, 1, "", "predict"], [51, 3, 1, "", "predict_proba"], [51, 3, 1, "", "score"], [51, 3, 1, "", "set_params"]], "wildboar.tree.RocketTreeRegressor": [[51, 3, 1, "", "apply"], [51, 3, 1, "", "decision_path"], [51, 3, 1, "", "fit"], [51, 3, 1, "", "get_metadata_routing"], [51, 3, 1, "", "get_params"], [51, 3, 1, "", "predict"], [51, 3, 1, "", "score"], [51, 3, 1, "", "set_params"]], "wildboar.tree.ShapeletTreeClassifier": [[51, 3, 1, "", "apply"], [51, 3, 1, "", "decision_path"], [51, 3, 1, "", "fit"], [51, 3, 1, "", "get_metadata_routing"], [51, 3, 1, "", "get_params"], [51, 3, 1, "", "predict"], [51, 3, 1, "", "predict_proba"], [51, 3, 1, "", "score"], [51, 3, 1, "", "set_params"]], "wildboar.tree.ShapeletTreeRegressor": [[51, 3, 1, "", "apply"], [51, 3, 1, "", "decision_path"], [51, 3, 1, "", "fit"], [51, 3, 1, "", "get_metadata_routing"], [51, 3, 1, "", "get_params"], [51, 3, 1, "", "predict"], [51, 3, 1, "", "score"], [51, 3, 1, "", "set_params"]], "wildboar.tree._base": [[48, 2, 1, "", "BaseTree"], [48, 2, 1, "", "BaseTreeClassifier"], [48, 2, 1, "", "BaseTreeRegressor"]], "wildboar.tree._base.BaseTree": [[48, 3, 1, "", "apply"], [48, 3, 1, "", "decision_path"], [48, 3, 1, "", "get_metadata_routing"], [48, 3, 1, "", "get_params"], [48, 3, 1, "", "set_params"]], "wildboar.tree._base.BaseTreeClassifier": [[48, 3, 1, "", "apply"], [48, 3, 1, "", "decision_path"], [48, 3, 1, "", "fit"], [48, 3, 1, "", "get_metadata_routing"], [48, 3, 1, "", "get_params"], [48, 3, 1, "", "predict"], [48, 3, 1, "", "predict_proba"], [48, 3, 1, "", "score"], [48, 3, 1, "", "set_params"]], "wildboar.tree._base.BaseTreeRegressor": [[48, 3, 1, "", "apply"], [48, 3, 1, "", "decision_path"], [48, 3, 1, "", "fit"], [48, 3, 1, "", "get_metadata_routing"], [48, 3, 1, "", "get_params"], [48, 3, 1, "", "predict"], [48, 3, 1, "", "score"], [48, 3, 1, "", "set_params"]], "wildboar.tree._ptree": [[49, 2, 1, "", "ProximityTreeClassifier"]], "wildboar.tree._ptree.ProximityTreeClassifier": [[49, 3, 1, "", "apply"], [49, 3, 1, "", "decision_path"], [49, 3, 1, "", "fit"], [49, 3, 1, "", "get_metadata_routing"], [49, 3, 1, "", "get_params"], [49, 3, 1, "", "predict"], [49, 3, 1, "", "predict_proba"], [49, 3, 1, "", "score"], [49, 3, 1, "", "set_params"]], "wildboar.tree._tree": [[50, 2, 1, "", "BaseFeatureTreeClassifier"], [50, 2, 1, "", "BaseFeatureTreeRegressor"], [50, 2, 1, "", "ExtraShapeletTreeClassifier"], [50, 2, 1, "", "ExtraShapeletTreeRegressor"], [50, 2, 1, "", "IntervalTreeClassifier"], [50, 2, 1, "", "IntervalTreeRegressor"], [50, 2, 1, "", "PivotTreeClassifier"], [50, 2, 1, "", "RocketTreeClassifier"], [50, 2, 1, "", "RocketTreeRegressor"], [50, 2, 1, "", "ShapeletTreeClassifier"], [50, 2, 1, "", "ShapeletTreeRegressor"]], "wildboar.tree._tree.BaseFeatureTreeClassifier": [[50, 3, 1, "", "apply"], [50, 3, 1, "", "decision_path"], [50, 3, 1, "", "fit"], [50, 3, 1, "", "get_metadata_routing"], [50, 3, 1, "", "get_params"], [50, 3, 1, "", "predict"], [50, 3, 1, "", "predict_proba"], [50, 3, 1, "", "score"], [50, 3, 1, "", "set_params"]], "wildboar.tree._tree.BaseFeatureTreeRegressor": [[50, 3, 1, "", "apply"], [50, 3, 1, "", "decision_path"], [50, 3, 1, "", "fit"], [50, 3, 1, "", "get_metadata_routing"], [50, 3, 1, "", "get_params"], [50, 3, 1, "", "predict"], [50, 3, 1, "", "score"], [50, 3, 1, "", "set_params"]], "wildboar.tree._tree.ExtraShapeletTreeClassifier": [[50, 3, 1, "", "apply"], [50, 3, 1, "", "decision_path"], [50, 3, 1, "", "fit"], [50, 3, 1, "", "get_metadata_routing"], [50, 3, 1, "", "get_params"], [50, 3, 1, "", "predict"], [50, 3, 1, "", "predict_proba"], [50, 3, 1, "", "score"], [50, 3, 1, "", "set_params"]], "wildboar.tree._tree.ExtraShapeletTreeRegressor": [[50, 3, 1, "", "apply"], [50, 3, 1, "", "decision_path"], [50, 3, 1, "", "fit"], [50, 3, 1, "", "get_metadata_routing"], [50, 3, 1, "", "get_params"], [50, 3, 1, "", "predict"], [50, 3, 1, "", "score"], [50, 3, 1, "", "set_params"]], "wildboar.tree._tree.IntervalTreeClassifier": [[50, 3, 1, "", "apply"], [50, 3, 1, "", "decision_path"], [50, 3, 1, "", "fit"], [50, 3, 1, "", "get_metadata_routing"], [50, 3, 1, "", "get_params"], [50, 3, 1, "", "predict"], [50, 3, 1, "", "predict_proba"], [50, 3, 1, "", "score"], [50, 3, 1, "", "set_params"]], "wildboar.tree._tree.IntervalTreeRegressor": [[50, 3, 1, "", "apply"], [50, 3, 1, "", "decision_path"], [50, 3, 1, "", "fit"], [50, 3, 1, "", "get_metadata_routing"], [50, 3, 1, "", "get_params"], [50, 3, 1, "", "predict"], [50, 3, 1, "", "score"], [50, 3, 1, "", "set_params"]], "wildboar.tree._tree.PivotTreeClassifier": [[50, 3, 1, "", "apply"], [50, 3, 1, "", "decision_path"], [50, 3, 1, "", "fit"], [50, 3, 1, "", "get_metadata_routing"], [50, 3, 1, "", "get_params"], [50, 3, 1, "", "predict"], [50, 3, 1, "", "predict_proba"], [50, 3, 1, "", "score"], [50, 3, 1, "", "set_params"]], "wildboar.tree._tree.RocketTreeClassifier": [[50, 3, 1, "", "apply"], [50, 3, 1, "", "decision_path"], [50, 3, 1, "", "fit"], [50, 3, 1, "", "get_metadata_routing"], [50, 3, 1, "", "get_params"], [50, 3, 1, "", "predict"], [50, 3, 1, "", "predict_proba"], [50, 3, 1, "", "score"], [50, 3, 1, "", "set_params"]], "wildboar.tree._tree.RocketTreeRegressor": [[50, 3, 1, "", "apply"], [50, 3, 1, "", "decision_path"], [50, 3, 1, "", "fit"], [50, 3, 1, "", "get_metadata_routing"], [50, 3, 1, "", "get_params"], [50, 3, 1, "", "predict"], [50, 3, 1, "", "score"], [50, 3, 1, "", "set_params"]], "wildboar.tree._tree.ShapeletTreeClassifier": [[50, 3, 1, "", "apply"], [50, 3, 1, "", "decision_path"], [50, 3, 1, "", "fit"], [50, 3, 1, "", "get_metadata_routing"], [50, 3, 1, "", "get_params"], [50, 3, 1, "", "predict"], [50, 3, 1, "", "predict_proba"], [50, 3, 1, "", "score"], [50, 3, 1, "", "set_params"]], "wildboar.tree._tree.ShapeletTreeRegressor": [[50, 3, 1, "", "apply"], [50, 3, 1, "", "decision_path"], [50, 3, 1, "", "fit"], [50, 3, 1, "", "get_metadata_routing"], [50, 3, 1, "", "get_params"], [50, 3, 1, "", "predict"], [50, 3, 1, "", "score"], [50, 3, 1, "", "set_params"]], "wildboar.utils": [[52, 0, 0, "-", "_parallel"], [53, 0, 0, "-", "_testing"], [56, 1, 1, "", "check_X_y"], [56, 1, 1, "", "check_array"], [54, 0, 0, "-", "decorators"], [55, 0, 0, "-", "estimator_checks"], [57, 0, 0, "-", "plot"], [58, 0, 0, "-", "validation"], [59, 0, 0, "-", "variable_len"]], "wildboar.utils._parallel": [[52, 1, 1, "", "run_in_parallel"]], "wildboar.utils._testing": [[53, 1, 1, "", "assert_exhaustive_parameter_checks"], [53, 1, 1, "", "assert_parameter_checks"]], "wildboar.utils.decorators": [[54, 1, 1, "", "array_or_scalar"], [54, 1, 1, "", "singleton"], [54, 1, 1, "", "unstable"]], "wildboar.utils.estimator_checks": [[55, 1, 1, "", "check_estimator"]], "wildboar.utils.plot": [[57, 2, 1, "", "MidpointNormalize"], [57, 1, 1, "", "plot_frequency_domain"], [57, 1, 1, "", "plot_time_domain"]], "wildboar.utils.plot.MidpointNormalize": [[57, 3, 1, "", "autoscale"], [57, 3, 1, "", "autoscale_None"], [57, 3, 1, "", "process_value"], [57, 3, 1, "", "scaled"]], "wildboar.utils.validation": [[58, 1, 1, "", "check_X_y"], [58, 1, 1, "", "check_array"], [58, 1, 1, "", "check_classification_targets"], [58, 1, 1, "", "check_option"], [58, 1, 1, "", "check_type"]], "wildboar.utils.variable_len": [[59, 1, 1, "", "get_variable_length"], [59, 1, 1, "", "is_end_of_series"], [59, 1, 1, "", "is_variable_length"]]}, "objtypes": {"0": "py:module", "1": "py:function", "2": "py:class", "3": "py:method", "4": "py:property"}, "objnames": {"0": ["py", "module", "Python module"], "1": ["py", "function", "Python function"], "2": ["py", "class", "Python class"], "3": ["py", "method", "Python method"], "4": ["py", "property", "Python property"]}, "titleterms": {"wildboar": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 80, 84], "function": [0, 1, 2, 3, 4, 5, 7, 8, 9, 10, 11, 14, 15, 18, 19, 23, 24, 25, 31, 32, 33, 35, 36, 38, 45, 47, 52, 53, 54, 55, 56, 57, 58, 59, 80], "annot": [0, 1, 2, 3, 64, 80], "base": [0, 4, 75, 76, 80], "class": [0, 4, 6, 7, 13, 15, 16, 17, 18, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 34, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 57, 80], "dataset": [0, 5, 6, 7, 8, 9, 66, 80, 83], "outlier": [0, 8, 78, 79, 80], "preprocess": [0, 9, 80], "distanc": [0, 10, 11, 12, 13, 14, 15, 71, 72, 80], "dtw": [0, 14, 80], "ensembl": [0, 16, 17, 74, 80], "explain": [0, 18, 19, 20, 21, 22, 23, 24, 80], "counterfactu": [0, 19, 20, 21, 22, 23, 80], "linear_model": [0, 26, 27, 28, 29, 30, 80], "metric": [0, 31, 32, 33, 70, 71, 72, 80], "model_select": [0, 34, 35, 36, 80], "transform": [0, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 62, 75, 80, 83], "tree": [0, 48, 49, 50, 51, 76, 80], "util": [0, 52, 53, 54, 55, 56, 57, 58, 59, 80], "_motif": 1, "modul": [1, 2, 4, 5, 6, 8, 9, 10, 11, 13, 14, 16, 18, 19, 20, 21, 22, 26, 27, 28, 29, 31, 32, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 48, 49, 50, 52, 53, 54, 55, 57, 58, 59], "content": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59], "_segment": 2, "packag": [3, 7, 15, 17, 23, 24, 25, 30, 33, 36, 47, 51, 56], "_filter": 5, "_repositori": 6, "submodul": [7, 15, 25, 56], "_distanc": 10, "_matrix_profil": [11, 42], "_multi_metr": 12, "_neighbor": 13, "_ensembl": 16, "_import": 18, "_helper": 19, "_nn": 20, "_proto": 21, "_sf": 22, "subpackag": [24, 25], "attribut": 25, "_hydra": [26, 40], "_rocket": [27, 44], "_shapelet": [28, 46], "_transform": 29, "_cluster": 31, "_counterfactu": 32, "_cv": 34, "_outlier": 35, "_base": [37, 48], "_conv": 38, "_diff": 39, "_interv": 41, "_pivot": 43, "_sax": 45, "_ptree": 49, "_tree": 50, "_parallel": 52, "_test": 53, "decor": 54, "estimator_check": 55, "plot": 57, "valid": 58, "variable_len": 59, "version": [60, 81], "exampl": [61, 83], "convolut": 62, "hydra": 62, "rocket": 62, "first": 62, "order": 62, "differ": 62, "user": 63, "guid": 63, "time": [65, 72, 83], "seri": [65, 83], "variabl": 65, "length": 65, "load": [66, 83], "singl": 66, "multipl": 66, "filter": 66, "pre": 67, "process": 67, "repositori": 68, "definit": 68, "instal": [68, 84], "local": 68, "cach": 68, "json": 68, "glossari": 69, "subsequ": [70, 71, 72], "elast": [70, 72], "non": 70, "pairwis": 71, "pair": 71, "multivari": 71, "support": 71, "search": 71, "benchmark": [71, 79], "dynam": 72, "warp": 72, "longest": 72, "common": 72, "edit": 72, "real": 72, "penalti": 72, "sequenc": 72, "move": 72, "split": 72, "merg": 72, "supervis": 73, "learn": [73, 77, 83], "estim": [74, 75, 76], "shapelet": 74, "forest": 74, "proxim": 74, "unsupervis": 77, "detect": [78, 79], "minor": 79, "label": 79, "major": 79, "emmott": 79, "what": 81, "": 81, "new": 81, "depend": 81, "1": 81, "2": 81, "0": 81, "chang": 81, "model": [81, 83], "changelog": 81, "other": 81, "improv": 81, "quickstart": 82, "get": 83, "start": 83, "machin": 83, "an": 83, "predict": 83, "tabular": 83, "data": 83, "explor": 83, "perform": 83, "persist": 83, "latest": 84, "releas": 84, "build": 84, "compil": 84, "from": 84, "sourc": 84}, "envversion": {"sphinx.domains.c": 2, "sphinx.domains.changeset": 1, "sphinx.domains.citation": 1, "sphinx.domains.cpp": 8, "sphinx.domains.index": 1, "sphinx.domains.javascript": 2, "sphinx.domains.math": 2, "sphinx.domains.python": 3, "sphinx.domains.rst": 2, "sphinx.domains.std": 2, "nbsphinx": 4, "sphinx.ext.intersphinx": 1, "sphinx": 57}, "alltitles": {"wildboar": [[0, "wildboar"], [25, "module-wildboar"], [80, "id1"]], "Functions": [[0, "id1"], [0, "id2"], [0, "id4"], [0, "id6"], [0, "id7"], [0, "id8"], [0, "id10"], [0, "id11"], [0, "id14"], [0, "id16"], [0, "id18"], [0, "id20"], [0, "id22"], [0, "id24"], [1, "functions"], [2, "functions"], [3, "functions"], [4, "functions"], [5, "functions"], [7, "functions"], [8, "functions"], [9, "functions"], [10, "functions"], [11, "functions"], [14, "functions"], [15, "functions"], [18, "functions"], [19, "functions"], [23, "functions"], [24, "functions"], [25, "functions"], [31, "functions"], [32, "functions"], [33, "functions"], [35, "functions"], [36, "functions"], [38, "functions"], [45, "functions"], [47, "functions"], [52, "functions"], [53, "functions"], [54, "functions"], [55, "functions"], [56, "functions"], [57, "functions"], [58, "functions"], [59, "functions"], [80, "id2"], [80, "id3"], [80, "id5"], [80, "id7"], [80, "id8"], [80, "id9"], [80, "id11"], [80, "id12"], [80, "id15"], [80, "id17"], [80, "id19"], [80, "id21"], [80, "id23"], [80, "id25"]], "wildboar.annotate": [[0, "wildboar-annotate"], [3, "module-wildboar.annotate"], [80, "wildboar-annotate"]], "wildboar.base": [[0, "wildboar-base"], [4, "module-wildboar.base"], [80, "wildboar-base"]], "Classes": [[0, "id3"], [0, "id5"], [0, "id9"], [0, "id12"], [0, "id13"], [0, "id15"], [0, "id17"], [0, "id19"], [0, "id21"], [0, "id23"], [4, "classes"], [6, "classes"], [7, "classes"], [13, "classes"], [15, "classes"], [16, "classes"], [17, "classes"], [18, "classes"], [20, "classes"], [21, "classes"], [22, "classes"], [23, "classes"], [24, "classes"], [26, "classes"], [27, "classes"], [28, "classes"], [29, "classes"], [30, "classes"], [34, "classes"], [36, "classes"], [37, "classes"], [39, "classes"], [40, "classes"], [41, "classes"], [42, "classes"], [43, "classes"], [44, "classes"], [45, "classes"], [46, "classes"], [47, "classes"], [48, "classes"], [49, "classes"], [50, "classes"], [51, "classes"], [57, "classes"], [80, "id4"], [80, "id6"], [80, "id10"], [80, "id13"], [80, "id14"], [80, "id16"], [80, "id18"], [80, "id20"], [80, "id22"], [80, "id24"]], "wildboar.datasets": [[0, "wildboar-datasets"], [7, "module-wildboar.datasets"], [80, "wildboar-datasets"]], "wildboar.datasets.outlier": [[0, "wildboar-datasets-outlier"], [8, "module-wildboar.datasets.outlier"], [80, "wildboar-datasets-outlier"]], "wildboar.datasets.preprocess": [[0, "wildboar-datasets-preprocess"], [9, "module-wildboar.datasets.preprocess"], [80, "wildboar-datasets-preprocess"]], "wildboar.distance": [[0, "wildboar-distance"], [15, "module-wildboar.distance"], [80, "wildboar-distance"]], "wildboar.distance.dtw": [[0, "wildboar-distance-dtw"], [14, "module-wildboar.distance.dtw"], [80, "wildboar-distance-dtw"]], "wildboar.ensemble": [[0, "wildboar-ensemble"], [17, "module-wildboar.ensemble"], [80, "wildboar-ensemble"]], "wildboar.explain": [[0, "wildboar-explain"], [24, "module-wildboar.explain"], [80, "wildboar-explain"]], "wildboar.explain.counterfactual": [[0, "wildboar-explain-counterfactual"], [23, "module-wildboar.explain.counterfactual"], [80, "wildboar-explain-counterfactual"]], "wildboar.linear_model": [[0, "wildboar-linear-model"], [30, "module-wildboar.linear_model"], [80, "wildboar-linear-model"]], "wildboar.metrics": [[0, "wildboar-metrics"], [33, "module-wildboar.metrics"], [80, "wildboar-metrics"]], "wildboar.model_selection": [[0, "wildboar-model-selection"], [36, "module-wildboar.model_selection"], [80, "wildboar-model-selection"]], "wildboar.transform": [[0, "wildboar-transform"], [47, "module-wildboar.transform"], [80, "wildboar-transform"]], "wildboar.tree": [[0, "wildboar-tree"], [51, "module-wildboar.tree"], [80, "wildboar-tree"]], "wildboar.utils": [[0, "wildboar-utils"], [56, "module-wildboar.utils"], [80, "wildboar-utils"]], "wildboar.annotate._motifs": [[1, "module-wildboar.annotate._motifs"]], "Module Contents": [[1, "module-contents"], [2, "module-contents"], [4, "module-contents"], [5, "module-contents"], [6, "module-contents"], [8, "module-contents"], [9, "module-contents"], [10, "module-contents"], [11, "module-contents"], [13, "module-contents"], [14, "module-contents"], [16, "module-contents"], [18, "module-contents"], [19, "module-contents"], [20, "module-contents"], [21, "module-contents"], [22, "module-contents"], [26, "module-contents"], [27, "module-contents"], [28, "module-contents"], [29, "module-contents"], [31, "module-contents"], [32, "module-contents"], [34, "module-contents"], [35, "module-contents"], [37, "module-contents"], [38, "module-contents"], [39, "module-contents"], [40, "module-contents"], [41, "module-contents"], [42, "module-contents"], [43, "module-contents"], [44, "module-contents"], [45, "module-contents"], [46, "module-contents"], [48, "module-contents"], [49, "module-contents"], [50, "module-contents"], [52, "module-contents"], [53, "module-contents"], [54, "module-contents"], [55, "module-contents"], [57, "module-contents"], [58, "module-contents"], [59, "module-contents"]], "wildboar.annotate._segment": [[2, "module-wildboar.annotate._segment"]], "Package Contents": [[3, "package-contents"], [7, "package-contents"], [15, "package-contents"], [17, "package-contents"], [23, "package-contents"], [24, "package-contents"], [25, "package-contents"], [30, "package-contents"], [33, "package-contents"], [36, "package-contents"], [47, "package-contents"], [51, "package-contents"], [56, "package-contents"]], "wildboar.datasets._filter": [[5, "module-wildboar.datasets._filter"]], "wildboar.datasets._repository": [[6, "module-wildboar.datasets._repository"]], "Submodules": [[7, "submodules"], [15, "submodules"], [25, "submodules"], [56, "submodules"]], "wildboar.distance._distance": [[10, "module-wildboar.distance._distance"]], "wildboar.distance._matrix_profile": [[11, "module-wildboar.distance._matrix_profile"]], "wildboar.distance._multi_metric": [[12, "module-wildboar.distance._multi_metric"]], "wildboar.distance._neighbors": [[13, "module-wildboar.distance._neighbors"]], "wildboar.ensemble._ensemble": [[16, "module-wildboar.ensemble._ensemble"]], "wildboar.explain._importance": [[18, "module-wildboar.explain._importance"]], "wildboar.explain.counterfactual._helper": [[19, "module-wildboar.explain.counterfactual._helper"]], "wildboar.explain.counterfactual._nn": [[20, "module-wildboar.explain.counterfactual._nn"]], "wildboar.explain.counterfactual._proto": [[21, "module-wildboar.explain.counterfactual._proto"]], "wildboar.explain.counterfactual._sf": [[22, "module-wildboar.explain.counterfactual._sf"]], "Subpackages": [[24, "subpackages"], [25, "subpackages"]], "Attributes": [[25, "attributes"]], "wildboar.linear_model._hydra": [[26, "module-wildboar.linear_model._hydra"]], "wildboar.linear_model._rocket": [[27, "module-wildboar.linear_model._rocket"]], "wildboar.linear_model._shapelet": [[28, "module-wildboar.linear_model._shapelet"]], "wildboar.linear_model._transform": [[29, "module-wildboar.linear_model._transform"]], "wildboar.metrics._cluster": [[31, "module-wildboar.metrics._cluster"]], "wildboar.metrics._counterfactual": [[32, "module-wildboar.metrics._counterfactual"]], "wildboar.model_selection._cv": [[34, "module-wildboar.model_selection._cv"]], "wildboar.model_selection._outlier": [[35, "module-wildboar.model_selection._outlier"]], "wildboar.transform._base": [[37, "module-wildboar.transform._base"]], "wildboar.transform._conv": [[38, "module-wildboar.transform._conv"]], "wildboar.transform._diff": [[39, "module-wildboar.transform._diff"]], "wildboar.transform._hydra": [[40, "module-wildboar.transform._hydra"]], "wildboar.transform._interval": [[41, "module-wildboar.transform._interval"]], "wildboar.transform._matrix_profile": [[42, "module-wildboar.transform._matrix_profile"]], "wildboar.transform._pivot": [[43, "module-wildboar.transform._pivot"]], "wildboar.transform._rocket": [[44, "module-wildboar.transform._rocket"]], "wildboar.transform._sax": [[45, "module-wildboar.transform._sax"]], "wildboar.transform._shapelet": [[46, "module-wildboar.transform._shapelet"]], "wildboar.tree._base": [[48, "module-wildboar.tree._base"]], "wildboar.tree._ptree": [[49, "module-wildboar.tree._ptree"]], "wildboar.tree._tree": [[50, "module-wildboar.tree._tree"]], "wildboar.utils._parallel": [[52, "module-wildboar.utils._parallel"]], "wildboar.utils._testing": [[53, "module-wildboar.utils._testing"]], "wildboar.utils.decorators": [[54, "module-wildboar.utils.decorators"]], "wildboar.utils.estimator_checks": [[55, "module-wildboar.utils.estimator_checks"]], "wildboar.utils.plot": [[57, "module-wildboar.utils.plot"]], "wildboar.utils.validation": [[58, "module-wildboar.utils.validation"]], "wildboar.utils.variable_len": [[59, "module-wildboar.utils.variable_len"]], "wildboar.version": [[60, "module-wildboar.version"]], "Examples": [[61, "examples"]], "Convolution transforms": [[62, "Convolution-transforms"]], "Hydra transform": [[62, "Hydra-transform"]], "Rocket transform": [[62, "Rocket-transform"]], "Hydra transform with first order differences": [[62, "Hydra-transform-with-first-order-differences"]], "Rocket transform with first order differences": [[62, "Rocket-transform-with-first-order-differences"]], "User guide": [[63, "user-guide"]], "Annotate": [[64, "annotate"]], "Time series": [[65, "time-series"]], "Variable length time series": [[65, "variable-length-time-series"]], "Datasets": [[66, "datasets"]], "Loading datasets": [[66, "loading-datasets"]], "Loading a single dataset": [[66, "loading-a-single-dataset"]], "Loading multiple datasets": [[66, "loading-multiple-datasets"]], "Filters": [[66, "filters"]], "Pre-processing": [[67, "pre-processing"]], "Repositories": [[68, "repositories"]], "Repository definitions": [[68, "repository-definitions"]], "Installing repositories": [[68, "installing-repositories"]], "Local cache": [[68, "local-cache"]], "JSON repositories": [[68, "json-repositories"]], "Glossary": [[69, "glossary"]], "Metrics": [[70, "metrics"], [71, "metrics"]], "Subsequence metrics": [[70, "subsequence-metrics"], [71, "subsequence-metrics"]], "Elastic and non-elastic metrics": [[70, "elastic-and-non-elastic-metrics"]], "Distance": [[71, "distance"]], "Pairwise distance": [[71, "pairwise-distance"]], "Paired distance": [[71, "paired-distance"]], "Multivariate support": [[71, "multivariate-support"]], "Subsequence search": [[71, "subsequence-search"]], "Pairwise subsequence distance": [[71, "pairwise-subsequence-distance"]], "Benchmark": [[71, "benchmark"]], "Elastic metrics": [[72, "elastic-metrics"]], "Dynamic time warping": [[72, "dynamic-time-warping"]], "Longest common subsequence": [[72, "longest-common-subsequence"]], "Edit-distance with real penalty": [[72, "edit-distance-with-real-penalty"]], "Edit-distance for real sequence": [[72, "edit-distance-for-real-sequence"]], "Time-warp edit distance": [[72, "time-warp-edit-distance"]], "Move-split-merge": [[72, "move-split-merge"]], "Supervised learning": [[73, "supervised-learning"]], "Ensemble estimators": [[74, "ensemble-estimators"]], "Shapelet forests": [[74, "shapelet-forests"]], "Proximity forests": [[74, "proximity-forests"]], "Transform-based estimators": [[75, "transform-based-estimators"]], "Tree-based estimators": [[76, "tree-based-estimators"]], "Unsupervised learning": [[77, "unsupervised-learning"]], "Outlier detection": [[78, "outlier-detection"]], "Outlier detection benchmarks": [[79, "outlier-detection-benchmarks"]], "Minority labeler": [[79, "minority-labeler"]], "Majority labeler": [[79, "majority-labeler"]], "Emmott labeler": [[79, "emmott-labeler"]], "Wildboar": [[80, "wildboar"]], "What\u2019s new": [[81, "what-s-new"]], "Dependencies": [[81, "dependencies"]], "Version 1.2.0": [[81, "version-1-2-0"]], "New and changed models": [[81, "new-and-changed-models"]], "Changelog": [[81, "changelog"]], "Other improvements": [[81, "other-improvements"]], "Quickstart": [[82, "quickstart"]], "Getting started": [[83, "getting-started"]], "Machine learning": [[83, "machine-learning"]], "Loading an example dataset": [[83, "loading-an-example-dataset"]], "Learning and predicting": [[83, "learning-and-predicting"]], "Transforming time series to tabular data": [[83, "transforming-time-series-to-tabular-data"]], "Exploring model performance": [[83, "exploring-model-performance"]], "Model persistence": [[83, "model-persistence"]], "Install wildboar": [[84, "install-wildboar"]], "Install the latest release": [[84, "install-the-latest-release"]], "Build and compile from source": [[84, "build-and-compile-from-source"]]}, "indexentries": {"module": [[1, "module-wildboar.annotate._motifs"], [2, "module-wildboar.annotate._segment"], [3, "module-wildboar.annotate"], [4, "module-wildboar.base"], [5, "module-wildboar.datasets._filter"], [6, "module-wildboar.datasets._repository"], [7, "module-wildboar.datasets"], [8, "module-wildboar.datasets.outlier"], [9, "module-wildboar.datasets.preprocess"], [10, "module-wildboar.distance._distance"], [11, "module-wildboar.distance._matrix_profile"], [12, "module-wildboar.distance._multi_metric"], [13, "module-wildboar.distance._neighbors"], [14, "module-wildboar.distance.dtw"], [15, "module-wildboar.distance"], [16, "module-wildboar.ensemble._ensemble"], [17, "module-wildboar.ensemble"], [18, "module-wildboar.explain._importance"], [19, "module-wildboar.explain.counterfactual._helper"], [20, "module-wildboar.explain.counterfactual._nn"], [21, "module-wildboar.explain.counterfactual._proto"], [22, "module-wildboar.explain.counterfactual._sf"], [23, "module-wildboar.explain.counterfactual"], [24, "module-wildboar.explain"], [25, "module-wildboar"], [26, "module-wildboar.linear_model._hydra"], [27, "module-wildboar.linear_model._rocket"], [28, "module-wildboar.linear_model._shapelet"], [29, "module-wildboar.linear_model._transform"], [30, "module-wildboar.linear_model"], [31, "module-wildboar.metrics._cluster"], [32, "module-wildboar.metrics._counterfactual"], [33, "module-wildboar.metrics"], [34, "module-wildboar.model_selection._cv"], [35, "module-wildboar.model_selection._outlier"], [36, "module-wildboar.model_selection"], [37, "module-wildboar.transform._base"], [38, "module-wildboar.transform._conv"], [39, "module-wildboar.transform._diff"], [40, "module-wildboar.transform._hydra"], [41, "module-wildboar.transform._interval"], [42, "module-wildboar.transform._matrix_profile"], [43, "module-wildboar.transform._pivot"], [44, "module-wildboar.transform._rocket"], [45, "module-wildboar.transform._sax"], [46, "module-wildboar.transform._shapelet"], [47, "module-wildboar.transform"], [48, "module-wildboar.tree._base"], [49, "module-wildboar.tree._ptree"], [50, "module-wildboar.tree._tree"], [51, "module-wildboar.tree"], [52, "module-wildboar.utils._parallel"], [53, "module-wildboar.utils._testing"], [54, "module-wildboar.utils.decorators"], [55, "module-wildboar.utils.estimator_checks"], [56, "module-wildboar.utils"], [57, "module-wildboar.utils.plot"], [58, "module-wildboar.utils.validation"], [59, "module-wildboar.utils.variable_len"], [60, "module-wildboar.version"]], "motifs() (in module wildboar.annotate._motifs)": [[1, "wildboar.annotate._motifs.motifs"]], "wildboar.annotate._motifs": [[1, "module-wildboar.annotate._motifs"]], "segment() (in module wildboar.annotate._segment)": [[2, "wildboar.annotate._segment.segment"]], "wildboar.annotate._segment": [[2, "module-wildboar.annotate._segment"]], "motifs() (in module wildboar.annotate)": [[3, "wildboar.annotate.motifs"]], "segment() (in module wildboar.annotate)": [[3, "wildboar.annotate.segment"]], "wildboar.annotate": [[3, "module-wildboar.annotate"]], "baseestimator (class in wildboar.base)": [[4, "wildboar.base.BaseEstimator"]], "counterfactualmixin (class in wildboar.base)": [[4, "wildboar.base.CounterfactualMixin"]], "explainermixin (class in wildboar.base)": [[4, "wildboar.base.ExplainerMixin"]], "fit_explain() (wildboar.base.explainermixin method)": [[4, "wildboar.base.ExplainerMixin.fit_explain"]], "get_metadata_routing() (wildboar.base.baseestimator method)": [[4, "wildboar.base.BaseEstimator.get_metadata_routing"]], "get_params() (wildboar.base.baseestimator method)": [[4, "wildboar.base.BaseEstimator.get_params"]], "is_counterfactual() (in module wildboar.base)": [[4, "wildboar.base.is_counterfactual"]], "is_explainer() (in module wildboar.base)": [[4, "wildboar.base.is_explainer"]], "plot() (wildboar.base.explainermixin method)": [[4, "wildboar.base.ExplainerMixin.plot"]], "score() (wildboar.base.counterfactualmixin method)": [[4, "wildboar.base.CounterfactualMixin.score"]], "set_params() (wildboar.base.baseestimator method)": [[4, "wildboar.base.BaseEstimator.set_params"]], "wildboar.base": [[4, "module-wildboar.base"]], "make_dict_filter() (in module wildboar.datasets._filter)": [[5, "wildboar.datasets._filter.make_dict_filter"]], "make_filter() (in module wildboar.datasets._filter)": [[5, "wildboar.datasets._filter.make_filter"]], "make_list_filter() (in module wildboar.datasets._filter)": [[5, "wildboar.datasets._filter.make_list_filter"]], "make_str_filter() (in module wildboar.datasets._filter)": [[5, "wildboar.datasets._filter.make_str_filter"]], "wildboar.datasets._filter": [[5, "module-wildboar.datasets._filter"]], "bundle (class in wildboar.datasets._repository)": [[6, "wildboar.datasets._repository.Bundle"]], "jsonrepository (class in wildboar.datasets._repository)": [[6, "wildboar.datasets._repository.JSONRepository"]], "npbundle (class in wildboar.datasets._repository)": [[6, "wildboar.datasets._repository.NpBundle"]], "repository (class in wildboar.datasets._repository)": [[6, "wildboar.datasets._repository.Repository"]], "download_url (wildboar.datasets._repository.jsonrepository property)": [[6, "wildboar.datasets._repository.JSONRepository.download_url"]], "download_url (wildboar.datasets._repository.repository property)": [[6, "wildboar.datasets._repository.Repository.download_url"]], "get_bundle() (wildboar.datasets._repository.jsonrepository method)": [[6, "wildboar.datasets._repository.JSONRepository.get_bundle"]], "get_bundle() (wildboar.datasets._repository.repository method)": [[6, "wildboar.datasets._repository.Repository.get_bundle"]], "get_bundles() (wildboar.datasets._repository.jsonrepository method)": [[6, "wildboar.datasets._repository.JSONRepository.get_bundles"]], "get_bundles() (wildboar.datasets._repository.repository method)": [[6, "wildboar.datasets._repository.Repository.get_bundles"]], "get_collection() (wildboar.datasets._repository.bundle method)": [[6, "wildboar.datasets._repository.Bundle.get_collection"]], "get_collection() (wildboar.datasets._repository.npbundle method)": [[6, "wildboar.datasets._repository.NpBundle.get_collection"]], "get_filename() (wildboar.datasets._repository.bundle method)": [[6, "wildboar.datasets._repository.Bundle.get_filename"]], "get_filename() (wildboar.datasets._repository.npbundle method)": [[6, "wildboar.datasets._repository.NpBundle.get_filename"]], "list() (wildboar.datasets._repository.bundle method)": [[6, "wildboar.datasets._repository.Bundle.list"]], "list() (wildboar.datasets._repository.npbundle method)": [[6, "wildboar.datasets._repository.NpBundle.list"]], "load() (wildboar.datasets._repository.bundle method)": [[6, "wildboar.datasets._repository.Bundle.load"]], "load() (wildboar.datasets._repository.npbundle method)": [[6, "wildboar.datasets._repository.NpBundle.load"]], "name (wildboar.datasets._repository.jsonrepository property)": [[6, "wildboar.datasets._repository.JSONRepository.name"]], "name (wildboar.datasets._repository.repository property)": [[6, "wildboar.datasets._repository.Repository.name"]], "refresh() (wildboar.datasets._repository.jsonrepository method)": [[6, "wildboar.datasets._repository.JSONRepository.refresh"]], "refresh() (wildboar.datasets._repository.repository method)": [[6, "wildboar.datasets._repository.Repository.refresh"]], "version (wildboar.datasets._repository.jsonrepository property)": [[6, "wildboar.datasets._repository.JSONRepository.version"]], "version (wildboar.datasets._repository.repository property)": [[6, "wildboar.datasets._repository.Repository.version"]], "wildboar.datasets._repository": [[6, "module-wildboar.datasets._repository"]], "wildboar_requires (wildboar.datasets._repository.jsonrepository property)": [[6, "wildboar.datasets._repository.JSONRepository.wildboar_requires"]], "wildboar_requires (wildboar.datasets._repository.repository property)": [[6, "wildboar.datasets._repository.Repository.wildboar_requires"]], "bundle (class in wildboar.datasets)": [[7, "wildboar.datasets.Bundle"]], "jsonrepository (class in wildboar.datasets)": [[7, "wildboar.datasets.JSONRepository"]], "npbundle (class in wildboar.datasets)": [[7, "wildboar.datasets.NpBundle"]], "repository (class in wildboar.datasets)": [[7, "wildboar.datasets.Repository"]], "clear_cache() (in module wildboar.datasets)": [[7, "wildboar.datasets.clear_cache"]], "download_url (wildboar.datasets.jsonrepository property)": [[7, "wildboar.datasets.JSONRepository.download_url"]], "download_url (wildboar.datasets.repository property)": [[7, "wildboar.datasets.Repository.download_url"]], "get_bundle() (wildboar.datasets.jsonrepository method)": [[7, "wildboar.datasets.JSONRepository.get_bundle"]], "get_bundle() (wildboar.datasets.repository method)": [[7, "wildboar.datasets.Repository.get_bundle"]], "get_bundles() (in module wildboar.datasets)": [[7, "wildboar.datasets.get_bundles"]], "get_bundles() (wildboar.datasets.jsonrepository method)": [[7, "wildboar.datasets.JSONRepository.get_bundles"]], "get_bundles() (wildboar.datasets.repository method)": [[7, "wildboar.datasets.Repository.get_bundles"]], "get_collection() (wildboar.datasets.bundle method)": [[7, "wildboar.datasets.Bundle.get_collection"]], "get_collection() (wildboar.datasets.npbundle method)": [[7, "wildboar.datasets.NpBundle.get_collection"]], "get_filename() (wildboar.datasets.bundle method)": [[7, "wildboar.datasets.Bundle.get_filename"]], "get_filename() (wildboar.datasets.npbundle method)": [[7, "wildboar.datasets.NpBundle.get_filename"]], "get_repository() (in module wildboar.datasets)": [[7, "wildboar.datasets.get_repository"]], "install_repository() (in module wildboar.datasets)": [[7, "wildboar.datasets.install_repository"]], "list() (wildboar.datasets.bundle method)": [[7, "wildboar.datasets.Bundle.list"]], "list() (wildboar.datasets.npbundle method)": [[7, "wildboar.datasets.NpBundle.list"]], "list_bundles() (in module wildboar.datasets)": [[7, "wildboar.datasets.list_bundles"]], "list_collections() (in module wildboar.datasets)": [[7, "wildboar.datasets.list_collections"]], "list_datasets() (in module wildboar.datasets)": [[7, "wildboar.datasets.list_datasets"]], "list_repositories() (in module wildboar.datasets)": [[7, "wildboar.datasets.list_repositories"]], "load() (wildboar.datasets.bundle method)": [[7, "wildboar.datasets.Bundle.load"]], "load() (wildboar.datasets.npbundle method)": [[7, "wildboar.datasets.NpBundle.load"]], "load_dataset() (in module wildboar.datasets)": [[7, "wildboar.datasets.load_dataset"]], "load_datasets() (in module wildboar.datasets)": [[7, "wildboar.datasets.load_datasets"]], "load_gun_point() (in module wildboar.datasets)": [[7, "wildboar.datasets.load_gun_point"]], "load_synthetic_control() (in module wildboar.datasets)": [[7, "wildboar.datasets.load_synthetic_control"]], "load_two_lead_ecg() (in module wildboar.datasets)": [[7, "wildboar.datasets.load_two_lead_ecg"]], "name (wildboar.datasets.jsonrepository property)": [[7, "wildboar.datasets.JSONRepository.name"]], "name (wildboar.datasets.repository property)": [[7, "wildboar.datasets.Repository.name"]], "refresh() (wildboar.datasets.jsonrepository method)": [[7, "wildboar.datasets.JSONRepository.refresh"]], "refresh() (wildboar.datasets.repository method)": [[7, "wildboar.datasets.Repository.refresh"]], "refresh_repositories() (in module wildboar.datasets)": [[7, "wildboar.datasets.refresh_repositories"]], "set_cache_dir() (in module wildboar.datasets)": [[7, "wildboar.datasets.set_cache_dir"]], "version (wildboar.datasets.jsonrepository property)": [[7, "wildboar.datasets.JSONRepository.version"]], "version (wildboar.datasets.repository property)": [[7, "wildboar.datasets.Repository.version"]], "wildboar.datasets": [[7, "module-wildboar.datasets"]], "wildboar_requires (wildboar.datasets.jsonrepository property)": [[7, "wildboar.datasets.JSONRepository.wildboar_requires"]], "wildboar_requires (wildboar.datasets.repository property)": [[7, "wildboar.datasets.Repository.wildboar_requires"]], "density_outliers() (in module wildboar.datasets.outlier)": [[8, "wildboar.datasets.outlier.density_outliers"]], "emmott_outliers() (in module wildboar.datasets.outlier)": [[8, "wildboar.datasets.outlier.emmott_outliers"]], "kmeans_outliers() (in module wildboar.datasets.outlier)": [[8, "wildboar.datasets.outlier.kmeans_outliers"]], "majority_outliers() (in module wildboar.datasets.outlier)": [[8, "wildboar.datasets.outlier.majority_outliers"]], "minority_outliers() (in module wildboar.datasets.outlier)": [[8, "wildboar.datasets.outlier.minority_outliers"]], "wildboar.datasets.outlier": [[8, "module-wildboar.datasets.outlier"]], "maxabs_scale() (in module wildboar.datasets.preprocess)": [[9, "wildboar.datasets.preprocess.maxabs_scale"]], "minmax_scale() (in module wildboar.datasets.preprocess)": [[9, "wildboar.datasets.preprocess.minmax_scale"]], "named_preprocess() (in module wildboar.datasets.preprocess)": [[9, "wildboar.datasets.preprocess.named_preprocess"]], "standardize() (in module wildboar.datasets.preprocess)": [[9, "wildboar.datasets.preprocess.standardize"]], "truncate() (in module wildboar.datasets.preprocess)": [[9, "wildboar.datasets.preprocess.truncate"]], "wildboar.datasets.preprocess": [[9, "module-wildboar.datasets.preprocess"]], "paired_distance() (in module wildboar.distance._distance)": [[10, "wildboar.distance._distance.paired_distance"]], "paired_subsequence_distance() (in module wildboar.distance._distance)": [[10, "wildboar.distance._distance.paired_subsequence_distance"]], "paired_subsequence_match() (in module wildboar.distance._distance)": [[10, "wildboar.distance._distance.paired_subsequence_match"]], "pairwise_distance() (in module wildboar.distance._distance)": [[10, "wildboar.distance._distance.pairwise_distance"]], "pairwise_subsequence_distance() (in module wildboar.distance._distance)": [[10, "wildboar.distance._distance.pairwise_subsequence_distance"]], "subsequence_match() (in module wildboar.distance._distance)": [[10, "wildboar.distance._distance.subsequence_match"]], "wildboar.distance._distance": [[10, "module-wildboar.distance._distance"]], "matrix_profile() (in module wildboar.distance._matrix_profile)": [[11, "wildboar.distance._matrix_profile.matrix_profile"]], "wildboar.distance._matrix_profile": [[11, "module-wildboar.distance._matrix_profile"]], "wildboar.distance._multi_metric": [[12, "module-wildboar.distance._multi_metric"]], "kmeans (class in wildboar.distance._neighbors)": [[13, "wildboar.distance._neighbors.KMeans"]], "kmedoids (class in wildboar.distance._neighbors)": [[13, "wildboar.distance._neighbors.KMedoids"]], "kneighborsclassifier (class in wildboar.distance._neighbors)": [[13, "wildboar.distance._neighbors.KNeighborsClassifier"]], "fit() (wildboar.distance._neighbors.kmeans method)": [[13, "wildboar.distance._neighbors.KMeans.fit"]], "fit() (wildboar.distance._neighbors.kmedoids method)": [[13, "wildboar.distance._neighbors.KMedoids.fit"]], "fit() (wildboar.distance._neighbors.kneighborsclassifier method)": [[13, "wildboar.distance._neighbors.KNeighborsClassifier.fit"]], "fit_predict() (wildboar.distance._neighbors.kmeans method)": [[13, "wildboar.distance._neighbors.KMeans.fit_predict"]], "fit_predict() (wildboar.distance._neighbors.kmedoids method)": [[13, "wildboar.distance._neighbors.KMedoids.fit_predict"]], "fit_transform() (wildboar.distance._neighbors.kmeans method)": [[13, "wildboar.distance._neighbors.KMeans.fit_transform"]], "fit_transform() (wildboar.distance._neighbors.kmedoids method)": [[13, "wildboar.distance._neighbors.KMedoids.fit_transform"]], "get_metadata_routing() (wildboar.distance._neighbors.kmeans method)": [[13, "wildboar.distance._neighbors.KMeans.get_metadata_routing"]], "get_metadata_routing() (wildboar.distance._neighbors.kmedoids method)": [[13, "wildboar.distance._neighbors.KMedoids.get_metadata_routing"]], "get_metadata_routing() (wildboar.distance._neighbors.kneighborsclassifier method)": [[13, "wildboar.distance._neighbors.KNeighborsClassifier.get_metadata_routing"]], "get_params() (wildboar.distance._neighbors.kmeans method)": [[13, "wildboar.distance._neighbors.KMeans.get_params"]], "get_params() (wildboar.distance._neighbors.kmedoids method)": [[13, "wildboar.distance._neighbors.KMedoids.get_params"]], "get_params() (wildboar.distance._neighbors.kneighborsclassifier method)": [[13, "wildboar.distance._neighbors.KNeighborsClassifier.get_params"]], "predict() (wildboar.distance._neighbors.kmeans method)": [[13, "wildboar.distance._neighbors.KMeans.predict"]], "predict() (wildboar.distance._neighbors.kmedoids method)": [[13, "wildboar.distance._neighbors.KMedoids.predict"]], "predict() (wildboar.distance._neighbors.kneighborsclassifier method)": [[13, "wildboar.distance._neighbors.KNeighborsClassifier.predict"]], "predict_proba() (wildboar.distance._neighbors.kneighborsclassifier method)": [[13, "wildboar.distance._neighbors.KNeighborsClassifier.predict_proba"]], "score() (wildboar.distance._neighbors.kneighborsclassifier method)": [[13, "wildboar.distance._neighbors.KNeighborsClassifier.score"]], "set_output() (wildboar.distance._neighbors.kmeans method)": [[13, "wildboar.distance._neighbors.KMeans.set_output"]], "set_output() (wildboar.distance._neighbors.kmedoids method)": [[13, "wildboar.distance._neighbors.KMedoids.set_output"]], "set_params() (wildboar.distance._neighbors.kmeans method)": [[13, "wildboar.distance._neighbors.KMeans.set_params"]], "set_params() (wildboar.distance._neighbors.kmedoids method)": [[13, "wildboar.distance._neighbors.KMedoids.set_params"]], "set_params() (wildboar.distance._neighbors.kneighborsclassifier method)": [[13, "wildboar.distance._neighbors.KNeighborsClassifier.set_params"]], "transform() (wildboar.distance._neighbors.kmeans method)": [[13, "wildboar.distance._neighbors.KMeans.transform"]], "transform() (wildboar.distance._neighbors.kmedoids method)": [[13, "wildboar.distance._neighbors.KMedoids.transform"]], "wildboar.distance._neighbors": [[13, "module-wildboar.distance._neighbors"]], "ddtw_distance() (in module wildboar.distance.dtw)": [[14, "wildboar.distance.dtw.ddtw_distance"]], "dtw_alignment() (in module wildboar.distance.dtw)": [[14, "wildboar.distance.dtw.dtw_alignment"]], "dtw_average() (in module wildboar.distance.dtw)": [[14, "wildboar.distance.dtw.dtw_average"]], "dtw_distance() (in module wildboar.distance.dtw)": [[14, "wildboar.distance.dtw.dtw_distance"]], "dtw_envelop() (in module wildboar.distance.dtw)": [[14, "wildboar.distance.dtw.dtw_envelop"]], "dtw_lb_keogh() (in module wildboar.distance.dtw)": [[14, "wildboar.distance.dtw.dtw_lb_keogh"]], "dtw_mapping() (in module wildboar.distance.dtw)": [[14, "wildboar.distance.dtw.dtw_mapping"]], "jeong_weight() (in module wildboar.distance.dtw)": [[14, "wildboar.distance.dtw.jeong_weight"]], "wddtw_distance() (in module wildboar.distance.dtw)": [[14, "wildboar.distance.dtw.wddtw_distance"]], "wdtw_alignment() (in module wildboar.distance.dtw)": [[14, "wildboar.distance.dtw.wdtw_alignment"]], "wdtw_distance() (in module wildboar.distance.dtw)": [[14, "wildboar.distance.dtw.wdtw_distance"]], "wildboar.distance.dtw": [[14, "module-wildboar.distance.dtw"]], "kmeans (class in wildboar.distance)": [[15, "wildboar.distance.KMeans"]], "kmedoids (class in wildboar.distance)": [[15, "wildboar.distance.KMedoids"]], "kneighborsclassifier (class in wildboar.distance)": [[15, "wildboar.distance.KNeighborsClassifier"]], "fit() (wildboar.distance.kmeans method)": [[15, "wildboar.distance.KMeans.fit"]], "fit() (wildboar.distance.kmedoids method)": [[15, "wildboar.distance.KMedoids.fit"]], "fit() (wildboar.distance.kneighborsclassifier method)": [[15, "wildboar.distance.KNeighborsClassifier.fit"]], "fit_predict() (wildboar.distance.kmeans method)": [[15, "wildboar.distance.KMeans.fit_predict"]], "fit_predict() (wildboar.distance.kmedoids method)": [[15, "wildboar.distance.KMedoids.fit_predict"]], "fit_transform() (wildboar.distance.kmeans method)": [[15, "wildboar.distance.KMeans.fit_transform"]], "fit_transform() (wildboar.distance.kmedoids method)": [[15, "wildboar.distance.KMedoids.fit_transform"]], "get_metadata_routing() (wildboar.distance.kmeans method)": [[15, "wildboar.distance.KMeans.get_metadata_routing"]], "get_metadata_routing() (wildboar.distance.kmedoids method)": [[15, "wildboar.distance.KMedoids.get_metadata_routing"]], "get_metadata_routing() (wildboar.distance.kneighborsclassifier method)": [[15, "wildboar.distance.KNeighborsClassifier.get_metadata_routing"]], "get_params() (wildboar.distance.kmeans method)": [[15, "wildboar.distance.KMeans.get_params"]], "get_params() (wildboar.distance.kmedoids method)": [[15, "wildboar.distance.KMedoids.get_params"]], "get_params() (wildboar.distance.kneighborsclassifier method)": [[15, "wildboar.distance.KNeighborsClassifier.get_params"]], "matrix_profile() (in module wildboar.distance)": [[15, "wildboar.distance.matrix_profile"]], "paired_distance() (in module wildboar.distance)": [[15, "wildboar.distance.paired_distance"]], "paired_subsequence_distance() (in module wildboar.distance)": [[15, "wildboar.distance.paired_subsequence_distance"]], "paired_subsequence_match() (in module wildboar.distance)": [[15, "wildboar.distance.paired_subsequence_match"]], "pairwise_distance() (in module wildboar.distance)": [[15, "wildboar.distance.pairwise_distance"]], "pairwise_subsequence_distance() (in module wildboar.distance)": [[15, "wildboar.distance.pairwise_subsequence_distance"]], "predict() (wildboar.distance.kmeans method)": [[15, "wildboar.distance.KMeans.predict"]], "predict() (wildboar.distance.kmedoids method)": [[15, "wildboar.distance.KMedoids.predict"]], "predict() (wildboar.distance.kneighborsclassifier method)": [[15, "wildboar.distance.KNeighborsClassifier.predict"]], "predict_proba() (wildboar.distance.kneighborsclassifier method)": [[15, "wildboar.distance.KNeighborsClassifier.predict_proba"]], "score() (wildboar.distance.kneighborsclassifier method)": [[15, "wildboar.distance.KNeighborsClassifier.score"]], "set_output() (wildboar.distance.kmeans method)": [[15, "wildboar.distance.KMeans.set_output"]], "set_output() (wildboar.distance.kmedoids method)": [[15, "wildboar.distance.KMedoids.set_output"]], "set_params() (wildboar.distance.kmeans method)": [[15, "wildboar.distance.KMeans.set_params"]], "set_params() (wildboar.distance.kmedoids method)": [[15, "wildboar.distance.KMedoids.set_params"]], "set_params() (wildboar.distance.kneighborsclassifier method)": [[15, "wildboar.distance.KNeighborsClassifier.set_params"]], "subsequence_match() (in module wildboar.distance)": [[15, "wildboar.distance.subsequence_match"]], "transform() (wildboar.distance.kmeans method)": [[15, "wildboar.distance.KMeans.transform"]], "transform() (wildboar.distance.kmedoids method)": [[15, "wildboar.distance.KMedoids.transform"]], "wildboar.distance": [[15, "module-wildboar.distance"]], "baggingclassifier (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier"]], "baggingregressor (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.BaggingRegressor"]], "basebagging (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.BaseBagging"]], "baseforestclassifier (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier"]], "baseforestregressor (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.BaseForestRegressor"]], "baseshapeletforestclassifier (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier"]], "baseshapeletforestregressor (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestRegressor"]], "extrashapelettreesclassifier (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier"]], "extrashapelettreesregressor (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesRegressor"]], "forestmixin (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.ForestMixin"]], "intervalforestclassifier (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier"]], "intervalforestregressor (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.IntervalForestRegressor"]], "isolationshapeletforest (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.IsolationShapeletForest"]], "pivotforestclassifier (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier"]], "proximityforestclassifier (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier"]], "rocketforestclassifier (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier"]], "rocketforestregressor (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.RocketForestRegressor"]], "shapeletforestclassifier (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier"]], "shapeletforestembedding (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.ShapeletForestEmbedding"]], "shapeletforestregressor (class in wildboar.ensemble._ensemble)": [[16, "wildboar.ensemble._ensemble.ShapeletForestRegressor"]], "base_estimator_ (wildboar.ensemble._ensemble.baggingclassifier property)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.baggingregressor property)": [[16, "wildboar.ensemble._ensemble.BaggingRegressor.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.basebagging property)": [[16, "wildboar.ensemble._ensemble.BaseBagging.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.baseforestclassifier property)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.baseforestregressor property)": [[16, "wildboar.ensemble._ensemble.BaseForestRegressor.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.baseshapeletforestclassifier property)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.baseshapeletforestregressor property)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestRegressor.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.extrashapelettreesclassifier property)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.extrashapelettreesregressor property)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesRegressor.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.intervalforestclassifier property)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.intervalforestregressor property)": [[16, "wildboar.ensemble._ensemble.IntervalForestRegressor.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.isolationshapeletforest property)": [[16, "wildboar.ensemble._ensemble.IsolationShapeletForest.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.pivotforestclassifier property)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.proximityforestclassifier property)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.rocketforestclassifier property)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.rocketforestregressor property)": [[16, "wildboar.ensemble._ensemble.RocketForestRegressor.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.shapeletforestclassifier property)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.shapeletforestembedding property)": [[16, "wildboar.ensemble._ensemble.ShapeletForestEmbedding.base_estimator_"]], "base_estimator_ (wildboar.ensemble._ensemble.shapeletforestregressor property)": [[16, "wildboar.ensemble._ensemble.ShapeletForestRegressor.base_estimator_"]], "decision_function() (wildboar.ensemble._ensemble.baggingclassifier method)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier.decision_function"]], "decision_function() (wildboar.ensemble._ensemble.baseforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier.decision_function"]], "decision_function() (wildboar.ensemble._ensemble.baseshapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier.decision_function"]], "decision_function() (wildboar.ensemble._ensemble.extrashapelettreesclassifier method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier.decision_function"]], "decision_function() (wildboar.ensemble._ensemble.intervalforestclassifier method)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier.decision_function"]], "decision_function() (wildboar.ensemble._ensemble.pivotforestclassifier method)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier.decision_function"]], "decision_function() (wildboar.ensemble._ensemble.proximityforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier.decision_function"]], "decision_function() (wildboar.ensemble._ensemble.rocketforestclassifier method)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier.decision_function"]], "decision_function() (wildboar.ensemble._ensemble.shapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier.decision_function"]], "estimators_samples_ (wildboar.ensemble._ensemble.baggingclassifier property)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.baggingregressor property)": [[16, "wildboar.ensemble._ensemble.BaggingRegressor.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.basebagging property)": [[16, "wildboar.ensemble._ensemble.BaseBagging.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.baseforestclassifier property)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.baseforestregressor property)": [[16, "wildboar.ensemble._ensemble.BaseForestRegressor.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.baseshapeletforestclassifier property)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.baseshapeletforestregressor property)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestRegressor.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.extrashapelettreesclassifier property)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.extrashapelettreesregressor property)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesRegressor.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.intervalforestclassifier property)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.intervalforestregressor property)": [[16, "wildboar.ensemble._ensemble.IntervalForestRegressor.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.isolationshapeletforest property)": [[16, "wildboar.ensemble._ensemble.IsolationShapeletForest.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.pivotforestclassifier property)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.proximityforestclassifier property)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.rocketforestclassifier property)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.rocketforestregressor property)": [[16, "wildboar.ensemble._ensemble.RocketForestRegressor.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.shapeletforestclassifier property)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.shapeletforestembedding property)": [[16, "wildboar.ensemble._ensemble.ShapeletForestEmbedding.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble._ensemble.shapeletforestregressor property)": [[16, "wildboar.ensemble._ensemble.ShapeletForestRegressor.estimators_samples_"]], "fit() (wildboar.ensemble._ensemble.baggingclassifier method)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier.fit"]], "fit() (wildboar.ensemble._ensemble.baggingregressor method)": [[16, "wildboar.ensemble._ensemble.BaggingRegressor.fit"]], "fit() (wildboar.ensemble._ensemble.basebagging method)": [[16, "wildboar.ensemble._ensemble.BaseBagging.fit"]], "fit() (wildboar.ensemble._ensemble.baseforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier.fit"]], "fit() (wildboar.ensemble._ensemble.baseforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseForestRegressor.fit"]], "fit() (wildboar.ensemble._ensemble.baseshapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier.fit"]], "fit() (wildboar.ensemble._ensemble.baseshapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestRegressor.fit"]], "fit() (wildboar.ensemble._ensemble.extrashapelettreesclassifier method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier.fit"]], "fit() (wildboar.ensemble._ensemble.extrashapelettreesregressor method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesRegressor.fit"]], "fit() (wildboar.ensemble._ensemble.intervalforestclassifier method)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier.fit"]], "fit() (wildboar.ensemble._ensemble.intervalforestregressor method)": [[16, "wildboar.ensemble._ensemble.IntervalForestRegressor.fit"]], "fit() (wildboar.ensemble._ensemble.isolationshapeletforest method)": [[16, "wildboar.ensemble._ensemble.IsolationShapeletForest.fit"]], "fit() (wildboar.ensemble._ensemble.pivotforestclassifier method)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier.fit"]], "fit() (wildboar.ensemble._ensemble.proximityforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier.fit"]], "fit() (wildboar.ensemble._ensemble.rocketforestclassifier method)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier.fit"]], "fit() (wildboar.ensemble._ensemble.rocketforestregressor method)": [[16, "wildboar.ensemble._ensemble.RocketForestRegressor.fit"]], "fit() (wildboar.ensemble._ensemble.shapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier.fit"]], "fit() (wildboar.ensemble._ensemble.shapeletforestembedding method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestEmbedding.fit"]], "fit() (wildboar.ensemble._ensemble.shapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestRegressor.fit"]], "fit_predict() (wildboar.ensemble._ensemble.isolationshapeletforest method)": [[16, "wildboar.ensemble._ensemble.IsolationShapeletForest.fit_predict"]], "get_metadata_routing() (wildboar.ensemble._ensemble.baggingclassifier method)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.baggingregressor method)": [[16, "wildboar.ensemble._ensemble.BaggingRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.basebagging method)": [[16, "wildboar.ensemble._ensemble.BaseBagging.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.baseforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.baseforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseForestRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.baseshapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.baseshapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.extrashapelettreesclassifier method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.extrashapelettreesregressor method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.intervalforestclassifier method)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.intervalforestregressor method)": [[16, "wildboar.ensemble._ensemble.IntervalForestRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.isolationshapeletforest method)": [[16, "wildboar.ensemble._ensemble.IsolationShapeletForest.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.pivotforestclassifier method)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.proximityforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.rocketforestclassifier method)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.rocketforestregressor method)": [[16, "wildboar.ensemble._ensemble.RocketForestRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.shapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.shapeletforestembedding method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestEmbedding.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble._ensemble.shapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestRegressor.get_metadata_routing"]], "get_params() (wildboar.ensemble._ensemble.baggingclassifier method)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier.get_params"]], "get_params() (wildboar.ensemble._ensemble.baggingregressor method)": [[16, "wildboar.ensemble._ensemble.BaggingRegressor.get_params"]], "get_params() (wildboar.ensemble._ensemble.basebagging method)": [[16, "wildboar.ensemble._ensemble.BaseBagging.get_params"]], "get_params() (wildboar.ensemble._ensemble.baseforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier.get_params"]], "get_params() (wildboar.ensemble._ensemble.baseforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseForestRegressor.get_params"]], "get_params() (wildboar.ensemble._ensemble.baseshapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier.get_params"]], "get_params() (wildboar.ensemble._ensemble.baseshapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestRegressor.get_params"]], "get_params() (wildboar.ensemble._ensemble.extrashapelettreesclassifier method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier.get_params"]], "get_params() (wildboar.ensemble._ensemble.extrashapelettreesregressor method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesRegressor.get_params"]], "get_params() (wildboar.ensemble._ensemble.intervalforestclassifier method)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier.get_params"]], "get_params() (wildboar.ensemble._ensemble.intervalforestregressor method)": [[16, "wildboar.ensemble._ensemble.IntervalForestRegressor.get_params"]], "get_params() (wildboar.ensemble._ensemble.isolationshapeletforest method)": [[16, "wildboar.ensemble._ensemble.IsolationShapeletForest.get_params"]], "get_params() (wildboar.ensemble._ensemble.pivotforestclassifier method)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier.get_params"]], "get_params() (wildboar.ensemble._ensemble.proximityforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier.get_params"]], "get_params() (wildboar.ensemble._ensemble.rocketforestclassifier method)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier.get_params"]], "get_params() (wildboar.ensemble._ensemble.rocketforestregressor method)": [[16, "wildboar.ensemble._ensemble.RocketForestRegressor.get_params"]], "get_params() (wildboar.ensemble._ensemble.shapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier.get_params"]], "get_params() (wildboar.ensemble._ensemble.shapeletforestembedding method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestEmbedding.get_params"]], "get_params() (wildboar.ensemble._ensemble.shapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestRegressor.get_params"]], "predict() (wildboar.ensemble._ensemble.baggingclassifier method)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier.predict"]], "predict() (wildboar.ensemble._ensemble.baggingregressor method)": [[16, "wildboar.ensemble._ensemble.BaggingRegressor.predict"]], "predict() (wildboar.ensemble._ensemble.baseforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier.predict"]], "predict() (wildboar.ensemble._ensemble.baseforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseForestRegressor.predict"]], "predict() (wildboar.ensemble._ensemble.baseshapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier.predict"]], "predict() (wildboar.ensemble._ensemble.baseshapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestRegressor.predict"]], "predict() (wildboar.ensemble._ensemble.extrashapelettreesclassifier method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier.predict"]], "predict() (wildboar.ensemble._ensemble.extrashapelettreesregressor method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesRegressor.predict"]], "predict() (wildboar.ensemble._ensemble.intervalforestclassifier method)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier.predict"]], "predict() (wildboar.ensemble._ensemble.intervalforestregressor method)": [[16, "wildboar.ensemble._ensemble.IntervalForestRegressor.predict"]], "predict() (wildboar.ensemble._ensemble.pivotforestclassifier method)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier.predict"]], "predict() (wildboar.ensemble._ensemble.proximityforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier.predict"]], "predict() (wildboar.ensemble._ensemble.rocketforestclassifier method)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier.predict"]], "predict() (wildboar.ensemble._ensemble.rocketforestregressor method)": [[16, "wildboar.ensemble._ensemble.RocketForestRegressor.predict"]], "predict() (wildboar.ensemble._ensemble.shapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier.predict"]], "predict() (wildboar.ensemble._ensemble.shapeletforestembedding method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestEmbedding.predict"]], "predict() (wildboar.ensemble._ensemble.shapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestRegressor.predict"]], "predict_log_proba() (wildboar.ensemble._ensemble.baggingclassifier method)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble._ensemble.baseforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble._ensemble.baseshapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble._ensemble.extrashapelettreesclassifier method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble._ensemble.intervalforestclassifier method)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble._ensemble.pivotforestclassifier method)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble._ensemble.proximityforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble._ensemble.rocketforestclassifier method)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble._ensemble.shapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier.predict_log_proba"]], "predict_proba() (wildboar.ensemble._ensemble.baggingclassifier method)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble._ensemble.baseforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble._ensemble.baseshapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble._ensemble.extrashapelettreesclassifier method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble._ensemble.intervalforestclassifier method)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble._ensemble.pivotforestclassifier method)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble._ensemble.proximityforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble._ensemble.rocketforestclassifier method)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble._ensemble.shapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier.predict_proba"]], "score() (wildboar.ensemble._ensemble.baggingclassifier method)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier.score"]], "score() (wildboar.ensemble._ensemble.baggingregressor method)": [[16, "wildboar.ensemble._ensemble.BaggingRegressor.score"]], "score() (wildboar.ensemble._ensemble.baseforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier.score"]], "score() (wildboar.ensemble._ensemble.baseforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseForestRegressor.score"]], "score() (wildboar.ensemble._ensemble.baseshapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier.score"]], "score() (wildboar.ensemble._ensemble.baseshapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestRegressor.score"]], "score() (wildboar.ensemble._ensemble.extrashapelettreesclassifier method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier.score"]], "score() (wildboar.ensemble._ensemble.extrashapelettreesregressor method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesRegressor.score"]], "score() (wildboar.ensemble._ensemble.intervalforestclassifier method)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier.score"]], "score() (wildboar.ensemble._ensemble.intervalforestregressor method)": [[16, "wildboar.ensemble._ensemble.IntervalForestRegressor.score"]], "score() (wildboar.ensemble._ensemble.pivotforestclassifier method)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier.score"]], "score() (wildboar.ensemble._ensemble.proximityforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier.score"]], "score() (wildboar.ensemble._ensemble.rocketforestclassifier method)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier.score"]], "score() (wildboar.ensemble._ensemble.rocketforestregressor method)": [[16, "wildboar.ensemble._ensemble.RocketForestRegressor.score"]], "score() (wildboar.ensemble._ensemble.shapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier.score"]], "score() (wildboar.ensemble._ensemble.shapeletforestembedding method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestEmbedding.score"]], "score() (wildboar.ensemble._ensemble.shapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestRegressor.score"]], "set_params() (wildboar.ensemble._ensemble.baggingclassifier method)": [[16, "wildboar.ensemble._ensemble.BaggingClassifier.set_params"]], "set_params() (wildboar.ensemble._ensemble.baggingregressor method)": [[16, "wildboar.ensemble._ensemble.BaggingRegressor.set_params"]], "set_params() (wildboar.ensemble._ensemble.basebagging method)": [[16, "wildboar.ensemble._ensemble.BaseBagging.set_params"]], "set_params() (wildboar.ensemble._ensemble.baseforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseForestClassifier.set_params"]], "set_params() (wildboar.ensemble._ensemble.baseforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseForestRegressor.set_params"]], "set_params() (wildboar.ensemble._ensemble.baseshapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestClassifier.set_params"]], "set_params() (wildboar.ensemble._ensemble.baseshapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.BaseShapeletForestRegressor.set_params"]], "set_params() (wildboar.ensemble._ensemble.extrashapelettreesclassifier method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesClassifier.set_params"]], "set_params() (wildboar.ensemble._ensemble.extrashapelettreesregressor method)": [[16, "wildboar.ensemble._ensemble.ExtraShapeletTreesRegressor.set_params"]], "set_params() (wildboar.ensemble._ensemble.intervalforestclassifier method)": [[16, "wildboar.ensemble._ensemble.IntervalForestClassifier.set_params"]], "set_params() (wildboar.ensemble._ensemble.intervalforestregressor method)": [[16, "wildboar.ensemble._ensemble.IntervalForestRegressor.set_params"]], "set_params() (wildboar.ensemble._ensemble.isolationshapeletforest method)": [[16, "wildboar.ensemble._ensemble.IsolationShapeletForest.set_params"]], "set_params() (wildboar.ensemble._ensemble.pivotforestclassifier method)": [[16, "wildboar.ensemble._ensemble.PivotForestClassifier.set_params"]], "set_params() (wildboar.ensemble._ensemble.proximityforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ProximityForestClassifier.set_params"]], "set_params() (wildboar.ensemble._ensemble.rocketforestclassifier method)": [[16, "wildboar.ensemble._ensemble.RocketForestClassifier.set_params"]], "set_params() (wildboar.ensemble._ensemble.rocketforestregressor method)": [[16, "wildboar.ensemble._ensemble.RocketForestRegressor.set_params"]], "set_params() (wildboar.ensemble._ensemble.shapeletforestclassifier method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestClassifier.set_params"]], "set_params() (wildboar.ensemble._ensemble.shapeletforestembedding method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestEmbedding.set_params"]], "set_params() (wildboar.ensemble._ensemble.shapeletforestregressor method)": [[16, "wildboar.ensemble._ensemble.ShapeletForestRegressor.set_params"]], "wildboar.ensemble._ensemble": [[16, "module-wildboar.ensemble._ensemble"]], "baggingclassifier (class in wildboar.ensemble)": [[17, "wildboar.ensemble.BaggingClassifier"]], "baggingregressor (class in wildboar.ensemble)": [[17, "wildboar.ensemble.BaggingRegressor"]], "basebagging (class in wildboar.ensemble)": [[17, "wildboar.ensemble.BaseBagging"]], "extrashapelettreesclassifier (class in wildboar.ensemble)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier"]], "extrashapelettreesregressor (class in wildboar.ensemble)": [[17, "wildboar.ensemble.ExtraShapeletTreesRegressor"]], "intervalforestclassifier (class in wildboar.ensemble)": [[17, "wildboar.ensemble.IntervalForestClassifier"]], "intervalforestregressor (class in wildboar.ensemble)": [[17, "wildboar.ensemble.IntervalForestRegressor"]], "isolationshapeletforest (class in wildboar.ensemble)": [[17, "wildboar.ensemble.IsolationShapeletForest"]], "pivotforestclassifier (class in wildboar.ensemble)": [[17, "wildboar.ensemble.PivotForestClassifier"]], "proximityforestclassifier (class in wildboar.ensemble)": [[17, "wildboar.ensemble.ProximityForestClassifier"]], "rocketforestclassifier (class in wildboar.ensemble)": [[17, "wildboar.ensemble.RocketForestClassifier"]], "rocketforestregressor (class in wildboar.ensemble)": [[17, "wildboar.ensemble.RocketForestRegressor"]], "shapeletforestclassifier (class in wildboar.ensemble)": [[17, "wildboar.ensemble.ShapeletForestClassifier"]], "shapeletforestembedding (class in wildboar.ensemble)": [[17, "wildboar.ensemble.ShapeletForestEmbedding"]], "shapeletforestregressor (class in wildboar.ensemble)": [[17, "wildboar.ensemble.ShapeletForestRegressor"]], "base_estimator_ (wildboar.ensemble.baggingclassifier property)": [[17, "wildboar.ensemble.BaggingClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble.baggingregressor property)": [[17, "wildboar.ensemble.BaggingRegressor.base_estimator_"]], "base_estimator_ (wildboar.ensemble.basebagging property)": [[17, "wildboar.ensemble.BaseBagging.base_estimator_"]], "base_estimator_ (wildboar.ensemble.extrashapelettreesclassifier property)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble.extrashapelettreesregressor property)": [[17, "wildboar.ensemble.ExtraShapeletTreesRegressor.base_estimator_"]], "base_estimator_ (wildboar.ensemble.intervalforestclassifier property)": [[17, "wildboar.ensemble.IntervalForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble.intervalforestregressor property)": [[17, "wildboar.ensemble.IntervalForestRegressor.base_estimator_"]], "base_estimator_ (wildboar.ensemble.isolationshapeletforest property)": [[17, "wildboar.ensemble.IsolationShapeletForest.base_estimator_"]], "base_estimator_ (wildboar.ensemble.pivotforestclassifier property)": [[17, "wildboar.ensemble.PivotForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble.proximityforestclassifier property)": [[17, "wildboar.ensemble.ProximityForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble.rocketforestclassifier property)": [[17, "wildboar.ensemble.RocketForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble.rocketforestregressor property)": [[17, "wildboar.ensemble.RocketForestRegressor.base_estimator_"]], "base_estimator_ (wildboar.ensemble.shapeletforestclassifier property)": [[17, "wildboar.ensemble.ShapeletForestClassifier.base_estimator_"]], "base_estimator_ (wildboar.ensemble.shapeletforestembedding property)": [[17, "wildboar.ensemble.ShapeletForestEmbedding.base_estimator_"]], "base_estimator_ (wildboar.ensemble.shapeletforestregressor property)": [[17, "wildboar.ensemble.ShapeletForestRegressor.base_estimator_"]], "decision_function() (wildboar.ensemble.baggingclassifier method)": [[17, "wildboar.ensemble.BaggingClassifier.decision_function"]], "decision_function() (wildboar.ensemble.extrashapelettreesclassifier method)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier.decision_function"]], "decision_function() (wildboar.ensemble.intervalforestclassifier method)": [[17, "wildboar.ensemble.IntervalForestClassifier.decision_function"]], "decision_function() (wildboar.ensemble.pivotforestclassifier method)": [[17, "wildboar.ensemble.PivotForestClassifier.decision_function"]], "decision_function() (wildboar.ensemble.proximityforestclassifier method)": [[17, "wildboar.ensemble.ProximityForestClassifier.decision_function"]], "decision_function() (wildboar.ensemble.rocketforestclassifier method)": [[17, "wildboar.ensemble.RocketForestClassifier.decision_function"]], "decision_function() (wildboar.ensemble.shapeletforestclassifier method)": [[17, "wildboar.ensemble.ShapeletForestClassifier.decision_function"]], "estimators_samples_ (wildboar.ensemble.baggingclassifier property)": [[17, "wildboar.ensemble.BaggingClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.baggingregressor property)": [[17, "wildboar.ensemble.BaggingRegressor.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.basebagging property)": [[17, "wildboar.ensemble.BaseBagging.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.extrashapelettreesclassifier property)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.extrashapelettreesregressor property)": [[17, "wildboar.ensemble.ExtraShapeletTreesRegressor.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.intervalforestclassifier property)": [[17, "wildboar.ensemble.IntervalForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.intervalforestregressor property)": [[17, "wildboar.ensemble.IntervalForestRegressor.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.isolationshapeletforest property)": [[17, "wildboar.ensemble.IsolationShapeletForest.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.pivotforestclassifier property)": [[17, "wildboar.ensemble.PivotForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.proximityforestclassifier property)": [[17, "wildboar.ensemble.ProximityForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.rocketforestclassifier property)": [[17, "wildboar.ensemble.RocketForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.rocketforestregressor property)": [[17, "wildboar.ensemble.RocketForestRegressor.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.shapeletforestclassifier property)": [[17, "wildboar.ensemble.ShapeletForestClassifier.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.shapeletforestembedding property)": [[17, "wildboar.ensemble.ShapeletForestEmbedding.estimators_samples_"]], "estimators_samples_ (wildboar.ensemble.shapeletforestregressor property)": [[17, "wildboar.ensemble.ShapeletForestRegressor.estimators_samples_"]], "fit() (wildboar.ensemble.baggingclassifier method)": [[17, "wildboar.ensemble.BaggingClassifier.fit"]], "fit() (wildboar.ensemble.baggingregressor method)": [[17, "wildboar.ensemble.BaggingRegressor.fit"]], "fit() (wildboar.ensemble.basebagging method)": [[17, "wildboar.ensemble.BaseBagging.fit"]], "fit() (wildboar.ensemble.extrashapelettreesclassifier method)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier.fit"]], "fit() (wildboar.ensemble.extrashapelettreesregressor method)": [[17, "wildboar.ensemble.ExtraShapeletTreesRegressor.fit"]], "fit() (wildboar.ensemble.intervalforestclassifier method)": [[17, "wildboar.ensemble.IntervalForestClassifier.fit"]], "fit() (wildboar.ensemble.intervalforestregressor method)": [[17, "wildboar.ensemble.IntervalForestRegressor.fit"]], "fit() (wildboar.ensemble.isolationshapeletforest method)": [[17, "wildboar.ensemble.IsolationShapeletForest.fit"]], "fit() (wildboar.ensemble.pivotforestclassifier method)": [[17, "wildboar.ensemble.PivotForestClassifier.fit"]], "fit() (wildboar.ensemble.proximityforestclassifier method)": [[17, "wildboar.ensemble.ProximityForestClassifier.fit"]], "fit() (wildboar.ensemble.rocketforestclassifier method)": [[17, "wildboar.ensemble.RocketForestClassifier.fit"]], "fit() (wildboar.ensemble.rocketforestregressor method)": [[17, "wildboar.ensemble.RocketForestRegressor.fit"]], "fit() (wildboar.ensemble.shapeletforestclassifier method)": [[17, "wildboar.ensemble.ShapeletForestClassifier.fit"]], "fit() (wildboar.ensemble.shapeletforestembedding method)": [[17, "wildboar.ensemble.ShapeletForestEmbedding.fit"]], "fit() (wildboar.ensemble.shapeletforestregressor method)": [[17, "wildboar.ensemble.ShapeletForestRegressor.fit"]], "fit_predict() (wildboar.ensemble.isolationshapeletforest method)": [[17, "wildboar.ensemble.IsolationShapeletForest.fit_predict"]], "get_metadata_routing() (wildboar.ensemble.baggingclassifier method)": [[17, "wildboar.ensemble.BaggingClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.baggingregressor method)": [[17, "wildboar.ensemble.BaggingRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.basebagging method)": [[17, "wildboar.ensemble.BaseBagging.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.extrashapelettreesclassifier method)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.extrashapelettreesregressor method)": [[17, "wildboar.ensemble.ExtraShapeletTreesRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.intervalforestclassifier method)": [[17, "wildboar.ensemble.IntervalForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.intervalforestregressor method)": [[17, "wildboar.ensemble.IntervalForestRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.isolationshapeletforest method)": [[17, "wildboar.ensemble.IsolationShapeletForest.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.pivotforestclassifier method)": [[17, "wildboar.ensemble.PivotForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.proximityforestclassifier method)": [[17, "wildboar.ensemble.ProximityForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.rocketforestclassifier method)": [[17, "wildboar.ensemble.RocketForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.rocketforestregressor method)": [[17, "wildboar.ensemble.RocketForestRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.shapeletforestclassifier method)": [[17, "wildboar.ensemble.ShapeletForestClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.shapeletforestembedding method)": [[17, "wildboar.ensemble.ShapeletForestEmbedding.get_metadata_routing"]], "get_metadata_routing() (wildboar.ensemble.shapeletforestregressor method)": [[17, "wildboar.ensemble.ShapeletForestRegressor.get_metadata_routing"]], "get_params() (wildboar.ensemble.baggingclassifier method)": [[17, "wildboar.ensemble.BaggingClassifier.get_params"]], "get_params() (wildboar.ensemble.baggingregressor method)": [[17, "wildboar.ensemble.BaggingRegressor.get_params"]], "get_params() (wildboar.ensemble.basebagging method)": [[17, "wildboar.ensemble.BaseBagging.get_params"]], "get_params() (wildboar.ensemble.extrashapelettreesclassifier method)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier.get_params"]], "get_params() (wildboar.ensemble.extrashapelettreesregressor method)": [[17, "wildboar.ensemble.ExtraShapeletTreesRegressor.get_params"]], "get_params() (wildboar.ensemble.intervalforestclassifier method)": [[17, "wildboar.ensemble.IntervalForestClassifier.get_params"]], "get_params() (wildboar.ensemble.intervalforestregressor method)": [[17, "wildboar.ensemble.IntervalForestRegressor.get_params"]], "get_params() (wildboar.ensemble.isolationshapeletforest method)": [[17, "wildboar.ensemble.IsolationShapeletForest.get_params"]], "get_params() (wildboar.ensemble.pivotforestclassifier method)": [[17, "wildboar.ensemble.PivotForestClassifier.get_params"]], "get_params() (wildboar.ensemble.proximityforestclassifier method)": [[17, "wildboar.ensemble.ProximityForestClassifier.get_params"]], "get_params() (wildboar.ensemble.rocketforestclassifier method)": [[17, "wildboar.ensemble.RocketForestClassifier.get_params"]], "get_params() (wildboar.ensemble.rocketforestregressor method)": [[17, "wildboar.ensemble.RocketForestRegressor.get_params"]], "get_params() (wildboar.ensemble.shapeletforestclassifier method)": [[17, "wildboar.ensemble.ShapeletForestClassifier.get_params"]], "get_params() (wildboar.ensemble.shapeletforestembedding method)": [[17, "wildboar.ensemble.ShapeletForestEmbedding.get_params"]], "get_params() (wildboar.ensemble.shapeletforestregressor method)": [[17, "wildboar.ensemble.ShapeletForestRegressor.get_params"]], "predict() (wildboar.ensemble.baggingclassifier method)": [[17, "wildboar.ensemble.BaggingClassifier.predict"]], "predict() (wildboar.ensemble.baggingregressor method)": [[17, "wildboar.ensemble.BaggingRegressor.predict"]], "predict() (wildboar.ensemble.extrashapelettreesclassifier method)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier.predict"]], "predict() (wildboar.ensemble.extrashapelettreesregressor method)": [[17, "wildboar.ensemble.ExtraShapeletTreesRegressor.predict"]], "predict() (wildboar.ensemble.intervalforestclassifier method)": [[17, "wildboar.ensemble.IntervalForestClassifier.predict"]], "predict() (wildboar.ensemble.intervalforestregressor method)": [[17, "wildboar.ensemble.IntervalForestRegressor.predict"]], "predict() (wildboar.ensemble.pivotforestclassifier method)": [[17, "wildboar.ensemble.PivotForestClassifier.predict"]], "predict() (wildboar.ensemble.proximityforestclassifier method)": [[17, "wildboar.ensemble.ProximityForestClassifier.predict"]], "predict() (wildboar.ensemble.rocketforestclassifier method)": [[17, "wildboar.ensemble.RocketForestClassifier.predict"]], "predict() (wildboar.ensemble.rocketforestregressor method)": [[17, "wildboar.ensemble.RocketForestRegressor.predict"]], "predict() (wildboar.ensemble.shapeletforestclassifier method)": [[17, "wildboar.ensemble.ShapeletForestClassifier.predict"]], "predict() (wildboar.ensemble.shapeletforestembedding method)": [[17, "wildboar.ensemble.ShapeletForestEmbedding.predict"]], "predict() (wildboar.ensemble.shapeletforestregressor method)": [[17, "wildboar.ensemble.ShapeletForestRegressor.predict"]], "predict_log_proba() (wildboar.ensemble.baggingclassifier method)": [[17, "wildboar.ensemble.BaggingClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble.extrashapelettreesclassifier method)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble.intervalforestclassifier method)": [[17, "wildboar.ensemble.IntervalForestClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble.pivotforestclassifier method)": [[17, "wildboar.ensemble.PivotForestClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble.proximityforestclassifier method)": [[17, "wildboar.ensemble.ProximityForestClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble.rocketforestclassifier method)": [[17, "wildboar.ensemble.RocketForestClassifier.predict_log_proba"]], "predict_log_proba() (wildboar.ensemble.shapeletforestclassifier method)": [[17, "wildboar.ensemble.ShapeletForestClassifier.predict_log_proba"]], "predict_proba() (wildboar.ensemble.baggingclassifier method)": [[17, "wildboar.ensemble.BaggingClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble.extrashapelettreesclassifier method)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble.intervalforestclassifier method)": [[17, "wildboar.ensemble.IntervalForestClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble.pivotforestclassifier method)": [[17, "wildboar.ensemble.PivotForestClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble.proximityforestclassifier method)": [[17, "wildboar.ensemble.ProximityForestClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble.rocketforestclassifier method)": [[17, "wildboar.ensemble.RocketForestClassifier.predict_proba"]], "predict_proba() (wildboar.ensemble.shapeletforestclassifier method)": [[17, "wildboar.ensemble.ShapeletForestClassifier.predict_proba"]], "score() (wildboar.ensemble.baggingclassifier method)": [[17, "wildboar.ensemble.BaggingClassifier.score"]], "score() (wildboar.ensemble.baggingregressor method)": [[17, "wildboar.ensemble.BaggingRegressor.score"]], "score() (wildboar.ensemble.extrashapelettreesclassifier method)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier.score"]], "score() (wildboar.ensemble.extrashapelettreesregressor method)": [[17, "wildboar.ensemble.ExtraShapeletTreesRegressor.score"]], "score() (wildboar.ensemble.intervalforestclassifier method)": [[17, "wildboar.ensemble.IntervalForestClassifier.score"]], "score() (wildboar.ensemble.intervalforestregressor method)": [[17, "wildboar.ensemble.IntervalForestRegressor.score"]], "score() (wildboar.ensemble.pivotforestclassifier method)": [[17, "wildboar.ensemble.PivotForestClassifier.score"]], "score() (wildboar.ensemble.proximityforestclassifier method)": [[17, "wildboar.ensemble.ProximityForestClassifier.score"]], "score() (wildboar.ensemble.rocketforestclassifier method)": [[17, "wildboar.ensemble.RocketForestClassifier.score"]], "score() (wildboar.ensemble.rocketforestregressor method)": [[17, "wildboar.ensemble.RocketForestRegressor.score"]], "score() (wildboar.ensemble.shapeletforestclassifier method)": [[17, "wildboar.ensemble.ShapeletForestClassifier.score"]], "score() (wildboar.ensemble.shapeletforestembedding method)": [[17, "wildboar.ensemble.ShapeletForestEmbedding.score"]], "score() (wildboar.ensemble.shapeletforestregressor method)": [[17, "wildboar.ensemble.ShapeletForestRegressor.score"]], "set_params() (wildboar.ensemble.baggingclassifier method)": [[17, "wildboar.ensemble.BaggingClassifier.set_params"]], "set_params() (wildboar.ensemble.baggingregressor method)": [[17, "wildboar.ensemble.BaggingRegressor.set_params"]], "set_params() (wildboar.ensemble.basebagging method)": [[17, "wildboar.ensemble.BaseBagging.set_params"]], "set_params() (wildboar.ensemble.extrashapelettreesclassifier method)": [[17, "wildboar.ensemble.ExtraShapeletTreesClassifier.set_params"]], "set_params() (wildboar.ensemble.extrashapelettreesregressor method)": [[17, "wildboar.ensemble.ExtraShapeletTreesRegressor.set_params"]], "set_params() (wildboar.ensemble.intervalforestclassifier method)": [[17, "wildboar.ensemble.IntervalForestClassifier.set_params"]], "set_params() (wildboar.ensemble.intervalforestregressor method)": [[17, "wildboar.ensemble.IntervalForestRegressor.set_params"]], "set_params() (wildboar.ensemble.isolationshapeletforest method)": [[17, "wildboar.ensemble.IsolationShapeletForest.set_params"]], "set_params() (wildboar.ensemble.pivotforestclassifier method)": [[17, "wildboar.ensemble.PivotForestClassifier.set_params"]], "set_params() (wildboar.ensemble.proximityforestclassifier method)": [[17, "wildboar.ensemble.ProximityForestClassifier.set_params"]], "set_params() (wildboar.ensemble.rocketforestclassifier method)": [[17, "wildboar.ensemble.RocketForestClassifier.set_params"]], "set_params() (wildboar.ensemble.rocketforestregressor method)": [[17, "wildboar.ensemble.RocketForestRegressor.set_params"]], "set_params() (wildboar.ensemble.shapeletforestclassifier method)": [[17, "wildboar.ensemble.ShapeletForestClassifier.set_params"]], "set_params() (wildboar.ensemble.shapeletforestembedding method)": [[17, "wildboar.ensemble.ShapeletForestEmbedding.set_params"]], "set_params() (wildboar.ensemble.shapeletforestregressor method)": [[17, "wildboar.ensemble.ShapeletForestRegressor.set_params"]], "wildboar.ensemble": [[17, "module-wildboar.ensemble"]], "amplitudeimportance (class in wildboar.explain._importance)": [[18, "wildboar.explain._importance.AmplitudeImportance"]], "intervalimportance (class in wildboar.explain._importance)": [[18, "wildboar.explain._importance.IntervalImportance"]], "permuteimportance (class in wildboar.explain._importance)": [[18, "wildboar.explain._importance.PermuteImportance"]], "shapeletimportance (class in wildboar.explain._importance)": [[18, "wildboar.explain._importance.ShapeletImportance"]], "fit_explain() (wildboar.explain._importance.amplitudeimportance method)": [[18, "wildboar.explain._importance.AmplitudeImportance.fit_explain"]], "fit_explain() (wildboar.explain._importance.intervalimportance method)": [[18, "wildboar.explain._importance.IntervalImportance.fit_explain"]], "fit_explain() (wildboar.explain._importance.shapeletimportance method)": [[18, "wildboar.explain._importance.ShapeletImportance.fit_explain"]], "get_metadata_routing() (wildboar.explain._importance.amplitudeimportance method)": [[18, "wildboar.explain._importance.AmplitudeImportance.get_metadata_routing"]], "get_metadata_routing() (wildboar.explain._importance.intervalimportance method)": [[18, "wildboar.explain._importance.IntervalImportance.get_metadata_routing"]], "get_metadata_routing() (wildboar.explain._importance.permuteimportance method)": [[18, "wildboar.explain._importance.PermuteImportance.get_metadata_routing"]], "get_metadata_routing() (wildboar.explain._importance.shapeletimportance method)": [[18, "wildboar.explain._importance.ShapeletImportance.get_metadata_routing"]], "get_params() (wildboar.explain._importance.amplitudeimportance method)": [[18, "wildboar.explain._importance.AmplitudeImportance.get_params"]], "get_params() (wildboar.explain._importance.intervalimportance method)": [[18, "wildboar.explain._importance.IntervalImportance.get_params"]], "get_params() (wildboar.explain._importance.permuteimportance method)": [[18, "wildboar.explain._importance.PermuteImportance.get_params"]], "get_params() (wildboar.explain._importance.shapeletimportance method)": [[18, "wildboar.explain._importance.ShapeletImportance.get_params"]], "plot() (wildboar.explain._importance.amplitudeimportance method)": [[18, "wildboar.explain._importance.AmplitudeImportance.plot"]], "plot() (wildboar.explain._importance.intervalimportance method)": [[18, "wildboar.explain._importance.IntervalImportance.plot"]], "plot() (wildboar.explain._importance.shapeletimportance method)": [[18, "wildboar.explain._importance.ShapeletImportance.plot"]], "plot_importances() (in module wildboar.explain._importance)": [[18, "wildboar.explain._importance.plot_importances"]], "set_params() (wildboar.explain._importance.amplitudeimportance method)": [[18, "wildboar.explain._importance.AmplitudeImportance.set_params"]], "set_params() (wildboar.explain._importance.intervalimportance method)": [[18, "wildboar.explain._importance.IntervalImportance.set_params"]], "set_params() (wildboar.explain._importance.permuteimportance method)": [[18, "wildboar.explain._importance.PermuteImportance.set_params"]], "set_params() (wildboar.explain._importance.shapeletimportance method)": [[18, "wildboar.explain._importance.ShapeletImportance.set_params"]], "wildboar.explain._importance": [[18, "module-wildboar.explain._importance"]], "counterfactuals() (in module wildboar.explain.counterfactual._helper)": [[19, "wildboar.explain.counterfactual._helper.counterfactuals"]], "wildboar.explain.counterfactual._helper": [[19, "module-wildboar.explain.counterfactual._helper"]], "kneighborscounterfactual (class in wildboar.explain.counterfactual._nn)": [[20, "wildboar.explain.counterfactual._nn.KNeighborsCounterfactual"]], "fit_explain() (wildboar.explain.counterfactual._nn.kneighborscounterfactual method)": [[20, "wildboar.explain.counterfactual._nn.KNeighborsCounterfactual.fit_explain"]], "get_metadata_routing() (wildboar.explain.counterfactual._nn.kneighborscounterfactual method)": [[20, "wildboar.explain.counterfactual._nn.KNeighborsCounterfactual.get_metadata_routing"]], "get_params() (wildboar.explain.counterfactual._nn.kneighborscounterfactual method)": [[20, "wildboar.explain.counterfactual._nn.KNeighborsCounterfactual.get_params"]], "plot() (wildboar.explain.counterfactual._nn.kneighborscounterfactual method)": [[20, "wildboar.explain.counterfactual._nn.KNeighborsCounterfactual.plot"]], "score() (wildboar.explain.counterfactual._nn.kneighborscounterfactual method)": [[20, "wildboar.explain.counterfactual._nn.KNeighborsCounterfactual.score"]], "set_params() (wildboar.explain.counterfactual._nn.kneighborscounterfactual method)": [[20, "wildboar.explain.counterfactual._nn.KNeighborsCounterfactual.set_params"]], "wildboar.explain.counterfactual._nn": [[20, "module-wildboar.explain.counterfactual._nn"]], "dynamictimewarptransform (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.DynamicTimeWarpTransform"]], "euclideantransform (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.EuclideanTransform"]], "knearestprototypesampler (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.KNearestPrototypeSampler"]], "knearestshapeletprototypesampler (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.KNearestShapeletPrototypeSampler"]], "metrictransform (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.MetricTransform"]], "predictevaluator (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.PredictEvaluator"]], "probabilityevaluator (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.ProbabilityEvaluator"]], "prototypecounterfactual (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.PrototypeCounterfactual"]], "prototypesampler (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.PrototypeSampler"]], "shapeletprototypesampler (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.ShapeletPrototypeSampler"]], "targetevaluator (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.TargetEvaluator"]], "uniformprototypesampler (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.UniformPrototypeSampler"]], "weighteddynamictimewarptransform (class in wildboar.explain.counterfactual._proto)": [[21, "wildboar.explain.counterfactual._proto.WeightedDynamicTimeWarpTransform"]], "fit_explain() (wildboar.explain.counterfactual._proto.prototypecounterfactual method)": [[21, "wildboar.explain.counterfactual._proto.PrototypeCounterfactual.fit_explain"]], "get_metadata_routing() (wildboar.explain.counterfactual._proto.prototypecounterfactual method)": [[21, "wildboar.explain.counterfactual._proto.PrototypeCounterfactual.get_metadata_routing"]], "get_params() (wildboar.explain.counterfactual._proto.prototypecounterfactual method)": [[21, "wildboar.explain.counterfactual._proto.PrototypeCounterfactual.get_params"]], "is_counterfactual() (wildboar.explain.counterfactual._proto.predictevaluator method)": [[21, "wildboar.explain.counterfactual._proto.PredictEvaluator.is_counterfactual"]], "is_counterfactual() (wildboar.explain.counterfactual._proto.probabilityevaluator method)": [[21, "wildboar.explain.counterfactual._proto.ProbabilityEvaluator.is_counterfactual"]], "is_counterfactual() (wildboar.explain.counterfactual._proto.targetevaluator method)": [[21, "wildboar.explain.counterfactual._proto.TargetEvaluator.is_counterfactual"]], "move() (wildboar.explain.counterfactual._proto.dynamictimewarptransform method)": [[21, "wildboar.explain.counterfactual._proto.DynamicTimeWarpTransform.move"]], "move() (wildboar.explain.counterfactual._proto.euclideantransform method)": [[21, "wildboar.explain.counterfactual._proto.EuclideanTransform.move"]], "move() (wildboar.explain.counterfactual._proto.knearestprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.KNearestPrototypeSampler.move"]], "move() (wildboar.explain.counterfactual._proto.knearestshapeletprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.KNearestShapeletPrototypeSampler.move"]], "move() (wildboar.explain.counterfactual._proto.metrictransform method)": [[21, "wildboar.explain.counterfactual._proto.MetricTransform.move"]], "move() (wildboar.explain.counterfactual._proto.prototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.PrototypeSampler.move"]], "move() (wildboar.explain.counterfactual._proto.shapeletprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.ShapeletPrototypeSampler.move"]], "move() (wildboar.explain.counterfactual._proto.uniformprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.UniformPrototypeSampler.move"]], "move() (wildboar.explain.counterfactual._proto.weighteddynamictimewarptransform method)": [[21, "wildboar.explain.counterfactual._proto.WeightedDynamicTimeWarpTransform.move"]], "nearest_index() (wildboar.explain.counterfactual._proto.knearestprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.KNearestPrototypeSampler.nearest_index"]], "plot() (wildboar.explain.counterfactual._proto.prototypecounterfactual method)": [[21, "wildboar.explain.counterfactual._proto.PrototypeCounterfactual.plot"]], "sample() (wildboar.explain.counterfactual._proto.knearestprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.KNearestPrototypeSampler.sample"]], "sample() (wildboar.explain.counterfactual._proto.knearestshapeletprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.KNearestShapeletPrototypeSampler.sample"]], "sample() (wildboar.explain.counterfactual._proto.prototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.PrototypeSampler.sample"]], "sample() (wildboar.explain.counterfactual._proto.shapeletprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.ShapeletPrototypeSampler.sample"]], "sample() (wildboar.explain.counterfactual._proto.uniformprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.UniformPrototypeSampler.sample"]], "sample_move() (wildboar.explain.counterfactual._proto.knearestprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.KNearestPrototypeSampler.sample_move"]], "sample_move() (wildboar.explain.counterfactual._proto.knearestshapeletprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.KNearestShapeletPrototypeSampler.sample_move"]], "sample_move() (wildboar.explain.counterfactual._proto.prototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.PrototypeSampler.sample_move"]], "sample_move() (wildboar.explain.counterfactual._proto.shapeletprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.ShapeletPrototypeSampler.sample_move"]], "sample_move() (wildboar.explain.counterfactual._proto.uniformprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.UniformPrototypeSampler.sample_move"]], "sample_shapelet() (wildboar.explain.counterfactual._proto.shapeletprototypesampler method)": [[21, "wildboar.explain.counterfactual._proto.ShapeletPrototypeSampler.sample_shapelet"]], "score() (wildboar.explain.counterfactual._proto.prototypecounterfactual method)": [[21, "wildboar.explain.counterfactual._proto.PrototypeCounterfactual.score"]], "set_params() (wildboar.explain.counterfactual._proto.prototypecounterfactual method)": [[21, "wildboar.explain.counterfactual._proto.PrototypeCounterfactual.set_params"]], "wildboar.explain.counterfactual._proto": [[21, "module-wildboar.explain.counterfactual._proto"]], "shapeletforestcounterfactual (class in wildboar.explain.counterfactual._sf)": [[22, "wildboar.explain.counterfactual._sf.ShapeletForestCounterfactual"]], "fit_explain() (wildboar.explain.counterfactual._sf.shapeletforestcounterfactual method)": [[22, "wildboar.explain.counterfactual._sf.ShapeletForestCounterfactual.fit_explain"]], "get_metadata_routing() (wildboar.explain.counterfactual._sf.shapeletforestcounterfactual method)": [[22, "wildboar.explain.counterfactual._sf.ShapeletForestCounterfactual.get_metadata_routing"]], "get_params() (wildboar.explain.counterfactual._sf.shapeletforestcounterfactual method)": [[22, "wildboar.explain.counterfactual._sf.ShapeletForestCounterfactual.get_params"]], "plot() (wildboar.explain.counterfactual._sf.shapeletforestcounterfactual method)": [[22, "wildboar.explain.counterfactual._sf.ShapeletForestCounterfactual.plot"]], "score() (wildboar.explain.counterfactual._sf.shapeletforestcounterfactual method)": [[22, "wildboar.explain.counterfactual._sf.ShapeletForestCounterfactual.score"]], "set_params() (wildboar.explain.counterfactual._sf.shapeletforestcounterfactual method)": [[22, "wildboar.explain.counterfactual._sf.ShapeletForestCounterfactual.set_params"]], "wildboar.explain.counterfactual._sf": [[22, "module-wildboar.explain.counterfactual._sf"]], "kneighborscounterfactual (class in wildboar.explain.counterfactual)": [[23, "wildboar.explain.counterfactual.KNeighborsCounterfactual"]], "prototypecounterfactual (class in wildboar.explain.counterfactual)": [[23, "wildboar.explain.counterfactual.PrototypeCounterfactual"]], "shapeletforestcounterfactual (class in wildboar.explain.counterfactual)": [[23, "wildboar.explain.counterfactual.ShapeletForestCounterfactual"]], "counterfactuals() (in module wildboar.explain.counterfactual)": [[23, "wildboar.explain.counterfactual.counterfactuals"]], "fit_explain() (wildboar.explain.counterfactual.kneighborscounterfactual method)": [[23, "wildboar.explain.counterfactual.KNeighborsCounterfactual.fit_explain"]], "fit_explain() (wildboar.explain.counterfactual.prototypecounterfactual method)": [[23, "wildboar.explain.counterfactual.PrototypeCounterfactual.fit_explain"]], "fit_explain() (wildboar.explain.counterfactual.shapeletforestcounterfactual method)": [[23, "wildboar.explain.counterfactual.ShapeletForestCounterfactual.fit_explain"]], "get_metadata_routing() (wildboar.explain.counterfactual.kneighborscounterfactual method)": [[23, "wildboar.explain.counterfactual.KNeighborsCounterfactual.get_metadata_routing"]], "get_metadata_routing() (wildboar.explain.counterfactual.prototypecounterfactual method)": [[23, "wildboar.explain.counterfactual.PrototypeCounterfactual.get_metadata_routing"]], "get_metadata_routing() (wildboar.explain.counterfactual.shapeletforestcounterfactual method)": [[23, "wildboar.explain.counterfactual.ShapeletForestCounterfactual.get_metadata_routing"]], "get_params() (wildboar.explain.counterfactual.kneighborscounterfactual method)": [[23, "wildboar.explain.counterfactual.KNeighborsCounterfactual.get_params"]], "get_params() (wildboar.explain.counterfactual.prototypecounterfactual method)": [[23, "wildboar.explain.counterfactual.PrototypeCounterfactual.get_params"]], "get_params() (wildboar.explain.counterfactual.shapeletforestcounterfactual method)": [[23, "wildboar.explain.counterfactual.ShapeletForestCounterfactual.get_params"]], "plot() (wildboar.explain.counterfactual.kneighborscounterfactual method)": [[23, "wildboar.explain.counterfactual.KNeighborsCounterfactual.plot"]], "plot() (wildboar.explain.counterfactual.prototypecounterfactual method)": [[23, "wildboar.explain.counterfactual.PrototypeCounterfactual.plot"]], "plot() (wildboar.explain.counterfactual.shapeletforestcounterfactual method)": [[23, "wildboar.explain.counterfactual.ShapeletForestCounterfactual.plot"]], "proximity() (in module wildboar.explain.counterfactual)": [[23, "wildboar.explain.counterfactual.proximity"]], "score() (wildboar.explain.counterfactual.kneighborscounterfactual method)": [[23, "wildboar.explain.counterfactual.KNeighborsCounterfactual.score"]], "score() (wildboar.explain.counterfactual.prototypecounterfactual method)": [[23, "wildboar.explain.counterfactual.PrototypeCounterfactual.score"]], "score() (wildboar.explain.counterfactual.shapeletforestcounterfactual method)": [[23, "wildboar.explain.counterfactual.ShapeletForestCounterfactual.score"]], "set_params() (wildboar.explain.counterfactual.kneighborscounterfactual method)": [[23, "wildboar.explain.counterfactual.KNeighborsCounterfactual.set_params"]], "set_params() (wildboar.explain.counterfactual.prototypecounterfactual method)": [[23, "wildboar.explain.counterfactual.PrototypeCounterfactual.set_params"]], "set_params() (wildboar.explain.counterfactual.shapeletforestcounterfactual method)": [[23, "wildboar.explain.counterfactual.ShapeletForestCounterfactual.set_params"]], "wildboar.explain.counterfactual": [[23, "module-wildboar.explain.counterfactual"]], "amplitudeimportance (class in wildboar.explain)": [[24, "wildboar.explain.AmplitudeImportance"]], "intervalimportance (class in wildboar.explain)": [[24, "wildboar.explain.IntervalImportance"]], "shapeletimportance (class in wildboar.explain)": [[24, "wildboar.explain.ShapeletImportance"]], "fit_explain() (wildboar.explain.amplitudeimportance method)": [[24, "wildboar.explain.AmplitudeImportance.fit_explain"]], "fit_explain() (wildboar.explain.intervalimportance method)": [[24, "wildboar.explain.IntervalImportance.fit_explain"]], "fit_explain() (wildboar.explain.shapeletimportance method)": [[24, "wildboar.explain.ShapeletImportance.fit_explain"]], "get_metadata_routing() (wildboar.explain.amplitudeimportance method)": [[24, "wildboar.explain.AmplitudeImportance.get_metadata_routing"]], "get_metadata_routing() (wildboar.explain.intervalimportance method)": [[24, "wildboar.explain.IntervalImportance.get_metadata_routing"]], "get_metadata_routing() (wildboar.explain.shapeletimportance method)": [[24, "wildboar.explain.ShapeletImportance.get_metadata_routing"]], "get_params() (wildboar.explain.amplitudeimportance method)": [[24, "wildboar.explain.AmplitudeImportance.get_params"]], "get_params() (wildboar.explain.intervalimportance method)": [[24, "wildboar.explain.IntervalImportance.get_params"]], "get_params() (wildboar.explain.shapeletimportance method)": [[24, "wildboar.explain.ShapeletImportance.get_params"]], "plot() (wildboar.explain.amplitudeimportance method)": [[24, "wildboar.explain.AmplitudeImportance.plot"]], "plot() (wildboar.explain.intervalimportance method)": [[24, "wildboar.explain.IntervalImportance.plot"]], "plot() (wildboar.explain.shapeletimportance method)": [[24, "wildboar.explain.ShapeletImportance.plot"]], "plot_importances() (in module wildboar.explain)": [[24, "wildboar.explain.plot_importances"]], "set_params() (wildboar.explain.amplitudeimportance method)": [[24, "wildboar.explain.AmplitudeImportance.set_params"]], "set_params() (wildboar.explain.intervalimportance method)": [[24, "wildboar.explain.IntervalImportance.set_params"]], "set_params() (wildboar.explain.shapeletimportance method)": [[24, "wildboar.explain.ShapeletImportance.set_params"]], "wildboar.explain": [[24, "module-wildboar.explain"]], "iseos() (in module wildboar)": [[25, "wildboar.iseos"]], "wildboar": [[25, "module-wildboar"]], "hydraclassifier (class in wildboar.linear_model._hydra)": [[26, "wildboar.linear_model._hydra.HydraClassifier"]], "get_metadata_routing() (wildboar.linear_model._hydra.hydraclassifier method)": [[26, "wildboar.linear_model._hydra.HydraClassifier.get_metadata_routing"]], "get_params() (wildboar.linear_model._hydra.hydraclassifier method)": [[26, "wildboar.linear_model._hydra.HydraClassifier.get_params"]], "score() (wildboar.linear_model._hydra.hydraclassifier method)": [[26, "wildboar.linear_model._hydra.HydraClassifier.score"]], "set_params() (wildboar.linear_model._hydra.hydraclassifier method)": [[26, "wildboar.linear_model._hydra.HydraClassifier.set_params"]], "wildboar.linear_model._hydra": [[26, "module-wildboar.linear_model._hydra"]], "rocketclassifier (class in wildboar.linear_model._rocket)": [[27, "wildboar.linear_model._rocket.RocketClassifier"]], "rocketregressor (class in wildboar.linear_model._rocket)": [[27, "wildboar.linear_model._rocket.RocketRegressor"]], "get_metadata_routing() (wildboar.linear_model._rocket.rocketclassifier method)": [[27, "wildboar.linear_model._rocket.RocketClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.linear_model._rocket.rocketregressor method)": [[27, "wildboar.linear_model._rocket.RocketRegressor.get_metadata_routing"]], "get_params() (wildboar.linear_model._rocket.rocketclassifier method)": [[27, "wildboar.linear_model._rocket.RocketClassifier.get_params"]], "get_params() (wildboar.linear_model._rocket.rocketregressor method)": [[27, "wildboar.linear_model._rocket.RocketRegressor.get_params"]], "score() (wildboar.linear_model._rocket.rocketclassifier method)": [[27, "wildboar.linear_model._rocket.RocketClassifier.score"]], "score() (wildboar.linear_model._rocket.rocketregressor method)": [[27, "wildboar.linear_model._rocket.RocketRegressor.score"]], "set_params() (wildboar.linear_model._rocket.rocketclassifier method)": [[27, "wildboar.linear_model._rocket.RocketClassifier.set_params"]], "set_params() (wildboar.linear_model._rocket.rocketregressor method)": [[27, "wildboar.linear_model._rocket.RocketRegressor.set_params"]], "wildboar.linear_model._rocket": [[27, "module-wildboar.linear_model._rocket"]], "randomshapeletclassifier (class in wildboar.linear_model._shapelet)": [[28, "wildboar.linear_model._shapelet.RandomShapeletClassifier"]], "randomshapeletregressor (class in wildboar.linear_model._shapelet)": [[28, "wildboar.linear_model._shapelet.RandomShapeletRegressor"]], "get_metadata_routing() (wildboar.linear_model._shapelet.randomshapeletclassifier method)": [[28, "wildboar.linear_model._shapelet.RandomShapeletClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.linear_model._shapelet.randomshapeletregressor method)": [[28, "wildboar.linear_model._shapelet.RandomShapeletRegressor.get_metadata_routing"]], "get_params() (wildboar.linear_model._shapelet.randomshapeletclassifier method)": [[28, "wildboar.linear_model._shapelet.RandomShapeletClassifier.get_params"]], "get_params() (wildboar.linear_model._shapelet.randomshapeletregressor method)": [[28, "wildboar.linear_model._shapelet.RandomShapeletRegressor.get_params"]], "score() (wildboar.linear_model._shapelet.randomshapeletclassifier method)": [[28, "wildboar.linear_model._shapelet.RandomShapeletClassifier.score"]], "score() (wildboar.linear_model._shapelet.randomshapeletregressor method)": [[28, "wildboar.linear_model._shapelet.RandomShapeletRegressor.score"]], "set_params() (wildboar.linear_model._shapelet.randomshapeletclassifier method)": [[28, "wildboar.linear_model._shapelet.RandomShapeletClassifier.set_params"]], "set_params() (wildboar.linear_model._shapelet.randomshapeletregressor method)": [[28, "wildboar.linear_model._shapelet.RandomShapeletRegressor.set_params"]], "wildboar.linear_model._shapelet": [[28, "module-wildboar.linear_model._shapelet"]], "basetransformclassifier (class in wildboar.linear_model._transform)": [[29, "wildboar.linear_model._transform.BaseTransformClassifier"]], "basetransformestimator (class in wildboar.linear_model._transform)": [[29, "wildboar.linear_model._transform.BaseTransformEstimator"]], "basetransformregressor (class in wildboar.linear_model._transform)": [[29, "wildboar.linear_model._transform.BaseTransformRegressor"]], "transformridgecv (class in wildboar.linear_model._transform)": [[29, "wildboar.linear_model._transform.TransformRidgeCV"]], "transformridgeclassifiercv (class in wildboar.linear_model._transform)": [[29, "wildboar.linear_model._transform.TransformRidgeClassifierCV"]], "get_metadata_routing() (wildboar.linear_model._transform.basetransformclassifier method)": [[29, "wildboar.linear_model._transform.BaseTransformClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.linear_model._transform.basetransformestimator method)": [[29, "wildboar.linear_model._transform.BaseTransformEstimator.get_metadata_routing"]], "get_metadata_routing() (wildboar.linear_model._transform.basetransformregressor method)": [[29, "wildboar.linear_model._transform.BaseTransformRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.linear_model._transform.transformridgecv method)": [[29, "wildboar.linear_model._transform.TransformRidgeCV.get_metadata_routing"]], "get_metadata_routing() (wildboar.linear_model._transform.transformridgeclassifiercv method)": [[29, "wildboar.linear_model._transform.TransformRidgeClassifierCV.get_metadata_routing"]], "get_params() (wildboar.linear_model._transform.basetransformclassifier method)": [[29, "wildboar.linear_model._transform.BaseTransformClassifier.get_params"]], "get_params() (wildboar.linear_model._transform.basetransformestimator method)": [[29, "wildboar.linear_model._transform.BaseTransformEstimator.get_params"]], "get_params() (wildboar.linear_model._transform.basetransformregressor method)": [[29, "wildboar.linear_model._transform.BaseTransformRegressor.get_params"]], "get_params() (wildboar.linear_model._transform.transformridgecv method)": [[29, "wildboar.linear_model._transform.TransformRidgeCV.get_params"]], "get_params() (wildboar.linear_model._transform.transformridgeclassifiercv method)": [[29, "wildboar.linear_model._transform.TransformRidgeClassifierCV.get_params"]], "score() (wildboar.linear_model._transform.basetransformclassifier method)": [[29, "wildboar.linear_model._transform.BaseTransformClassifier.score"]], "score() (wildboar.linear_model._transform.basetransformregressor method)": [[29, "wildboar.linear_model._transform.BaseTransformRegressor.score"]], "score() (wildboar.linear_model._transform.transformridgecv method)": [[29, "wildboar.linear_model._transform.TransformRidgeCV.score"]], "score() (wildboar.linear_model._transform.transformridgeclassifiercv method)": [[29, "wildboar.linear_model._transform.TransformRidgeClassifierCV.score"]], "set_params() (wildboar.linear_model._transform.basetransformclassifier method)": [[29, "wildboar.linear_model._transform.BaseTransformClassifier.set_params"]], "set_params() (wildboar.linear_model._transform.basetransformestimator method)": [[29, "wildboar.linear_model._transform.BaseTransformEstimator.set_params"]], "set_params() (wildboar.linear_model._transform.basetransformregressor method)": [[29, "wildboar.linear_model._transform.BaseTransformRegressor.set_params"]], "set_params() (wildboar.linear_model._transform.transformridgecv method)": [[29, "wildboar.linear_model._transform.TransformRidgeCV.set_params"]], "set_params() (wildboar.linear_model._transform.transformridgeclassifiercv method)": [[29, "wildboar.linear_model._transform.TransformRidgeClassifierCV.set_params"]], "wildboar.linear_model._transform": [[29, "module-wildboar.linear_model._transform"]], "hydraclassifier (class in wildboar.linear_model)": [[30, "wildboar.linear_model.HydraClassifier"]], "randomshapeletclassifier (class in wildboar.linear_model)": [[30, "wildboar.linear_model.RandomShapeletClassifier"]], "randomshapeletregressor (class in wildboar.linear_model)": [[30, "wildboar.linear_model.RandomShapeletRegressor"]], "rocketclassifier (class in wildboar.linear_model)": [[30, "wildboar.linear_model.RocketClassifier"]], "rocketregressor (class in wildboar.linear_model)": [[30, "wildboar.linear_model.RocketRegressor"]], "get_metadata_routing() (wildboar.linear_model.hydraclassifier method)": [[30, "wildboar.linear_model.HydraClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.linear_model.randomshapeletclassifier method)": [[30, "wildboar.linear_model.RandomShapeletClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.linear_model.randomshapeletregressor method)": [[30, "wildboar.linear_model.RandomShapeletRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.linear_model.rocketclassifier method)": [[30, "wildboar.linear_model.RocketClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.linear_model.rocketregressor method)": [[30, "wildboar.linear_model.RocketRegressor.get_metadata_routing"]], "get_params() (wildboar.linear_model.hydraclassifier method)": [[30, "wildboar.linear_model.HydraClassifier.get_params"]], "get_params() (wildboar.linear_model.randomshapeletclassifier method)": [[30, "wildboar.linear_model.RandomShapeletClassifier.get_params"]], "get_params() (wildboar.linear_model.randomshapeletregressor method)": [[30, "wildboar.linear_model.RandomShapeletRegressor.get_params"]], "get_params() (wildboar.linear_model.rocketclassifier method)": [[30, "wildboar.linear_model.RocketClassifier.get_params"]], "get_params() (wildboar.linear_model.rocketregressor method)": [[30, "wildboar.linear_model.RocketRegressor.get_params"]], "score() (wildboar.linear_model.hydraclassifier method)": [[30, "wildboar.linear_model.HydraClassifier.score"]], "score() (wildboar.linear_model.randomshapeletclassifier method)": [[30, "wildboar.linear_model.RandomShapeletClassifier.score"]], "score() (wildboar.linear_model.randomshapeletregressor method)": [[30, "wildboar.linear_model.RandomShapeletRegressor.score"]], "score() (wildboar.linear_model.rocketclassifier method)": [[30, "wildboar.linear_model.RocketClassifier.score"]], "score() (wildboar.linear_model.rocketregressor method)": [[30, "wildboar.linear_model.RocketRegressor.score"]], "set_params() (wildboar.linear_model.hydraclassifier method)": [[30, "wildboar.linear_model.HydraClassifier.set_params"]], "set_params() (wildboar.linear_model.randomshapeletclassifier method)": [[30, "wildboar.linear_model.RandomShapeletClassifier.set_params"]], "set_params() (wildboar.linear_model.randomshapeletregressor method)": [[30, "wildboar.linear_model.RandomShapeletRegressor.set_params"]], "set_params() (wildboar.linear_model.rocketclassifier method)": [[30, "wildboar.linear_model.RocketClassifier.set_params"]], "set_params() (wildboar.linear_model.rocketregressor method)": [[30, "wildboar.linear_model.RocketRegressor.set_params"]], "wildboar.linear_model": [[30, "module-wildboar.linear_model"]], "silhouette_samples() (in module wildboar.metrics._cluster)": [[31, "wildboar.metrics._cluster.silhouette_samples"]], "silhouette_score() (in module wildboar.metrics._cluster)": [[31, "wildboar.metrics._cluster.silhouette_score"]], "wildboar.metrics._cluster": [[31, "module-wildboar.metrics._cluster"]], "compactness_score() (in module wildboar.metrics._counterfactual)": [[32, "wildboar.metrics._counterfactual.compactness_score"]], "plausability_score() (in module wildboar.metrics._counterfactual)": [[32, "wildboar.metrics._counterfactual.plausability_score"]], "proximity_score() (in module wildboar.metrics._counterfactual)": [[32, "wildboar.metrics._counterfactual.proximity_score"]], "redudancy_score() (in module wildboar.metrics._counterfactual)": [[32, "wildboar.metrics._counterfactual.redudancy_score"]], "relative_proximity_score() (in module wildboar.metrics._counterfactual)": [[32, "wildboar.metrics._counterfactual.relative_proximity_score"]], "validity_score() (in module wildboar.metrics._counterfactual)": [[32, "wildboar.metrics._counterfactual.validity_score"]], "wildboar.metrics._counterfactual": [[32, "module-wildboar.metrics._counterfactual"]], "compactness_score() (in module wildboar.metrics)": [[33, "wildboar.metrics.compactness_score"]], "plausability_score() (in module wildboar.metrics)": [[33, "wildboar.metrics.plausability_score"]], "proximity_score() (in module wildboar.metrics)": [[33, "wildboar.metrics.proximity_score"]], "redudancy_score() (in module wildboar.metrics)": [[33, "wildboar.metrics.redudancy_score"]], "relative_proximity_score() (in module wildboar.metrics)": [[33, "wildboar.metrics.relative_proximity_score"]], "silhouette_samples() (in module wildboar.metrics)": [[33, "wildboar.metrics.silhouette_samples"]], "silhouette_score() (in module wildboar.metrics)": [[33, "wildboar.metrics.silhouette_score"]], "validity_score() (in module wildboar.metrics)": [[33, "wildboar.metrics.validity_score"]], "wildboar.metrics": [[33, "module-wildboar.metrics"]], "repeatedoutliersplit (class in wildboar.model_selection._cv)": [[34, "wildboar.model_selection._cv.RepeatedOutlierSplit"]], "get_n_splits() (wildboar.model_selection._cv.repeatedoutliersplit method)": [[34, "wildboar.model_selection._cv.RepeatedOutlierSplit.get_n_splits"]], "split() (wildboar.model_selection._cv.repeatedoutliersplit method)": [[34, "wildboar.model_selection._cv.RepeatedOutlierSplit.split"]], "wildboar.model_selection._cv": [[34, "module-wildboar.model_selection._cv"]], "outlier_train_test_split() (in module wildboar.model_selection._outlier)": [[35, "wildboar.model_selection._outlier.outlier_train_test_split"]], "wildboar.model_selection._outlier": [[35, "module-wildboar.model_selection._outlier"]], "repeatedoutliersplit (class in wildboar.model_selection)": [[36, "wildboar.model_selection.RepeatedOutlierSplit"]], "get_n_splits() (wildboar.model_selection.repeatedoutliersplit method)": [[36, "wildboar.model_selection.RepeatedOutlierSplit.get_n_splits"]], "outlier_train_test_split() (in module wildboar.model_selection)": [[36, "wildboar.model_selection.outlier_train_test_split"]], "split() (wildboar.model_selection.repeatedoutliersplit method)": [[36, "wildboar.model_selection.RepeatedOutlierSplit.split"]], "wildboar.model_selection": [[36, "module-wildboar.model_selection"]], "baseattributetransform (class in wildboar.transform._base)": [[37, "wildboar.transform._base.BaseAttributeTransform"]], "fit() (wildboar.transform._base.baseattributetransform method)": [[37, "wildboar.transform._base.BaseAttributeTransform.fit"]], "fit_transform() (wildboar.transform._base.baseattributetransform method)": [[37, "wildboar.transform._base.BaseAttributeTransform.fit_transform"]], "get_metadata_routing() (wildboar.transform._base.baseattributetransform method)": [[37, "wildboar.transform._base.BaseAttributeTransform.get_metadata_routing"]], "get_params() (wildboar.transform._base.baseattributetransform method)": [[37, "wildboar.transform._base.BaseAttributeTransform.get_params"]], "set_output() (wildboar.transform._base.baseattributetransform method)": [[37, "wildboar.transform._base.BaseAttributeTransform.set_output"]], "set_params() (wildboar.transform._base.baseattributetransform method)": [[37, "wildboar.transform._base.BaseAttributeTransform.set_params"]], "transform() (wildboar.transform._base.baseattributetransform method)": [[37, "wildboar.transform._base.BaseAttributeTransform.transform"]], "wildboar.transform._base": [[37, "module-wildboar.transform._base"]], "convolve() (in module wildboar.transform._conv)": [[38, "wildboar.transform._conv.convolve"]], "wildboar.transform._conv": [[38, "module-wildboar.transform._conv"]], "difftransform (class in wildboar.transform._diff)": [[39, "wildboar.transform._diff.DiffTransform"]], "fit_transform() (wildboar.transform._diff.difftransform method)": [[39, "wildboar.transform._diff.DiffTransform.fit_transform"]], "get_metadata_routing() (wildboar.transform._diff.difftransform method)": [[39, "wildboar.transform._diff.DiffTransform.get_metadata_routing"]], "get_params() (wildboar.transform._diff.difftransform method)": [[39, "wildboar.transform._diff.DiffTransform.get_params"]], "set_output() (wildboar.transform._diff.difftransform method)": [[39, "wildboar.transform._diff.DiffTransform.set_output"]], "set_params() (wildboar.transform._diff.difftransform method)": [[39, "wildboar.transform._diff.DiffTransform.set_params"]], "wildboar.transform._diff": [[39, "module-wildboar.transform._diff"]], "hydratransform (class in wildboar.transform._hydra)": [[40, "wildboar.transform._hydra.HydraTransform"]], "fit() (wildboar.transform._hydra.hydratransform method)": [[40, "wildboar.transform._hydra.HydraTransform.fit"]], "fit_transform() (wildboar.transform._hydra.hydratransform method)": [[40, "wildboar.transform._hydra.HydraTransform.fit_transform"]], "get_metadata_routing() (wildboar.transform._hydra.hydratransform method)": [[40, "wildboar.transform._hydra.HydraTransform.get_metadata_routing"]], "get_params() (wildboar.transform._hydra.hydratransform method)": [[40, "wildboar.transform._hydra.HydraTransform.get_params"]], "set_output() (wildboar.transform._hydra.hydratransform method)": [[40, "wildboar.transform._hydra.HydraTransform.set_output"]], "set_params() (wildboar.transform._hydra.hydratransform method)": [[40, "wildboar.transform._hydra.HydraTransform.set_params"]], "transform() (wildboar.transform._hydra.hydratransform method)": [[40, "wildboar.transform._hydra.HydraTransform.transform"]], "wildboar.transform._hydra": [[40, "module-wildboar.transform._hydra"]], "featuretransform (class in wildboar.transform._interval)": [[41, "wildboar.transform._interval.FeatureTransform"]], "intervalmixin (class in wildboar.transform._interval)": [[41, "wildboar.transform._interval.IntervalMixin"]], "intervaltransform (class in wildboar.transform._interval)": [[41, "wildboar.transform._interval.IntervalTransform"]], "fit() (wildboar.transform._interval.featuretransform method)": [[41, "wildboar.transform._interval.FeatureTransform.fit"]], "fit() (wildboar.transform._interval.intervaltransform method)": [[41, "wildboar.transform._interval.IntervalTransform.fit"]], "fit_transform() (wildboar.transform._interval.featuretransform method)": [[41, "wildboar.transform._interval.FeatureTransform.fit_transform"]], "fit_transform() (wildboar.transform._interval.intervaltransform method)": [[41, "wildboar.transform._interval.IntervalTransform.fit_transform"]], "get_metadata_routing() (wildboar.transform._interval.featuretransform method)": [[41, "wildboar.transform._interval.FeatureTransform.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform._interval.intervaltransform method)": [[41, "wildboar.transform._interval.IntervalTransform.get_metadata_routing"]], "get_params() (wildboar.transform._interval.featuretransform method)": [[41, "wildboar.transform._interval.FeatureTransform.get_params"]], "get_params() (wildboar.transform._interval.intervaltransform method)": [[41, "wildboar.transform._interval.IntervalTransform.get_params"]], "set_output() (wildboar.transform._interval.featuretransform method)": [[41, "wildboar.transform._interval.FeatureTransform.set_output"]], "set_output() (wildboar.transform._interval.intervaltransform method)": [[41, "wildboar.transform._interval.IntervalTransform.set_output"]], "set_params() (wildboar.transform._interval.featuretransform method)": [[41, "wildboar.transform._interval.FeatureTransform.set_params"]], "set_params() (wildboar.transform._interval.intervaltransform method)": [[41, "wildboar.transform._interval.IntervalTransform.set_params"]], "transform() (wildboar.transform._interval.featuretransform method)": [[41, "wildboar.transform._interval.FeatureTransform.transform"]], "transform() (wildboar.transform._interval.intervaltransform method)": [[41, "wildboar.transform._interval.IntervalTransform.transform"]], "wildboar.transform._interval": [[41, "module-wildboar.transform._interval"]], "matrixprofiletransform (class in wildboar.transform._matrix_profile)": [[42, "wildboar.transform._matrix_profile.MatrixProfileTransform"]], "fit() (wildboar.transform._matrix_profile.matrixprofiletransform method)": [[42, "wildboar.transform._matrix_profile.MatrixProfileTransform.fit"]], "fit_transform() (wildboar.transform._matrix_profile.matrixprofiletransform method)": [[42, "wildboar.transform._matrix_profile.MatrixProfileTransform.fit_transform"]], "get_metadata_routing() (wildboar.transform._matrix_profile.matrixprofiletransform method)": [[42, "wildboar.transform._matrix_profile.MatrixProfileTransform.get_metadata_routing"]], "get_params() (wildboar.transform._matrix_profile.matrixprofiletransform method)": [[42, "wildboar.transform._matrix_profile.MatrixProfileTransform.get_params"]], "set_output() (wildboar.transform._matrix_profile.matrixprofiletransform method)": [[42, "wildboar.transform._matrix_profile.MatrixProfileTransform.set_output"]], "set_params() (wildboar.transform._matrix_profile.matrixprofiletransform method)": [[42, "wildboar.transform._matrix_profile.MatrixProfileTransform.set_params"]], "transform() (wildboar.transform._matrix_profile.matrixprofiletransform method)": [[42, "wildboar.transform._matrix_profile.MatrixProfileTransform.transform"]], "wildboar.transform._matrix_profile": [[42, "module-wildboar.transform._matrix_profile"]], "pivotmixin (class in wildboar.transform._pivot)": [[43, "wildboar.transform._pivot.PivotMixin"]], "pivottransform (class in wildboar.transform._pivot)": [[43, "wildboar.transform._pivot.PivotTransform"]], "proximitytransform (class in wildboar.transform._pivot)": [[43, "wildboar.transform._pivot.ProximityTransform"]], "fit() (wildboar.transform._pivot.pivottransform method)": [[43, "wildboar.transform._pivot.PivotTransform.fit"]], "fit_transform() (wildboar.transform._pivot.pivottransform method)": [[43, "wildboar.transform._pivot.PivotTransform.fit_transform"]], "fit_transform() (wildboar.transform._pivot.proximitytransform method)": [[43, "wildboar.transform._pivot.ProximityTransform.fit_transform"]], "get_metadata_routing() (wildboar.transform._pivot.pivottransform method)": [[43, "wildboar.transform._pivot.PivotTransform.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform._pivot.proximitytransform method)": [[43, "wildboar.transform._pivot.ProximityTransform.get_metadata_routing"]], "get_params() (wildboar.transform._pivot.pivottransform method)": [[43, "wildboar.transform._pivot.PivotTransform.get_params"]], "get_params() (wildboar.transform._pivot.proximitytransform method)": [[43, "wildboar.transform._pivot.ProximityTransform.get_params"]], "set_output() (wildboar.transform._pivot.pivottransform method)": [[43, "wildboar.transform._pivot.PivotTransform.set_output"]], "set_output() (wildboar.transform._pivot.proximitytransform method)": [[43, "wildboar.transform._pivot.ProximityTransform.set_output"]], "set_params() (wildboar.transform._pivot.pivottransform method)": [[43, "wildboar.transform._pivot.PivotTransform.set_params"]], "set_params() (wildboar.transform._pivot.proximitytransform method)": [[43, "wildboar.transform._pivot.ProximityTransform.set_params"]], "transform() (wildboar.transform._pivot.pivottransform method)": [[43, "wildboar.transform._pivot.PivotTransform.transform"]], "wildboar.transform._pivot": [[43, "module-wildboar.transform._pivot"]], "rocketmixin (class in wildboar.transform._rocket)": [[44, "wildboar.transform._rocket.RocketMixin"]], "rockettransform (class in wildboar.transform._rocket)": [[44, "wildboar.transform._rocket.RocketTransform"]], "fit() (wildboar.transform._rocket.rockettransform method)": [[44, "wildboar.transform._rocket.RocketTransform.fit"]], "fit_transform() (wildboar.transform._rocket.rockettransform method)": [[44, "wildboar.transform._rocket.RocketTransform.fit_transform"]], "get_metadata_routing() (wildboar.transform._rocket.rockettransform method)": [[44, "wildboar.transform._rocket.RocketTransform.get_metadata_routing"]], "get_params() (wildboar.transform._rocket.rockettransform method)": [[44, "wildboar.transform._rocket.RocketTransform.get_params"]], "set_output() (wildboar.transform._rocket.rockettransform method)": [[44, "wildboar.transform._rocket.RocketTransform.set_output"]], "set_params() (wildboar.transform._rocket.rockettransform method)": [[44, "wildboar.transform._rocket.RocketTransform.set_params"]], "transform() (wildboar.transform._rocket.rockettransform method)": [[44, "wildboar.transform._rocket.RocketTransform.transform"]], "wildboar.transform._rocket": [[44, "module-wildboar.transform._rocket"]], "binning (class in wildboar.transform._sax)": [[45, "wildboar.transform._sax.Binning"]], "normalbinning (class in wildboar.transform._sax)": [[45, "wildboar.transform._sax.NormalBinning"]], "paa (class in wildboar.transform._sax)": [[45, "wildboar.transform._sax.PAA"]], "sax (class in wildboar.transform._sax)": [[45, "wildboar.transform._sax.SAX"]], "uniformbinning (class in wildboar.transform._sax)": [[45, "wildboar.transform._sax.UniformBinning"]], "fit_transform() (wildboar.transform._sax.paa method)": [[45, "wildboar.transform._sax.PAA.fit_transform"]], "fit_transform() (wildboar.transform._sax.sax method)": [[45, "wildboar.transform._sax.SAX.fit_transform"]], "get_metadata_routing() (wildboar.transform._sax.paa method)": [[45, "wildboar.transform._sax.PAA.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform._sax.sax method)": [[45, "wildboar.transform._sax.SAX.get_metadata_routing"]], "get_params() (wildboar.transform._sax.paa method)": [[45, "wildboar.transform._sax.PAA.get_params"]], "get_params() (wildboar.transform._sax.sax method)": [[45, "wildboar.transform._sax.SAX.get_params"]], "get_thresholds() (wildboar.transform._sax.binning method)": [[45, "wildboar.transform._sax.Binning.get_thresholds"]], "get_thresholds() (wildboar.transform._sax.normalbinning method)": [[45, "wildboar.transform._sax.NormalBinning.get_thresholds"]], "get_thresholds() (wildboar.transform._sax.uniformbinning method)": [[45, "wildboar.transform._sax.UniformBinning.get_thresholds"]], "piecewice_aggregate_approximation() (in module wildboar.transform._sax)": [[45, "wildboar.transform._sax.piecewice_aggregate_approximation"]], "scale() (wildboar.transform._sax.binning method)": [[45, "wildboar.transform._sax.Binning.scale"]], "scale() (wildboar.transform._sax.normalbinning method)": [[45, "wildboar.transform._sax.NormalBinning.scale"]], "scale() (wildboar.transform._sax.uniformbinning method)": [[45, "wildboar.transform._sax.UniformBinning.scale"]], "set_output() (wildboar.transform._sax.paa method)": [[45, "wildboar.transform._sax.PAA.set_output"]], "set_output() (wildboar.transform._sax.sax method)": [[45, "wildboar.transform._sax.SAX.set_output"]], "set_params() (wildboar.transform._sax.paa method)": [[45, "wildboar.transform._sax.PAA.set_params"]], "set_params() (wildboar.transform._sax.sax method)": [[45, "wildboar.transform._sax.SAX.set_params"]], "symbolic_aggregate_approximation() (in module wildboar.transform._sax)": [[45, "wildboar.transform._sax.symbolic_aggregate_approximation"]], "wildboar.transform._sax": [[45, "module-wildboar.transform._sax"]], "randomshapelettransform (class in wildboar.transform._shapelet)": [[46, "wildboar.transform._shapelet.RandomShapeletTransform"]], "shapeletmixin (class in wildboar.transform._shapelet)": [[46, "wildboar.transform._shapelet.ShapeletMixin"]], "fit() (wildboar.transform._shapelet.randomshapelettransform method)": [[46, "wildboar.transform._shapelet.RandomShapeletTransform.fit"]], "fit_transform() (wildboar.transform._shapelet.randomshapelettransform method)": [[46, "wildboar.transform._shapelet.RandomShapeletTransform.fit_transform"]], "get_metadata_routing() (wildboar.transform._shapelet.randomshapelettransform method)": [[46, "wildboar.transform._shapelet.RandomShapeletTransform.get_metadata_routing"]], "get_params() (wildboar.transform._shapelet.randomshapelettransform method)": [[46, "wildboar.transform._shapelet.RandomShapeletTransform.get_params"]], "set_output() (wildboar.transform._shapelet.randomshapelettransform method)": [[46, "wildboar.transform._shapelet.RandomShapeletTransform.set_output"]], "set_params() (wildboar.transform._shapelet.randomshapelettransform method)": [[46, "wildboar.transform._shapelet.RandomShapeletTransform.set_params"]], "transform() (wildboar.transform._shapelet.randomshapelettransform method)": [[46, "wildboar.transform._shapelet.RandomShapeletTransform.transform"]], "wildboar.transform._shapelet": [[46, "module-wildboar.transform._shapelet"]], "difftransform (class in wildboar.transform)": [[47, "wildboar.transform.DiffTransform"]], "featuretransform (class in wildboar.transform)": [[47, "wildboar.transform.FeatureTransform"]], "hydratransform (class in wildboar.transform)": [[47, "wildboar.transform.HydraTransform"]], "intervaltransform (class in wildboar.transform)": [[47, "wildboar.transform.IntervalTransform"]], "matrixprofiletransform (class in wildboar.transform)": [[47, "wildboar.transform.MatrixProfileTransform"]], "paa (class in wildboar.transform)": [[47, "wildboar.transform.PAA"]], "pivottransform (class in wildboar.transform)": [[47, "wildboar.transform.PivotTransform"]], "proximitytransform (class in wildboar.transform)": [[47, "wildboar.transform.ProximityTransform"]], "randomshapelettransform (class in wildboar.transform)": [[47, "wildboar.transform.RandomShapeletTransform"]], "rockettransform (class in wildboar.transform)": [[47, "wildboar.transform.RocketTransform"]], "sax (class in wildboar.transform)": [[47, "wildboar.transform.SAX"]], "convolve() (in module wildboar.transform)": [[47, "wildboar.transform.convolve"]], "fit() (wildboar.transform.featuretransform method)": [[47, "wildboar.transform.FeatureTransform.fit"]], "fit() (wildboar.transform.hydratransform method)": [[47, "wildboar.transform.HydraTransform.fit"]], "fit() (wildboar.transform.intervaltransform method)": [[47, "wildboar.transform.IntervalTransform.fit"]], "fit() (wildboar.transform.matrixprofiletransform method)": [[47, "wildboar.transform.MatrixProfileTransform.fit"]], "fit() (wildboar.transform.pivottransform method)": [[47, "wildboar.transform.PivotTransform.fit"]], "fit() (wildboar.transform.randomshapelettransform method)": [[47, "wildboar.transform.RandomShapeletTransform.fit"]], "fit() (wildboar.transform.rockettransform method)": [[47, "wildboar.transform.RocketTransform.fit"]], "fit_transform() (wildboar.transform.difftransform method)": [[47, "wildboar.transform.DiffTransform.fit_transform"]], "fit_transform() (wildboar.transform.featuretransform method)": [[47, "wildboar.transform.FeatureTransform.fit_transform"]], "fit_transform() (wildboar.transform.hydratransform method)": [[47, "wildboar.transform.HydraTransform.fit_transform"]], "fit_transform() (wildboar.transform.intervaltransform method)": [[47, "wildboar.transform.IntervalTransform.fit_transform"]], "fit_transform() (wildboar.transform.matrixprofiletransform method)": [[47, "wildboar.transform.MatrixProfileTransform.fit_transform"]], "fit_transform() (wildboar.transform.paa method)": [[47, "wildboar.transform.PAA.fit_transform"]], "fit_transform() (wildboar.transform.pivottransform method)": [[47, "wildboar.transform.PivotTransform.fit_transform"]], "fit_transform() (wildboar.transform.proximitytransform method)": [[47, "wildboar.transform.ProximityTransform.fit_transform"]], "fit_transform() (wildboar.transform.randomshapelettransform method)": [[47, "wildboar.transform.RandomShapeletTransform.fit_transform"]], "fit_transform() (wildboar.transform.rockettransform method)": [[47, "wildboar.transform.RocketTransform.fit_transform"]], "fit_transform() (wildboar.transform.sax method)": [[47, "wildboar.transform.SAX.fit_transform"]], "get_metadata_routing() (wildboar.transform.difftransform method)": [[47, "wildboar.transform.DiffTransform.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform.featuretransform method)": [[47, "wildboar.transform.FeatureTransform.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform.hydratransform method)": [[47, "wildboar.transform.HydraTransform.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform.intervaltransform method)": [[47, "wildboar.transform.IntervalTransform.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform.matrixprofiletransform method)": [[47, "wildboar.transform.MatrixProfileTransform.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform.paa method)": [[47, "wildboar.transform.PAA.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform.pivottransform method)": [[47, "wildboar.transform.PivotTransform.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform.proximitytransform method)": [[47, "wildboar.transform.ProximityTransform.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform.randomshapelettransform method)": [[47, "wildboar.transform.RandomShapeletTransform.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform.rockettransform method)": [[47, "wildboar.transform.RocketTransform.get_metadata_routing"]], "get_metadata_routing() (wildboar.transform.sax method)": [[47, "wildboar.transform.SAX.get_metadata_routing"]], "get_params() (wildboar.transform.difftransform method)": [[47, "wildboar.transform.DiffTransform.get_params"]], "get_params() (wildboar.transform.featuretransform method)": [[47, "wildboar.transform.FeatureTransform.get_params"]], "get_params() (wildboar.transform.hydratransform method)": [[47, "wildboar.transform.HydraTransform.get_params"]], "get_params() (wildboar.transform.intervaltransform method)": [[47, "wildboar.transform.IntervalTransform.get_params"]], "get_params() (wildboar.transform.matrixprofiletransform method)": [[47, "wildboar.transform.MatrixProfileTransform.get_params"]], "get_params() (wildboar.transform.paa method)": [[47, "wildboar.transform.PAA.get_params"]], "get_params() (wildboar.transform.pivottransform method)": [[47, "wildboar.transform.PivotTransform.get_params"]], "get_params() (wildboar.transform.proximitytransform method)": [[47, "wildboar.transform.ProximityTransform.get_params"]], "get_params() (wildboar.transform.randomshapelettransform method)": [[47, "wildboar.transform.RandomShapeletTransform.get_params"]], "get_params() (wildboar.transform.rockettransform method)": [[47, "wildboar.transform.RocketTransform.get_params"]], "get_params() (wildboar.transform.sax method)": [[47, "wildboar.transform.SAX.get_params"]], "piecewice_aggregate_approximation() (in module wildboar.transform)": [[47, "wildboar.transform.piecewice_aggregate_approximation"]], "set_output() (wildboar.transform.difftransform method)": [[47, "wildboar.transform.DiffTransform.set_output"]], "set_output() (wildboar.transform.featuretransform method)": [[47, "wildboar.transform.FeatureTransform.set_output"]], "set_output() (wildboar.transform.hydratransform method)": [[47, "wildboar.transform.HydraTransform.set_output"]], "set_output() (wildboar.transform.intervaltransform method)": [[47, "wildboar.transform.IntervalTransform.set_output"]], "set_output() (wildboar.transform.matrixprofiletransform method)": [[47, "wildboar.transform.MatrixProfileTransform.set_output"]], "set_output() (wildboar.transform.paa method)": [[47, "wildboar.transform.PAA.set_output"]], "set_output() (wildboar.transform.pivottransform method)": [[47, "wildboar.transform.PivotTransform.set_output"]], "set_output() (wildboar.transform.proximitytransform method)": [[47, "wildboar.transform.ProximityTransform.set_output"]], "set_output() (wildboar.transform.randomshapelettransform method)": [[47, "wildboar.transform.RandomShapeletTransform.set_output"]], "set_output() (wildboar.transform.rockettransform method)": [[47, "wildboar.transform.RocketTransform.set_output"]], "set_output() (wildboar.transform.sax method)": [[47, "wildboar.transform.SAX.set_output"]], "set_params() (wildboar.transform.difftransform method)": [[47, "wildboar.transform.DiffTransform.set_params"]], "set_params() (wildboar.transform.featuretransform method)": [[47, "wildboar.transform.FeatureTransform.set_params"]], "set_params() (wildboar.transform.hydratransform method)": [[47, "wildboar.transform.HydraTransform.set_params"]], "set_params() (wildboar.transform.intervaltransform method)": [[47, "wildboar.transform.IntervalTransform.set_params"]], "set_params() (wildboar.transform.matrixprofiletransform method)": [[47, "wildboar.transform.MatrixProfileTransform.set_params"]], "set_params() (wildboar.transform.paa method)": [[47, "wildboar.transform.PAA.set_params"]], "set_params() (wildboar.transform.pivottransform method)": [[47, "wildboar.transform.PivotTransform.set_params"]], "set_params() (wildboar.transform.proximitytransform method)": [[47, "wildboar.transform.ProximityTransform.set_params"]], "set_params() (wildboar.transform.randomshapelettransform method)": [[47, "wildboar.transform.RandomShapeletTransform.set_params"]], "set_params() (wildboar.transform.rockettransform method)": [[47, "wildboar.transform.RocketTransform.set_params"]], "set_params() (wildboar.transform.sax method)": [[47, "wildboar.transform.SAX.set_params"]], "symbolic_aggregate_approximation() (in module wildboar.transform)": [[47, "wildboar.transform.symbolic_aggregate_approximation"]], "transform() (wildboar.transform.featuretransform method)": [[47, "wildboar.transform.FeatureTransform.transform"]], "transform() (wildboar.transform.hydratransform method)": [[47, "wildboar.transform.HydraTransform.transform"]], "transform() (wildboar.transform.intervaltransform method)": [[47, "wildboar.transform.IntervalTransform.transform"]], "transform() (wildboar.transform.matrixprofiletransform method)": [[47, "wildboar.transform.MatrixProfileTransform.transform"]], "transform() (wildboar.transform.pivottransform method)": [[47, "wildboar.transform.PivotTransform.transform"]], "transform() (wildboar.transform.randomshapelettransform method)": [[47, "wildboar.transform.RandomShapeletTransform.transform"]], "transform() (wildboar.transform.rockettransform method)": [[47, "wildboar.transform.RocketTransform.transform"]], "wildboar.transform": [[47, "module-wildboar.transform"]], "basetree (class in wildboar.tree._base)": [[48, "wildboar.tree._base.BaseTree"]], "basetreeclassifier (class in wildboar.tree._base)": [[48, "wildboar.tree._base.BaseTreeClassifier"]], "basetreeregressor (class in wildboar.tree._base)": [[48, "wildboar.tree._base.BaseTreeRegressor"]], "apply() (wildboar.tree._base.basetree method)": [[48, "wildboar.tree._base.BaseTree.apply"]], "apply() (wildboar.tree._base.basetreeclassifier method)": [[48, "wildboar.tree._base.BaseTreeClassifier.apply"]], "apply() (wildboar.tree._base.basetreeregressor method)": [[48, "wildboar.tree._base.BaseTreeRegressor.apply"]], "decision_path() (wildboar.tree._base.basetree method)": [[48, "wildboar.tree._base.BaseTree.decision_path"]], "decision_path() (wildboar.tree._base.basetreeclassifier method)": [[48, "wildboar.tree._base.BaseTreeClassifier.decision_path"]], "decision_path() (wildboar.tree._base.basetreeregressor method)": [[48, "wildboar.tree._base.BaseTreeRegressor.decision_path"]], "fit() (wildboar.tree._base.basetreeclassifier method)": [[48, "wildboar.tree._base.BaseTreeClassifier.fit"]], "fit() (wildboar.tree._base.basetreeregressor method)": [[48, "wildboar.tree._base.BaseTreeRegressor.fit"]], "get_metadata_routing() (wildboar.tree._base.basetree method)": [[48, "wildboar.tree._base.BaseTree.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._base.basetreeclassifier method)": [[48, "wildboar.tree._base.BaseTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._base.basetreeregressor method)": [[48, "wildboar.tree._base.BaseTreeRegressor.get_metadata_routing"]], "get_params() (wildboar.tree._base.basetree method)": [[48, "wildboar.tree._base.BaseTree.get_params"]], "get_params() (wildboar.tree._base.basetreeclassifier method)": [[48, "wildboar.tree._base.BaseTreeClassifier.get_params"]], "get_params() (wildboar.tree._base.basetreeregressor method)": [[48, "wildboar.tree._base.BaseTreeRegressor.get_params"]], "predict() (wildboar.tree._base.basetreeclassifier method)": [[48, "wildboar.tree._base.BaseTreeClassifier.predict"]], "predict() (wildboar.tree._base.basetreeregressor method)": [[48, "wildboar.tree._base.BaseTreeRegressor.predict"]], "predict_proba() (wildboar.tree._base.basetreeclassifier method)": [[48, "wildboar.tree._base.BaseTreeClassifier.predict_proba"]], "score() (wildboar.tree._base.basetreeclassifier method)": [[48, "wildboar.tree._base.BaseTreeClassifier.score"]], "score() (wildboar.tree._base.basetreeregressor method)": [[48, "wildboar.tree._base.BaseTreeRegressor.score"]], "set_params() (wildboar.tree._base.basetree method)": [[48, "wildboar.tree._base.BaseTree.set_params"]], "set_params() (wildboar.tree._base.basetreeclassifier method)": [[48, "wildboar.tree._base.BaseTreeClassifier.set_params"]], "set_params() (wildboar.tree._base.basetreeregressor method)": [[48, "wildboar.tree._base.BaseTreeRegressor.set_params"]], "wildboar.tree._base": [[48, "module-wildboar.tree._base"]], "proximitytreeclassifier (class in wildboar.tree._ptree)": [[49, "wildboar.tree._ptree.ProximityTreeClassifier"]], "apply() (wildboar.tree._ptree.proximitytreeclassifier method)": [[49, "wildboar.tree._ptree.ProximityTreeClassifier.apply"]], "decision_path() (wildboar.tree._ptree.proximitytreeclassifier method)": [[49, "wildboar.tree._ptree.ProximityTreeClassifier.decision_path"]], "fit() (wildboar.tree._ptree.proximitytreeclassifier method)": [[49, "wildboar.tree._ptree.ProximityTreeClassifier.fit"]], "get_metadata_routing() (wildboar.tree._ptree.proximitytreeclassifier method)": [[49, "wildboar.tree._ptree.ProximityTreeClassifier.get_metadata_routing"]], "get_params() (wildboar.tree._ptree.proximitytreeclassifier method)": [[49, "wildboar.tree._ptree.ProximityTreeClassifier.get_params"]], "predict() (wildboar.tree._ptree.proximitytreeclassifier method)": [[49, "wildboar.tree._ptree.ProximityTreeClassifier.predict"]], "predict_proba() (wildboar.tree._ptree.proximitytreeclassifier method)": [[49, "wildboar.tree._ptree.ProximityTreeClassifier.predict_proba"]], "score() (wildboar.tree._ptree.proximitytreeclassifier method)": [[49, "wildboar.tree._ptree.ProximityTreeClassifier.score"]], "set_params() (wildboar.tree._ptree.proximitytreeclassifier method)": [[49, "wildboar.tree._ptree.ProximityTreeClassifier.set_params"]], "wildboar.tree._ptree": [[49, "module-wildboar.tree._ptree"]], "basefeaturetreeclassifier (class in wildboar.tree._tree)": [[50, "wildboar.tree._tree.BaseFeatureTreeClassifier"]], "basefeaturetreeregressor (class in wildboar.tree._tree)": [[50, "wildboar.tree._tree.BaseFeatureTreeRegressor"]], "extrashapelettreeclassifier (class in wildboar.tree._tree)": [[50, "wildboar.tree._tree.ExtraShapeletTreeClassifier"]], "extrashapelettreeregressor (class in wildboar.tree._tree)": [[50, "wildboar.tree._tree.ExtraShapeletTreeRegressor"]], "intervaltreeclassifier (class in wildboar.tree._tree)": [[50, "wildboar.tree._tree.IntervalTreeClassifier"]], "intervaltreeregressor (class in wildboar.tree._tree)": [[50, "wildboar.tree._tree.IntervalTreeRegressor"]], "pivottreeclassifier (class in wildboar.tree._tree)": [[50, "wildboar.tree._tree.PivotTreeClassifier"]], "rockettreeclassifier (class in wildboar.tree._tree)": [[50, "wildboar.tree._tree.RocketTreeClassifier"]], "rockettreeregressor (class in wildboar.tree._tree)": [[50, "wildboar.tree._tree.RocketTreeRegressor"]], "shapelettreeclassifier (class in wildboar.tree._tree)": [[50, "wildboar.tree._tree.ShapeletTreeClassifier"]], "shapelettreeregressor (class in wildboar.tree._tree)": [[50, "wildboar.tree._tree.ShapeletTreeRegressor"]], "apply() (wildboar.tree._tree.basefeaturetreeclassifier method)": [[50, "wildboar.tree._tree.BaseFeatureTreeClassifier.apply"]], "apply() (wildboar.tree._tree.basefeaturetreeregressor method)": [[50, "wildboar.tree._tree.BaseFeatureTreeRegressor.apply"]], "apply() (wildboar.tree._tree.extrashapelettreeclassifier method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeClassifier.apply"]], "apply() (wildboar.tree._tree.extrashapelettreeregressor method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeRegressor.apply"]], "apply() (wildboar.tree._tree.intervaltreeclassifier method)": [[50, "wildboar.tree._tree.IntervalTreeClassifier.apply"]], "apply() (wildboar.tree._tree.intervaltreeregressor method)": [[50, "wildboar.tree._tree.IntervalTreeRegressor.apply"]], "apply() (wildboar.tree._tree.pivottreeclassifier method)": [[50, "wildboar.tree._tree.PivotTreeClassifier.apply"]], "apply() (wildboar.tree._tree.rockettreeclassifier method)": [[50, "wildboar.tree._tree.RocketTreeClassifier.apply"]], "apply() (wildboar.tree._tree.rockettreeregressor method)": [[50, "wildboar.tree._tree.RocketTreeRegressor.apply"]], "apply() (wildboar.tree._tree.shapelettreeclassifier method)": [[50, "wildboar.tree._tree.ShapeletTreeClassifier.apply"]], "apply() (wildboar.tree._tree.shapelettreeregressor method)": [[50, "wildboar.tree._tree.ShapeletTreeRegressor.apply"]], "decision_path() (wildboar.tree._tree.basefeaturetreeclassifier method)": [[50, "wildboar.tree._tree.BaseFeatureTreeClassifier.decision_path"]], "decision_path() (wildboar.tree._tree.basefeaturetreeregressor method)": [[50, "wildboar.tree._tree.BaseFeatureTreeRegressor.decision_path"]], "decision_path() (wildboar.tree._tree.extrashapelettreeclassifier method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeClassifier.decision_path"]], "decision_path() (wildboar.tree._tree.extrashapelettreeregressor method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeRegressor.decision_path"]], "decision_path() (wildboar.tree._tree.intervaltreeclassifier method)": [[50, "wildboar.tree._tree.IntervalTreeClassifier.decision_path"]], "decision_path() (wildboar.tree._tree.intervaltreeregressor method)": [[50, "wildboar.tree._tree.IntervalTreeRegressor.decision_path"]], "decision_path() (wildboar.tree._tree.pivottreeclassifier method)": [[50, "wildboar.tree._tree.PivotTreeClassifier.decision_path"]], "decision_path() (wildboar.tree._tree.rockettreeclassifier method)": [[50, "wildboar.tree._tree.RocketTreeClassifier.decision_path"]], "decision_path() (wildboar.tree._tree.rockettreeregressor method)": [[50, "wildboar.tree._tree.RocketTreeRegressor.decision_path"]], "decision_path() (wildboar.tree._tree.shapelettreeclassifier method)": [[50, "wildboar.tree._tree.ShapeletTreeClassifier.decision_path"]], "decision_path() (wildboar.tree._tree.shapelettreeregressor method)": [[50, "wildboar.tree._tree.ShapeletTreeRegressor.decision_path"]], "fit() (wildboar.tree._tree.basefeaturetreeclassifier method)": [[50, "wildboar.tree._tree.BaseFeatureTreeClassifier.fit"]], "fit() (wildboar.tree._tree.basefeaturetreeregressor method)": [[50, "wildboar.tree._tree.BaseFeatureTreeRegressor.fit"]], "fit() (wildboar.tree._tree.extrashapelettreeclassifier method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeClassifier.fit"]], "fit() (wildboar.tree._tree.extrashapelettreeregressor method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeRegressor.fit"]], "fit() (wildboar.tree._tree.intervaltreeclassifier method)": [[50, "wildboar.tree._tree.IntervalTreeClassifier.fit"]], "fit() (wildboar.tree._tree.intervaltreeregressor method)": [[50, "wildboar.tree._tree.IntervalTreeRegressor.fit"]], "fit() (wildboar.tree._tree.pivottreeclassifier method)": [[50, "wildboar.tree._tree.PivotTreeClassifier.fit"]], "fit() (wildboar.tree._tree.rockettreeclassifier method)": [[50, "wildboar.tree._tree.RocketTreeClassifier.fit"]], "fit() (wildboar.tree._tree.rockettreeregressor method)": [[50, "wildboar.tree._tree.RocketTreeRegressor.fit"]], "fit() (wildboar.tree._tree.shapelettreeclassifier method)": [[50, "wildboar.tree._tree.ShapeletTreeClassifier.fit"]], "fit() (wildboar.tree._tree.shapelettreeregressor method)": [[50, "wildboar.tree._tree.ShapeletTreeRegressor.fit"]], "get_metadata_routing() (wildboar.tree._tree.basefeaturetreeclassifier method)": [[50, "wildboar.tree._tree.BaseFeatureTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._tree.basefeaturetreeregressor method)": [[50, "wildboar.tree._tree.BaseFeatureTreeRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._tree.extrashapelettreeclassifier method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._tree.extrashapelettreeregressor method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._tree.intervaltreeclassifier method)": [[50, "wildboar.tree._tree.IntervalTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._tree.intervaltreeregressor method)": [[50, "wildboar.tree._tree.IntervalTreeRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._tree.pivottreeclassifier method)": [[50, "wildboar.tree._tree.PivotTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._tree.rockettreeclassifier method)": [[50, "wildboar.tree._tree.RocketTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._tree.rockettreeregressor method)": [[50, "wildboar.tree._tree.RocketTreeRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._tree.shapelettreeclassifier method)": [[50, "wildboar.tree._tree.ShapeletTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree._tree.shapelettreeregressor method)": [[50, "wildboar.tree._tree.ShapeletTreeRegressor.get_metadata_routing"]], "get_params() (wildboar.tree._tree.basefeaturetreeclassifier method)": [[50, "wildboar.tree._tree.BaseFeatureTreeClassifier.get_params"]], "get_params() (wildboar.tree._tree.basefeaturetreeregressor method)": [[50, "wildboar.tree._tree.BaseFeatureTreeRegressor.get_params"]], "get_params() (wildboar.tree._tree.extrashapelettreeclassifier method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeClassifier.get_params"]], "get_params() (wildboar.tree._tree.extrashapelettreeregressor method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeRegressor.get_params"]], "get_params() (wildboar.tree._tree.intervaltreeclassifier method)": [[50, "wildboar.tree._tree.IntervalTreeClassifier.get_params"]], "get_params() (wildboar.tree._tree.intervaltreeregressor method)": [[50, "wildboar.tree._tree.IntervalTreeRegressor.get_params"]], "get_params() (wildboar.tree._tree.pivottreeclassifier method)": [[50, "wildboar.tree._tree.PivotTreeClassifier.get_params"]], "get_params() (wildboar.tree._tree.rockettreeclassifier method)": [[50, "wildboar.tree._tree.RocketTreeClassifier.get_params"]], "get_params() (wildboar.tree._tree.rockettreeregressor method)": [[50, "wildboar.tree._tree.RocketTreeRegressor.get_params"]], "get_params() (wildboar.tree._tree.shapelettreeclassifier method)": [[50, "wildboar.tree._tree.ShapeletTreeClassifier.get_params"]], "get_params() (wildboar.tree._tree.shapelettreeregressor method)": [[50, "wildboar.tree._tree.ShapeletTreeRegressor.get_params"]], "predict() (wildboar.tree._tree.basefeaturetreeclassifier method)": [[50, "wildboar.tree._tree.BaseFeatureTreeClassifier.predict"]], "predict() (wildboar.tree._tree.basefeaturetreeregressor method)": [[50, "wildboar.tree._tree.BaseFeatureTreeRegressor.predict"]], "predict() (wildboar.tree._tree.extrashapelettreeclassifier method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeClassifier.predict"]], "predict() (wildboar.tree._tree.extrashapelettreeregressor method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeRegressor.predict"]], "predict() (wildboar.tree._tree.intervaltreeclassifier method)": [[50, "wildboar.tree._tree.IntervalTreeClassifier.predict"]], "predict() (wildboar.tree._tree.intervaltreeregressor method)": [[50, "wildboar.tree._tree.IntervalTreeRegressor.predict"]], "predict() (wildboar.tree._tree.pivottreeclassifier method)": [[50, "wildboar.tree._tree.PivotTreeClassifier.predict"]], "predict() (wildboar.tree._tree.rockettreeclassifier method)": [[50, "wildboar.tree._tree.RocketTreeClassifier.predict"]], "predict() (wildboar.tree._tree.rockettreeregressor method)": [[50, "wildboar.tree._tree.RocketTreeRegressor.predict"]], "predict() (wildboar.tree._tree.shapelettreeclassifier method)": [[50, "wildboar.tree._tree.ShapeletTreeClassifier.predict"]], "predict() (wildboar.tree._tree.shapelettreeregressor method)": [[50, "wildboar.tree._tree.ShapeletTreeRegressor.predict"]], "predict_proba() (wildboar.tree._tree.basefeaturetreeclassifier method)": [[50, "wildboar.tree._tree.BaseFeatureTreeClassifier.predict_proba"]], "predict_proba() (wildboar.tree._tree.extrashapelettreeclassifier method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeClassifier.predict_proba"]], "predict_proba() (wildboar.tree._tree.intervaltreeclassifier method)": [[50, "wildboar.tree._tree.IntervalTreeClassifier.predict_proba"]], "predict_proba() (wildboar.tree._tree.pivottreeclassifier method)": [[50, "wildboar.tree._tree.PivotTreeClassifier.predict_proba"]], "predict_proba() (wildboar.tree._tree.rockettreeclassifier method)": [[50, "wildboar.tree._tree.RocketTreeClassifier.predict_proba"]], "predict_proba() (wildboar.tree._tree.shapelettreeclassifier method)": [[50, "wildboar.tree._tree.ShapeletTreeClassifier.predict_proba"]], "score() (wildboar.tree._tree.basefeaturetreeclassifier method)": [[50, "wildboar.tree._tree.BaseFeatureTreeClassifier.score"]], "score() (wildboar.tree._tree.basefeaturetreeregressor method)": [[50, "wildboar.tree._tree.BaseFeatureTreeRegressor.score"]], "score() (wildboar.tree._tree.extrashapelettreeclassifier method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeClassifier.score"]], "score() (wildboar.tree._tree.extrashapelettreeregressor method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeRegressor.score"]], "score() (wildboar.tree._tree.intervaltreeclassifier method)": [[50, "wildboar.tree._tree.IntervalTreeClassifier.score"]], "score() (wildboar.tree._tree.intervaltreeregressor method)": [[50, "wildboar.tree._tree.IntervalTreeRegressor.score"]], "score() (wildboar.tree._tree.pivottreeclassifier method)": [[50, "wildboar.tree._tree.PivotTreeClassifier.score"]], "score() (wildboar.tree._tree.rockettreeclassifier method)": [[50, "wildboar.tree._tree.RocketTreeClassifier.score"]], "score() (wildboar.tree._tree.rockettreeregressor method)": [[50, "wildboar.tree._tree.RocketTreeRegressor.score"]], "score() (wildboar.tree._tree.shapelettreeclassifier method)": [[50, "wildboar.tree._tree.ShapeletTreeClassifier.score"]], "score() (wildboar.tree._tree.shapelettreeregressor method)": [[50, "wildboar.tree._tree.ShapeletTreeRegressor.score"]], "set_params() (wildboar.tree._tree.basefeaturetreeclassifier method)": [[50, "wildboar.tree._tree.BaseFeatureTreeClassifier.set_params"]], "set_params() (wildboar.tree._tree.basefeaturetreeregressor method)": [[50, "wildboar.tree._tree.BaseFeatureTreeRegressor.set_params"]], "set_params() (wildboar.tree._tree.extrashapelettreeclassifier method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeClassifier.set_params"]], "set_params() (wildboar.tree._tree.extrashapelettreeregressor method)": [[50, "wildboar.tree._tree.ExtraShapeletTreeRegressor.set_params"]], "set_params() (wildboar.tree._tree.intervaltreeclassifier method)": [[50, "wildboar.tree._tree.IntervalTreeClassifier.set_params"]], "set_params() (wildboar.tree._tree.intervaltreeregressor method)": [[50, "wildboar.tree._tree.IntervalTreeRegressor.set_params"]], "set_params() (wildboar.tree._tree.pivottreeclassifier method)": [[50, "wildboar.tree._tree.PivotTreeClassifier.set_params"]], "set_params() (wildboar.tree._tree.rockettreeclassifier method)": [[50, "wildboar.tree._tree.RocketTreeClassifier.set_params"]], "set_params() (wildboar.tree._tree.rockettreeregressor method)": [[50, "wildboar.tree._tree.RocketTreeRegressor.set_params"]], "set_params() (wildboar.tree._tree.shapelettreeclassifier method)": [[50, "wildboar.tree._tree.ShapeletTreeClassifier.set_params"]], "set_params() (wildboar.tree._tree.shapelettreeregressor method)": [[50, "wildboar.tree._tree.ShapeletTreeRegressor.set_params"]], "wildboar.tree._tree": [[50, "module-wildboar.tree._tree"]], "extrashapelettreeclassifier (class in wildboar.tree)": [[51, "wildboar.tree.ExtraShapeletTreeClassifier"]], "extrashapelettreeregressor (class in wildboar.tree)": [[51, "wildboar.tree.ExtraShapeletTreeRegressor"]], "intervaltreeclassifier (class in wildboar.tree)": [[51, "wildboar.tree.IntervalTreeClassifier"]], "intervaltreeregressor (class in wildboar.tree)": [[51, "wildboar.tree.IntervalTreeRegressor"]], "pivottreeclassifier (class in wildboar.tree)": [[51, "wildboar.tree.PivotTreeClassifier"]], "proximitytreeclassifier (class in wildboar.tree)": [[51, "wildboar.tree.ProximityTreeClassifier"]], "rockettreeclassifier (class in wildboar.tree)": [[51, "wildboar.tree.RocketTreeClassifier"]], "rockettreeregressor (class in wildboar.tree)": [[51, "wildboar.tree.RocketTreeRegressor"]], "shapelettreeclassifier (class in wildboar.tree)": [[51, "wildboar.tree.ShapeletTreeClassifier"]], "shapelettreeregressor (class in wildboar.tree)": [[51, "wildboar.tree.ShapeletTreeRegressor"]], "apply() (wildboar.tree.extrashapelettreeclassifier method)": [[51, "wildboar.tree.ExtraShapeletTreeClassifier.apply"]], "apply() (wildboar.tree.extrashapelettreeregressor method)": [[51, "wildboar.tree.ExtraShapeletTreeRegressor.apply"]], "apply() (wildboar.tree.intervaltreeclassifier method)": [[51, "wildboar.tree.IntervalTreeClassifier.apply"]], "apply() (wildboar.tree.intervaltreeregressor method)": [[51, "wildboar.tree.IntervalTreeRegressor.apply"]], "apply() (wildboar.tree.pivottreeclassifier method)": [[51, "wildboar.tree.PivotTreeClassifier.apply"]], "apply() (wildboar.tree.proximitytreeclassifier method)": [[51, "wildboar.tree.ProximityTreeClassifier.apply"]], "apply() (wildboar.tree.rockettreeclassifier method)": [[51, "wildboar.tree.RocketTreeClassifier.apply"]], "apply() (wildboar.tree.rockettreeregressor method)": [[51, "wildboar.tree.RocketTreeRegressor.apply"]], "apply() (wildboar.tree.shapelettreeclassifier method)": [[51, "wildboar.tree.ShapeletTreeClassifier.apply"]], "apply() (wildboar.tree.shapelettreeregressor method)": [[51, "wildboar.tree.ShapeletTreeRegressor.apply"]], "decision_path() (wildboar.tree.extrashapelettreeclassifier method)": [[51, "wildboar.tree.ExtraShapeletTreeClassifier.decision_path"]], "decision_path() (wildboar.tree.extrashapelettreeregressor method)": [[51, "wildboar.tree.ExtraShapeletTreeRegressor.decision_path"]], "decision_path() (wildboar.tree.intervaltreeclassifier method)": [[51, "wildboar.tree.IntervalTreeClassifier.decision_path"]], "decision_path() (wildboar.tree.intervaltreeregressor method)": [[51, "wildboar.tree.IntervalTreeRegressor.decision_path"]], "decision_path() (wildboar.tree.pivottreeclassifier method)": [[51, "wildboar.tree.PivotTreeClassifier.decision_path"]], "decision_path() (wildboar.tree.proximitytreeclassifier method)": [[51, "wildboar.tree.ProximityTreeClassifier.decision_path"]], "decision_path() (wildboar.tree.rockettreeclassifier method)": [[51, "wildboar.tree.RocketTreeClassifier.decision_path"]], "decision_path() (wildboar.tree.rockettreeregressor method)": [[51, "wildboar.tree.RocketTreeRegressor.decision_path"]], "decision_path() (wildboar.tree.shapelettreeclassifier method)": [[51, "wildboar.tree.ShapeletTreeClassifier.decision_path"]], "decision_path() (wildboar.tree.shapelettreeregressor method)": [[51, "wildboar.tree.ShapeletTreeRegressor.decision_path"]], "fit() (wildboar.tree.extrashapelettreeclassifier method)": [[51, "wildboar.tree.ExtraShapeletTreeClassifier.fit"]], "fit() (wildboar.tree.extrashapelettreeregressor method)": [[51, "wildboar.tree.ExtraShapeletTreeRegressor.fit"]], "fit() (wildboar.tree.intervaltreeclassifier method)": [[51, "wildboar.tree.IntervalTreeClassifier.fit"]], "fit() (wildboar.tree.intervaltreeregressor method)": [[51, "wildboar.tree.IntervalTreeRegressor.fit"]], "fit() (wildboar.tree.pivottreeclassifier method)": [[51, "wildboar.tree.PivotTreeClassifier.fit"]], "fit() (wildboar.tree.proximitytreeclassifier method)": [[51, "wildboar.tree.ProximityTreeClassifier.fit"]], "fit() (wildboar.tree.rockettreeclassifier method)": [[51, "wildboar.tree.RocketTreeClassifier.fit"]], "fit() (wildboar.tree.rockettreeregressor method)": [[51, "wildboar.tree.RocketTreeRegressor.fit"]], "fit() (wildboar.tree.shapelettreeclassifier method)": [[51, "wildboar.tree.ShapeletTreeClassifier.fit"]], "fit() (wildboar.tree.shapelettreeregressor method)": [[51, "wildboar.tree.ShapeletTreeRegressor.fit"]], "get_metadata_routing() (wildboar.tree.extrashapelettreeclassifier method)": [[51, "wildboar.tree.ExtraShapeletTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree.extrashapelettreeregressor method)": [[51, "wildboar.tree.ExtraShapeletTreeRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree.intervaltreeclassifier method)": [[51, "wildboar.tree.IntervalTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree.intervaltreeregressor method)": [[51, "wildboar.tree.IntervalTreeRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree.pivottreeclassifier method)": [[51, "wildboar.tree.PivotTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree.proximitytreeclassifier method)": [[51, "wildboar.tree.ProximityTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree.rockettreeclassifier method)": [[51, "wildboar.tree.RocketTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree.rockettreeregressor method)": [[51, "wildboar.tree.RocketTreeRegressor.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree.shapelettreeclassifier method)": [[51, "wildboar.tree.ShapeletTreeClassifier.get_metadata_routing"]], "get_metadata_routing() (wildboar.tree.shapelettreeregressor method)": [[51, "wildboar.tree.ShapeletTreeRegressor.get_metadata_routing"]], "get_params() (wildboar.tree.extrashapelettreeclassifier method)": [[51, "wildboar.tree.ExtraShapeletTreeClassifier.get_params"]], "get_params() (wildboar.tree.extrashapelettreeregressor method)": [[51, "wildboar.tree.ExtraShapeletTreeRegressor.get_params"]], "get_params() (wildboar.tree.intervaltreeclassifier method)": [[51, "wildboar.tree.IntervalTreeClassifier.get_params"]], "get_params() (wildboar.tree.intervaltreeregressor method)": [[51, "wildboar.tree.IntervalTreeRegressor.get_params"]], "get_params() (wildboar.tree.pivottreeclassifier method)": [[51, "wildboar.tree.PivotTreeClassifier.get_params"]], "get_params() (wildboar.tree.proximitytreeclassifier method)": [[51, "wildboar.tree.ProximityTreeClassifier.get_params"]], "get_params() (wildboar.tree.rockettreeclassifier method)": [[51, "wildboar.tree.RocketTreeClassifier.get_params"]], "get_params() (wildboar.tree.rockettreeregressor method)": [[51, "wildboar.tree.RocketTreeRegressor.get_params"]], "get_params() (wildboar.tree.shapelettreeclassifier method)": [[51, "wildboar.tree.ShapeletTreeClassifier.get_params"]], "get_params() (wildboar.tree.shapelettreeregressor method)": [[51, "wildboar.tree.ShapeletTreeRegressor.get_params"]], "predict() (wildboar.tree.extrashapelettreeclassifier method)": [[51, "wildboar.tree.ExtraShapeletTreeClassifier.predict"]], "predict() (wildboar.tree.extrashapelettreeregressor method)": [[51, "wildboar.tree.ExtraShapeletTreeRegressor.predict"]], "predict() (wildboar.tree.intervaltreeclassifier method)": [[51, "wildboar.tree.IntervalTreeClassifier.predict"]], "predict() (wildboar.tree.intervaltreeregressor method)": [[51, "wildboar.tree.IntervalTreeRegressor.predict"]], "predict() (wildboar.tree.pivottreeclassifier method)": [[51, "wildboar.tree.PivotTreeClassifier.predict"]], "predict() (wildboar.tree.proximitytreeclassifier method)": [[51, "wildboar.tree.ProximityTreeClassifier.predict"]], "predict() (wildboar.tree.rockettreeclassifier method)": [[51, "wildboar.tree.RocketTreeClassifier.predict"]], "predict() (wildboar.tree.rockettreeregressor method)": [[51, "wildboar.tree.RocketTreeRegressor.predict"]], "predict() (wildboar.tree.shapelettreeclassifier method)": [[51, "wildboar.tree.ShapeletTreeClassifier.predict"]], "predict() (wildboar.tree.shapelettreeregressor method)": [[51, "wildboar.tree.ShapeletTreeRegressor.predict"]], "predict_proba() (wildboar.tree.extrashapelettreeclassifier method)": [[51, "wildboar.tree.ExtraShapeletTreeClassifier.predict_proba"]], "predict_proba() (wildboar.tree.intervaltreeclassifier method)": [[51, "wildboar.tree.IntervalTreeClassifier.predict_proba"]], "predict_proba() (wildboar.tree.pivottreeclassifier method)": [[51, "wildboar.tree.PivotTreeClassifier.predict_proba"]], "predict_proba() (wildboar.tree.proximitytreeclassifier method)": [[51, "wildboar.tree.ProximityTreeClassifier.predict_proba"]], "predict_proba() (wildboar.tree.rockettreeclassifier method)": [[51, "wildboar.tree.RocketTreeClassifier.predict_proba"]], "predict_proba() (wildboar.tree.shapelettreeclassifier method)": [[51, "wildboar.tree.ShapeletTreeClassifier.predict_proba"]], "score() (wildboar.tree.extrashapelettreeclassifier method)": [[51, "wildboar.tree.ExtraShapeletTreeClassifier.score"]], "score() (wildboar.tree.extrashapelettreeregressor method)": [[51, "wildboar.tree.ExtraShapeletTreeRegressor.score"]], "score() (wildboar.tree.intervaltreeclassifier method)": [[51, "wildboar.tree.IntervalTreeClassifier.score"]], "score() (wildboar.tree.intervaltreeregressor method)": [[51, "wildboar.tree.IntervalTreeRegressor.score"]], "score() (wildboar.tree.pivottreeclassifier method)": [[51, "wildboar.tree.PivotTreeClassifier.score"]], "score() (wildboar.tree.proximitytreeclassifier method)": [[51, "wildboar.tree.ProximityTreeClassifier.score"]], "score() (wildboar.tree.rockettreeclassifier method)": [[51, "wildboar.tree.RocketTreeClassifier.score"]], "score() (wildboar.tree.rockettreeregressor method)": [[51, "wildboar.tree.RocketTreeRegressor.score"]], "score() (wildboar.tree.shapelettreeclassifier method)": [[51, "wildboar.tree.ShapeletTreeClassifier.score"]], "score() (wildboar.tree.shapelettreeregressor method)": [[51, "wildboar.tree.ShapeletTreeRegressor.score"]], "set_params() (wildboar.tree.extrashapelettreeclassifier method)": [[51, "wildboar.tree.ExtraShapeletTreeClassifier.set_params"]], "set_params() (wildboar.tree.extrashapelettreeregressor method)": [[51, "wildboar.tree.ExtraShapeletTreeRegressor.set_params"]], "set_params() (wildboar.tree.intervaltreeclassifier method)": [[51, "wildboar.tree.IntervalTreeClassifier.set_params"]], "set_params() (wildboar.tree.intervaltreeregressor method)": [[51, "wildboar.tree.IntervalTreeRegressor.set_params"]], "set_params() (wildboar.tree.pivottreeclassifier method)": [[51, "wildboar.tree.PivotTreeClassifier.set_params"]], "set_params() (wildboar.tree.proximitytreeclassifier method)": [[51, "wildboar.tree.ProximityTreeClassifier.set_params"]], "set_params() (wildboar.tree.rockettreeclassifier method)": [[51, "wildboar.tree.RocketTreeClassifier.set_params"]], "set_params() (wildboar.tree.rockettreeregressor method)": [[51, "wildboar.tree.RocketTreeRegressor.set_params"]], "set_params() (wildboar.tree.shapelettreeclassifier method)": [[51, "wildboar.tree.ShapeletTreeClassifier.set_params"]], "set_params() (wildboar.tree.shapelettreeregressor method)": [[51, "wildboar.tree.ShapeletTreeRegressor.set_params"]], "wildboar.tree": [[51, "module-wildboar.tree"]], "run_in_parallel() (in module wildboar.utils._parallel)": [[52, "wildboar.utils._parallel.run_in_parallel"]], "wildboar.utils._parallel": [[52, "module-wildboar.utils._parallel"]], "assert_exhaustive_parameter_checks() (in module wildboar.utils._testing)": [[53, "wildboar.utils._testing.assert_exhaustive_parameter_checks"]], "assert_parameter_checks() (in module wildboar.utils._testing)": [[53, "wildboar.utils._testing.assert_parameter_checks"]], "wildboar.utils._testing": [[53, "module-wildboar.utils._testing"]], "array_or_scalar() (in module wildboar.utils.decorators)": [[54, "wildboar.utils.decorators.array_or_scalar"]], "singleton() (in module wildboar.utils.decorators)": [[54, "wildboar.utils.decorators.singleton"]], "unstable() (in module wildboar.utils.decorators)": [[54, "wildboar.utils.decorators.unstable"]], "wildboar.utils.decorators": [[54, "module-wildboar.utils.decorators"]], "check_estimator() (in module wildboar.utils.estimator_checks)": [[55, "wildboar.utils.estimator_checks.check_estimator"]], "wildboar.utils.estimator_checks": [[55, "module-wildboar.utils.estimator_checks"]], "check_x_y() (in module wildboar.utils)": [[56, "wildboar.utils.check_X_y"]], "check_array() (in module wildboar.utils)": [[56, "wildboar.utils.check_array"]], "wildboar.utils": [[56, "module-wildboar.utils"]], "midpointnormalize (class in wildboar.utils.plot)": [[57, "wildboar.utils.plot.MidpointNormalize"]], "autoscale() (wildboar.utils.plot.midpointnormalize method)": [[57, "wildboar.utils.plot.MidpointNormalize.autoscale"]], "autoscale_none() (wildboar.utils.plot.midpointnormalize method)": [[57, "wildboar.utils.plot.MidpointNormalize.autoscale_None"]], "plot_frequency_domain() (in module wildboar.utils.plot)": [[57, "wildboar.utils.plot.plot_frequency_domain"]], "plot_time_domain() (in module wildboar.utils.plot)": [[57, "wildboar.utils.plot.plot_time_domain"]], "process_value() (wildboar.utils.plot.midpointnormalize static method)": [[57, "wildboar.utils.plot.MidpointNormalize.process_value"]], "scaled() (wildboar.utils.plot.midpointnormalize method)": [[57, "wildboar.utils.plot.MidpointNormalize.scaled"]], "wildboar.utils.plot": [[57, "module-wildboar.utils.plot"]], "check_x_y() (in module wildboar.utils.validation)": [[58, "wildboar.utils.validation.check_X_y"]], "check_array() (in module wildboar.utils.validation)": [[58, "wildboar.utils.validation.check_array"]], "check_classification_targets() (in module wildboar.utils.validation)": [[58, "wildboar.utils.validation.check_classification_targets"]], "check_option() (in module wildboar.utils.validation)": [[58, "wildboar.utils.validation.check_option"]], "check_type() (in module wildboar.utils.validation)": [[58, "wildboar.utils.validation.check_type"]], "wildboar.utils.validation": [[58, "module-wildboar.utils.validation"]], "get_variable_length() (in module wildboar.utils.variable_len)": [[59, "wildboar.utils.variable_len.get_variable_length"]], "is_end_of_series() (in module wildboar.utils.variable_len)": [[59, "wildboar.utils.variable_len.is_end_of_series"]], "is_variable_length() (in module wildboar.utils.variable_len)": [[59, "wildboar.utils.variable_len.is_variable_length"]], "wildboar.utils.variable_len": [[59, "module-wildboar.utils.variable_len"]], "wildboar.version": [[60, "module-wildboar.version"]]}}) \ No newline at end of file