diff --git a/defaults/config/php/8.0.x/php-fpm.conf b/defaults/config/php/8.0.x/php-fpm.conf deleted file mode 100644 index 74966b9cf..000000000 --- a/defaults/config/php/8.0.x/php-fpm.conf +++ /dev/null @@ -1,523 +0,0 @@ -;;;;;;;;;;;;;;;;;;;;; -; FPM Configuration ; -;;;;;;;;;;;;;;;;;;;;; - -; All relative paths in this configuration file are relative to PHP's install -; prefix (/tmp/staged/app/php). This prefix can be dynamically changed by using the -; '-p' argument from the command line. - -;;;;;;;;;;;;;;;;;; -; Global Options ; -;;;;;;;;;;;;;;;;;; - -[global] -; Pid file -; Note: the default prefix is /tmp/staged/app/php/var -; Default Value: none -pid = @{HOME}/php/var/run/php-fpm.pid - -; Error log file -; If it's set to "syslog", log is sent to syslogd instead of being written -; in a local file. -; Note: the default prefix is /tmp/staged/app/php/var -; Default Value: log/php-fpm.log -error_log = /proc/self/fd/2 - -; syslog_facility is used to specify what type of program is logging the -; message. This lets syslogd specify that messages from different facilities -; will be handled differently. -; See syslog(3) for possible values (ex daemon equiv LOG_DAEMON) -; Default Value: daemon -;syslog.facility = daemon - -; syslog_ident is prepended to every message. If you have multiple FPM -; instances running on the same server, you can change the default value -; which must suit common needs. -; Default Value: php-fpm -;syslog.ident = php-fpm - -; Log level -; Possible Values: alert, error, warning, notice, debug -; Default Value: notice -;log_level = notice - -; If this number of child processes exit with SIGSEGV or SIGBUS within the time -; interval set by emergency_restart_interval then FPM will restart. A value -; of '0' means 'Off'. -; Default Value: 0 -;emergency_restart_threshold = 0 - -; Interval of time used by emergency_restart_interval to determine when -; a graceful restart will be initiated. This can be useful to work around -; accidental corruptions in an accelerator's shared memory. -; Available Units: s(econds), m(inutes), h(ours), or d(ays) -; Default Unit: seconds -; Default Value: 0 -;emergency_restart_interval = 0 - -; Time limit for child processes to wait for a reaction on signals from master. -; Available units: s(econds), m(inutes), h(ours), or d(ays) -; Default Unit: seconds -; Default Value: 0 -;process_control_timeout = 0 - -; The maximum number of processes FPM will fork. This has been design to control -; the global number of processes when using dynamic PM within a lot of pools. -; Use it with caution. -; Note: A value of 0 indicates no limit -; Default Value: 0 -; process.max = 128 - -; Specify the nice(2) priority to apply to the master process (only if set) -; The value can vary from -19 (highest priority) to 20 (lower priority) -; Note: - It will only work if the FPM master process is launched as root -; - The pool process will inherit the master process priority -; unless it specified otherwise -; Default Value: no set -; process.priority = -19 - -; Send FPM to background. Set to 'no' to keep FPM in foreground for debugging. -; Default Value: yes -daemonize = no - -; Set open file descriptor rlimit for the master process. -; Default Value: system defined value -;rlimit_files = 1024 - -; Set max core size rlimit for the master process. -; Possible Values: 'unlimited' or an integer greater or equal to 0 -; Default Value: system defined value -;rlimit_core = 0 - -; Specify the event mechanism FPM will use. The following is available: -; - select (any POSIX os) -; - poll (any POSIX os) -; - epoll (linux >= 2.5.44) -; - kqueue (FreeBSD >= 4.1, OpenBSD >= 2.9, NetBSD >= 2.0) -; - /dev/poll (Solaris >= 7) -; - port (Solaris >= 10) -; Default Value: not set (auto detection) -;events.mechanism = epoll - -; When FPM is build with systemd integration, specify the interval, -; in second, between health report notification to systemd. -; Set to 0 to disable. -; Available Units: s(econds), m(inutes), h(ours) -; Default Unit: seconds -; Default value: 10 -;systemd_interval = 10 - -;;;;;;;;;;;;;;;;;;;; -; Pool Definitions ; -;;;;;;;;;;;;;;;;;;;; - -; Multiple pools of child processes may be started with different listening -; ports and different management options. The name of the pool will be -; used in logs and stats. There is no limitation on the number of pools which -; FPM can handle. Your system will tell you anyway :) - -; Start a new pool named 'www'. -; the variable $pool can we used in any directive and will be replaced by the -; pool name ('www' here) -[www] - -; Per pool prefix -; It only applies on the following directives: -; - 'slowlog' -; - 'listen' (unixsocket) -; - 'chroot' -; - 'chdir' -; - 'php_values' -; - 'php_admin_values' -; When not set, the global prefix (or /tmp/staged/app/php) applies instead. -; Note: This directive can also be relative to the global prefix. -; Default Value: none -;prefix = /path/to/pools/$pool - -; Unix user/group of processes -; Note: The user is mandatory. If the group is not set, the default user's group -; will be used. -;user = nobody -;group = nobody - -; The address on which to accept FastCGI requests. -; Valid syntaxes are: -; 'ip.add.re.ss:port' - to listen on a TCP socket to a specific address on -; a specific port; -; 'port' - to listen on a TCP socket to all addresses on a -; specific port; -; '/path/to/unix/socket' - to listen on a unix socket. -; Note: This value is mandatory. -listen = #PHP_FPM_LISTEN - -; Set listen(2) backlog. -; Default Value: 65535 (-1 on FreeBSD and OpenBSD) -;listen.backlog = 65535 - -; Set permissions for unix socket, if one is used. In Linux, read/write -; permissions must be set in order to allow connections from a web server. Many -; BSD-derived systems allow connections regardless of permissions. -; Default Values: user and group are set as the running user -; mode is set to 0660 -;listen.owner = nobody -;listen.group = nobody -;listen.mode = 0660 - -; List of ipv4 addresses of FastCGI clients which are allowed to connect. -; Equivalent to the FCGI_WEB_SERVER_ADDRS environment variable in the original -; PHP FCGI (5.2.2+). Makes sense only with a tcp listening socket. Each address -; must be separated by a comma. If this value is left blank, connections will be -; accepted from any ip address. -; Default Value: any -listen.allowed_clients = 127.0.0.1 - -; Specify the nice(2) priority to apply to the pool processes (only if set) -; The value can vary from -19 (highest priority) to 20 (lower priority) -; Note: - It will only work if the FPM master process is launched as root -; - The pool processes will inherit the master process priority -; unless it specified otherwise -; Default Value: no set -; process.priority = -19 - -; Choose how the process manager will control the number of child processes. -; Possible Values: -; static - a fixed number (pm.max_children) of child processes; -; dynamic - the number of child processes are set dynamically based on the -; following directives. With this process management, there will be -; always at least 1 children. -; pm.max_children - the maximum number of children that can -; be alive at the same time. -; pm.start_servers - the number of children created on startup. -; pm.min_spare_servers - the minimum number of children in 'idle' -; state (waiting to process). If the number -; of 'idle' processes is less than this -; number then some children will be created. -; pm.max_spare_servers - the maximum number of children in 'idle' -; state (waiting to process). If the number -; of 'idle' processes is greater than this -; number then some children will be killed. -; ondemand - no children are created at startup. Children will be forked when -; new requests will connect. The following parameter are used: -; pm.max_children - the maximum number of children that -; can be alive at the same time. -; pm.process_idle_timeout - The number of seconds after which -; an idle process will be killed. -; Note: This value is mandatory. -pm = dynamic - -; The number of child processes to be created when pm is set to 'static' and the -; maximum number of child processes when pm is set to 'dynamic' or 'ondemand'. -; This value sets the limit on the number of simultaneous requests that will be -; served. Equivalent to the ApacheMaxClients directive with mpm_prefork. -; Equivalent to the PHP_FCGI_CHILDREN environment variable in the original PHP -; CGI. The below defaults are based on a server without much resources. Don't -; forget to tweak pm.* to fit your needs. -; Note: Used when pm is set to 'static', 'dynamic' or 'ondemand' -; Note: This value is mandatory. -pm.max_children = 5 - -; The number of child processes created on startup. -; Note: Used only when pm is set to 'dynamic' -; Default Value: min_spare_servers + (max_spare_servers - min_spare_servers) / 2 -pm.start_servers = 2 - -; The desired minimum number of idle server processes. -; Note: Used only when pm is set to 'dynamic' -; Note: Mandatory when pm is set to 'dynamic' -pm.min_spare_servers = 1 - -; The desired maximum number of idle server processes. -; Note: Used only when pm is set to 'dynamic' -; Note: Mandatory when pm is set to 'dynamic' -pm.max_spare_servers = 3 - -; The number of seconds after which an idle process will be killed. -; Note: Used only when pm is set to 'ondemand' -; Default Value: 10s -;pm.process_idle_timeout = 10s; - -; The number of requests each child process should execute before respawning. -; This can be useful to work around memory leaks in 3rd party libraries. For -; endless request processing specify '0'. Equivalent to PHP_FCGI_MAX_REQUESTS. -; Default Value: 0 -;pm.max_requests = 500 - -; The URI to view the FPM status page. If this value is not set, no URI will be -; recognized as a status page. It shows the following informations: -; pool - the name of the pool; -; process manager - static, dynamic or ondemand; -; start time - the date and time FPM has started; -; start since - number of seconds since FPM has started; -; accepted conn - the number of request accepted by the pool; -; listen queue - the number of request in the queue of pending -; connections (see backlog in listen(2)); -; max listen queue - the maximum number of requests in the queue -; of pending connections since FPM has started; -; listen queue len - the size of the socket queue of pending connections; -; idle processes - the number of idle processes; -; active processes - the number of active processes; -; total processes - the number of idle + active processes; -; max active processes - the maximum number of active processes since FPM -; has started; -; max children reached - number of times, the process limit has been reached, -; when pm tries to start more children (works only for -; pm 'dynamic' and 'ondemand'); -; Value are updated in real time. -; Example output: -; pool: www -; process manager: static -; start time: 01/Jul/2011:17:53:49 +0200 -; start since: 62636 -; accepted conn: 190460 -; listen queue: 0 -; max listen queue: 1 -; listen queue len: 42 -; idle processes: 4 -; active processes: 11 -; total processes: 15 -; max active processes: 12 -; max children reached: 0 -; -; By default the status page output is formatted as text/plain. Passing either -; 'html', 'xml' or 'json' in the query string will return the corresponding -; output syntax. Example: -; http://www.foo.bar/status -; http://www.foo.bar/status?json -; http://www.foo.bar/status?html -; http://www.foo.bar/status?xml -; -; By default the status page only outputs short status. Passing 'full' in the -; query string will also return status for each pool process. -; Example: -; http://www.foo.bar/status?full -; http://www.foo.bar/status?json&full -; http://www.foo.bar/status?html&full -; http://www.foo.bar/status?xml&full -; The Full status returns for each process: -; pid - the PID of the process; -; state - the state of the process (Idle, Running, ...); -; start time - the date and time the process has started; -; start since - the number of seconds since the process has started; -; requests - the number of requests the process has served; -; request duration - the duration in µs of the requests; -; request method - the request method (GET, POST, ...); -; request URI - the request URI with the query string; -; content length - the content length of the request (only with POST); -; user - the user (PHP_AUTH_USER) (or '-' if not set); -; script - the main script called (or '-' if not set); -; last request cpu - the %cpu the last request consumed -; it's always 0 if the process is not in Idle state -; because CPU calculation is done when the request -; processing has terminated; -; last request memory - the max amount of memory the last request consumed -; it's always 0 if the process is not in Idle state -; because memory calculation is done when the request -; processing has terminated; -; If the process is in Idle state, then informations are related to the -; last request the process has served. Otherwise informations are related to -; the current request being served. -; Example output: -; ************************ -; pid: 31330 -; state: Running -; start time: 01/Jul/2011:17:53:49 +0200 -; start since: 63087 -; requests: 12808 -; request duration: 1250261 -; request method: GET -; request URI: /test_mem.php?N=10000 -; content length: 0 -; user: - -; script: /home/fat/web/docs/php/test_mem.php -; last request cpu: 0.00 -; last request memory: 0 -; -; Note: There is a real-time FPM status monitoring sample web page available -; It's available in: ${prefix}/share/fpm/status.html -; -; Note: The value must start with a leading slash (/). The value can be -; anything, but it may not be a good idea to use the .php extension or it -; may conflict with a real PHP file. -; Default Value: not set -;pm.status_path = /status - -; The ping URI to call the monitoring page of FPM. If this value is not set, no -; URI will be recognized as a ping page. This could be used to test from outside -; that FPM is alive and responding, or to -; - create a graph of FPM availability (rrd or such); -; - remove a server from a group if it is not responding (load balancing); -; - trigger alerts for the operating team (24/7). -; Note: The value must start with a leading slash (/). The value can be -; anything, but it may not be a good idea to use the .php extension or it -; may conflict with a real PHP file. -; Default Value: not set -;ping.path = /ping - -; This directive may be used to customize the response of a ping request. The -; response is formatted as text/plain with a 200 response code. -; Default Value: pong -;ping.response = pong - -; The access log file -; Default: not set -;access.log = log/$pool.access.log - -; The access log format. -; The following syntax is allowed -; %%: the '%' character -; %C: %CPU used by the request -; it can accept the following format: -; - %{user}C for user CPU only -; - %{system}C for system CPU only -; - %{total}C for user + system CPU (default) -; %d: time taken to serve the request -; it can accept the following format: -; - %{seconds}d (default) -; - %{miliseconds}d -; - %{mili}d -; - %{microseconds}d -; - %{micro}d -; %e: an environment variable (same as $_ENV or $_SERVER) -; it must be associated with embraces to specify the name of the env -; variable. Some exemples: -; - server specifics like: %{REQUEST_METHOD}e or %{SERVER_PROTOCOL}e -; - HTTP headers like: %{HTTP_HOST}e or %{HTTP_USER_AGENT}e -; %f: script filename -; %l: content-length of the request (for POST request only) -; %m: request method -; %M: peak of memory allocated by PHP -; it can accept the following format: -; - %{bytes}M (default) -; - %{kilobytes}M -; - %{kilo}M -; - %{megabytes}M -; - %{mega}M -; %n: pool name -; %o: output header -; it must be associated with embraces to specify the name of the header: -; - %{Content-Type}o -; - %{X-Powered-By}o -; - %{Transfert-Encoding}o -; - .... -; %p: PID of the child that serviced the request -; %P: PID of the parent of the child that serviced the request -; %q: the query string -; %Q: the '?' character if query string exists -; %r: the request URI (without the query string, see %q and %Q) -; %R: remote IP address -; %s: status (response code) -; %t: server time the request was received -; it can accept a strftime(3) format: -; %d/%b/%Y:%H:%M:%S %z (default) -; %T: time the log has been written (the request has finished) -; it can accept a strftime(3) format: -; %d/%b/%Y:%H:%M:%S %z (default) -; %u: remote user -; -; Default: "%R - %u %t \"%m %r\" %s" -;access.format = "%R - %u %t \"%m %r%Q%q\" %s %f %{mili}d %{kilo}M %C%%" - -; The log file for slow requests -; Default Value: not set -; Note: slowlog is mandatory if request_slowlog_timeout is set -;slowlog = log/$pool.log.slow - -; The timeout for serving a single request after which a PHP backtrace will be -; dumped to the 'slowlog' file. A value of '0s' means 'off'. -; Available units: s(econds)(default), m(inutes), h(ours), or d(ays) -; Default Value: 0 -;request_slowlog_timeout = 0 - -; The timeout for serving a single request after which the worker process will -; be killed. This option should be used when the 'max_execution_time' ini option -; does not stop script execution for some reason. A value of '0' means 'off'. -; Available units: s(econds)(default), m(inutes), h(ours), or d(ays) -; Default Value: 0 -;request_terminate_timeout = 0 - -; Set open file descriptor rlimit. -; Default Value: system defined value -;rlimit_files = 1024 - -; Set max core size rlimit. -; Possible Values: 'unlimited' or an integer greater or equal to 0 -; Default Value: system defined value -;rlimit_core = 0 - -; Chroot to this directory at the start. This value must be defined as an -; absolute path. When this value is not set, chroot is not used. -; Note: you can prefix with '$prefix' to chroot to the pool prefix or one -; of its subdirectories. If the pool prefix is not set, the global prefix -; will be used instead. -; Note: chrooting is a great security feature and should be used whenever -; possible. However, all PHP paths will be relative to the chroot -; (error_log, sessions.save_path, ...). -; Default Value: not set -;chroot = - -; Chdir to this directory at the start. -; Note: relative path can be used. -; Default Value: current directory or / when chroot -;chdir = @{HOME}/#{WEBDIR} - -; Redirect worker stdout and stderr into main error log. If not set, stdout and -; stderr will be redirected to /dev/null according to FastCGI specs. -; Note: on highloaded environement, this can cause some delay in the page -; process time (several ms). -; Default Value: no -;catch_workers_output = yes - -; Clear environment in FPM workers -; Prevents arbitrary environment variables from reaching FPM worker processes -; by clearing the environment in workers before env vars specified in this -; pool configuration are added. -; Setting to "no" will make all environment variables available to PHP code -; via getenv(), $_ENV and $_SERVER. -; Default Value: yes -clear_env = no - -; Limits the extensions of the main script FPM will allow to parse. This can -; prevent configuration mistakes on the web server side. You should only limit -; FPM to .php extensions to prevent malicious users to use other extensions to -; exectute php code. -; Note: set an empty value to allow all extensions. -; Default Value: .php -;security.limit_extensions = .php .php3 .php4 .php5 - -; Pass environment variables like LD_LIBRARY_PATH. All $VARIABLEs are taken from -; the current environment. -; Default Value: clean env - -; Additional php.ini defines, specific to this pool of workers. These settings -; overwrite the values previously defined in the php.ini. The directives are the -; same as the PHP SAPI: -; php_value/php_flag - you can set classic ini defines which can -; be overwritten from PHP call 'ini_set'. -; php_admin_value/php_admin_flag - these directives won't be overwritten by -; PHP call 'ini_set' -; For php_*flag, valid values are on, off, 1, 0, true, false, yes or no. - -; Defining 'extension' will load the corresponding shared extension from -; extension_dir. Defining 'disable_functions' or 'disable_classes' will not -; overwrite previously defined php.ini values, but will append the new value -; instead. - -; Note: path INI options can be relative and will be expanded with the prefix -; (pool, global or /tmp/staged/app/php) - -; Default Value: nothing is defined by default except the values in php.ini and -; specified at startup with the -d argument -;php_admin_value[sendmail_path] = /usr/sbin/sendmail -t -i -f www@my.domain.com -;php_flag[display_errors] = off -;php_admin_value[error_log] = /var/log/fpm-php.www.log -;php_admin_flag[log_errors] = on -;php_admin_value[memory_limit] = 32M - -; Include one or more files. If glob(3) exists, it is used to include a bunch of -; files from a glob(3) pattern. This directive can be used everywhere in the -; file. -; Relative path can also be used. They will be prefixed by: -; - the global prefix if it's been set (-p argument) -; - /tmp/staged/app/php otherwise -;include=@{HOME}/php/etc/fpm.d/*.conf -#{PHP_FPM_CONF_INCLUDE} diff --git a/defaults/config/php/8.0.x/php.ini b/defaults/config/php/8.0.x/php.ini deleted file mode 100644 index 1dad703d5..000000000 --- a/defaults/config/php/8.0.x/php.ini +++ /dev/null @@ -1,1924 +0,0 @@ -[PHP] - -;;;;;;;;;;;;;;;;;;; -; About php.ini ; -;;;;;;;;;;;;;;;;;;; -; PHP's initialization file, generally called php.ini, is responsible for -; configuring many of the aspects of PHP's behavior. - -; PHP attempts to find and load this configuration from a number of locations. -; The following is a summary of its search order: -; 1. SAPI module specific location. -; 2. The PHPRC environment variable. (As of PHP 5.2.0) -; 3. A number of predefined registry keys on Windows (As of PHP 5.2.0) -; 4. Current working directory (except CLI) -; 5. The web server's directory (for SAPI modules), or directory of PHP -; (otherwise in Windows) -; 6. The directory from the --with-config-file-path compile time option, or the -; Windows directory (usually C:\windows) -; See the PHPdocs for more specific information. -; http://php.net/configuration.file - -; The syntax of the file is extremely simple. Whitespace and lines -; beginning with a semicolon are silently ignored (as you probably guessed). -; Section headers (e.g. [Foo]) are also silently ignored, even though -; they might mean something in the future. - -; Directives following the section heading [PATH=/www/mysite] only -; apply to PHP files in the /www/mysite directory. Directives -; following the section heading [HOST=www.example.com] only apply to -; PHP files served from www.example.com. Directives set in these -; special sections cannot be overridden by user-defined INI files or -; at runtime. Currently, [PATH=] and [HOST=] sections only work under -; CGI/FastCGI. -; http://php.net/ini.sections - -; Directives are specified using the following syntax: -; directive = value -; Directive names are *case sensitive* - foo=bar is different from FOO=bar. -; Directives are variables used to configure PHP or PHP extensions. -; There is no name validation. If PHP can't find an expected -; directive because it is not set or is mistyped, a default value will be used. - -; The value can be a string, a number, a PHP constant (e.g. E_ALL or M_PI), one -; of the INI constants (On, Off, True, False, Yes, No and None) or an expression -; (e.g. E_ALL & ~E_NOTICE), a quoted string ("bar"), or a reference to a -; previously set variable or directive (e.g. ${foo}) - -; Expressions in the INI file are limited to bitwise operators and parentheses: -; | bitwise OR -; ^ bitwise XOR -; & bitwise AND -; ~ bitwise NOT -; ! boolean NOT - -; Boolean flags can be turned on using the values 1, On, True or Yes. -; They can be turned off using the values 0, Off, False or No. - -; An empty string can be denoted by simply not writing anything after the equal -; sign, or by using the None keyword: - -; foo = ; sets foo to an empty string -; foo = None ; sets foo to an empty string -; foo = "None" ; sets foo to the string 'None' - -; If you use constants in your value, and these constants belong to a -; dynamically loaded extension (either a PHP extension or a Zend extension), -; you may only use these constants *after* the line that loads the extension. - -;;;;;;;;;;;;;;;;;;; -; About this file ; -;;;;;;;;;;;;;;;;;;; -; PHP comes packaged with two INI files. One that is recommended to be used -; in production environments and one that is recommended to be used in -; development environments. - -; php.ini-production contains settings which hold security, performance and -; best practices at its core. But please be aware, these settings may break -; compatibility with older or less security conscience applications. We -; recommending using the production ini in production and testing environments. - -; php.ini-development is very similar to its production variant, except it is -; much more verbose when it comes to errors. We recommend using the -; development version only in development environments, as errors shown to -; application users can inadvertently leak otherwise secure information. - -; This is the php.ini-production INI file. - -;;;;;;;;;;;;;;;;;;; -; Quick Reference ; -;;;;;;;;;;;;;;;;;;; - -; The following are all the settings which are different in either the production -; or development versions of the INIs with respect to PHP's default behavior. -; Please see the actual settings later in the document for more details as to why -; we recommend these changes in PHP's behavior. - -; display_errors -; Default Value: On -; Development Value: On -; Production Value: Off - -; display_startup_errors -; Default Value: On -; Development Value: On -; Production Value: Off - -; error_reporting -; Default Value: E_ALL -; Development Value: E_ALL -; Production Value: E_ALL & ~E_DEPRECATED & ~E_STRICT - -; html_errors -; Default Value: On -; Development Value: On -; Production value: On - -; log_errors -; Default Value: Off -; Development Value: On -; Production Value: On - -; max_input_time -; Default Value: -1 (Unlimited) -; Development Value: 60 (60 seconds) -; Production Value: 60 (60 seconds) - -; output_buffering -; Default Value: Off -; Development Value: 4096 -; Production Value: 4096 - -; register_argc_argv -; Default Value: On -; Development Value: Off -; Production Value: Off - -; request_order -; Default Value: None -; Development Value: "GP" -; Production Value: "GP" - -; session.gc_divisor -; Default Value: 100 -; Development Value: 1000 -; Production Value: 1000 - -; session.sid_bits_per_character -; Default Value: 4 -; Development Value: 5 -; Production Value: 5 - -; short_open_tag -; Default Value: On -; Development Value: Off -; Production Value: Off - -; track_errors -; Default Value: Off -; Development Value: On -; Production Value: Off - -; variables_order -; Default Value: "EGPCS" -; Development Value: "GPCS" -; Production Value: "GPCS" - -; zend.exception_ignore_args -; Default Value: Off -; Development Value: Off -; Production Value: On - -; zend.exception_string_param_max_len -; Default Value: 15 -; Development Value: 15 -; Production Value: 0 - -;;;;;;;;;;;;;;;;;;;; -; php.ini Options ; -;;;;;;;;;;;;;;;;;;;; -; Name for user-defined php.ini (.htaccess) files. Default is ".user.ini" -;user_ini.filename = ".user.ini" - -; To disable this feature set this option to an empty value -;user_ini.filename = - -; TTL for user-defined php.ini files (time-to-live) in seconds. Default is 300 seconds (5 minutes) -;user_ini.cache_ttl = 300 - -;;;;;;;;;;;;;;;;;;;; -; Language Options ; -;;;;;;;;;;;;;;;;;;;; - -; Enable the PHP scripting language engine under Apache. -; http://php.net/engine -engine = On - -; This directive determines whether or not PHP will recognize code between -; tags as PHP source which should be processed as such. It is -; generally recommended that should be used and that this feature -; should be disabled, as enabling it may result in issues when generating XML -; documents, however this remains supported for backward compatibility reasons. -; Note that this directive does not control the would work. -; http://php.net/syntax-highlighting -;highlight.string = #DD0000 -;highlight.comment = #FF9900 -;highlight.keyword = #007700 -;highlight.default = #0000BB -;highlight.html = #000000 - -; If enabled, the request will be allowed to complete even if the user aborts -; the request. Consider enabling it if executing long requests, which may end up -; being interrupted by the user or a browser timing out. PHP's default behavior -; is to disable this feature. -; http://php.net/ignore-user-abort -;ignore_user_abort = On - -; Determines the size of the realpath cache to be used by PHP. This value should -; be increased on systems where PHP opens many files to reflect the quantity of -; the file operations performed. -; Note: if open_basedir is set, the cache is disabled -; http://php.net/realpath-cache-size -;realpath_cache_size = 4096k - -; Duration of time, in seconds for which to cache realpath information for a given -; file or directory. For systems with rarely changing files, consider increasing this -; value. -; http://php.net/realpath-cache-ttl -;realpath_cache_ttl = 120 - -; Enables or disables the circular reference collector. -; http://php.net/zend.enable-gc -zend.enable_gc = On - -; If enabled, scripts may be written in encodings that are incompatible with -; the scanner. CP936, Big5, CP949 and Shift_JIS are the examples of such -; encodings. To use this feature, mbstring extension must be enabled. -;zend.multibyte = Off - -; Allows to set the default encoding for the scripts. This value will be used -; unless "declare(encoding=...)" directive appears at the top of the script. -; Only affects if zend.multibyte is set. -;zend.script_encoding = - -; Allows setting the maximum string length in an argument of a stringified stack trace -; to a value between 0 and 1000000. -; This has no effect when zend.exception_ignore_args is enabled. -; Default Value: 15 -; Development Value: 15 -; Production Value: 0 -; In production, it is recommended to set this to 0 to reduce the output -; of sensitive information in stack traces. -zend.exception_string_param_max_len = 0 - -;;;;;;;;;;;;;;;;; -; Miscellaneous ; -;;;;;;;;;;;;;;;;; - -; Decides whether PHP may expose the fact that it is installed on the server -; (e.g. by adding its signature to the Web server header). It is no security -; threat in any way, but it makes it possible to determine whether you use PHP -; on your server or not. -; http://php.net/expose-php -expose_php = Off - -;;;;;;;;;;;;;;;;;;; -; Resource Limits ; -;;;;;;;;;;;;;;;;;;; - -; Maximum execution time of each script, in seconds -; http://php.net/max-execution-time -; Note: This directive is hardcoded to 0 for the CLI SAPI -max_execution_time = 30 - -; Maximum amount of time each script may spend parsing request data. It's a good -; idea to limit this time on productions servers in order to eliminate unexpectedly -; long running scripts. -; Note: This directive is hardcoded to -1 for the CLI SAPI -; Default Value: -1 (Unlimited) -; Development Value: 60 (60 seconds) -; Production Value: 60 (60 seconds) -; http://php.net/max-input-time -max_input_time = 60 - -; Maximum input variable nesting level -; http://php.net/max-input-nesting-level -;max_input_nesting_level = 64 - -; How many GET/POST/COOKIE input variables may be accepted -;max_input_vars = 1000 - -; Maximum amount of memory a script may consume -; http://php.net/memory-limit -memory_limit = 128M - -;;;;;;;;;;;;;;;;;;;;;;;;;;;;;; -; Error handling and logging ; -;;;;;;;;;;;;;;;;;;;;;;;;;;;;;; - -; This directive informs PHP of which errors, warnings and notices you would like -; it to take action for. The recommended way of setting values for this -; directive is through the use of the error level constants and bitwise -; operators. The error level constants are below here for convenience as well as -; some common settings and their meanings. -; By default, PHP is set to take action on all errors, notices and warnings EXCEPT -; those related to E_NOTICE and E_STRICT, which together cover best practices and -; recommended coding standards in PHP. For performance reasons, this is the -; recommend error reporting setting. Your production server shouldn't be wasting -; resources complaining about best practices and coding standards. That's what -; development servers and development settings are for. -; Note: The php.ini-development file has this setting as E_ALL. This -; means it pretty much reports everything which is exactly what you want during -; development and early testing. -; -; Error Level Constants: -; E_ALL - All errors and warnings (includes E_STRICT as of PHP 5.4.0) -; E_ERROR - fatal run-time errors -; E_RECOVERABLE_ERROR - almost fatal run-time errors -; E_WARNING - run-time warnings (non-fatal errors) -; E_PARSE - compile-time parse errors -; E_NOTICE - run-time notices (these are warnings which often result -; from a bug in your code, but it's possible that it was -; intentional (e.g., using an uninitialized variable and -; relying on the fact it is automatically initialized to an -; empty string) -; E_STRICT - run-time notices, enable to have PHP suggest changes -; to your code which will ensure the best interoperability -; and forward compatibility of your code -; E_CORE_ERROR - fatal errors that occur during PHP's initial startup -; E_CORE_WARNING - warnings (non-fatal errors) that occur during PHP's -; initial startup -; E_COMPILE_ERROR - fatal compile-time errors -; E_COMPILE_WARNING - compile-time warnings (non-fatal errors) -; E_USER_ERROR - user-generated error message -; E_USER_WARNING - user-generated warning message -; E_USER_NOTICE - user-generated notice message -; E_DEPRECATED - warn about code that will not work in future versions -; of PHP -; E_USER_DEPRECATED - user-generated deprecation warnings -; -; Common Values: -; E_ALL (Show all errors, warnings and notices including coding standards.) -; E_ALL & ~E_NOTICE (Show all errors, except for notices) -; E_ALL & ~E_NOTICE & ~E_STRICT (Show all errors, except for notices and coding standards warnings.) -; E_COMPILE_ERROR|E_RECOVERABLE_ERROR|E_ERROR|E_CORE_ERROR (Show only errors) -; Default Value: E_ALL -; Development Value: E_ALL -; Production Value: E_ALL & ~E_DEPRECATED & ~E_STRICT -; http://php.net/error-reporting -error_reporting = E_ALL & ~E_DEPRECATED & ~E_STRICT - -; This directive controls whether or not and where PHP will output errors, -; notices and warnings too. Error output is very useful during development, but -; it could be very dangerous in production environments. Depending on the code -; which is triggering the error, sensitive information could potentially leak -; out of your application such as database usernames and passwords or worse. -; For production environments, we recommend logging errors rather than -; sending them to STDOUT. -; Possible Values: -; Off = Do not display any errors -; stderr = Display errors to STDERR (affects only CGI/CLI binaries!) -; On or stdout = Display errors to STDOUT -; Default Value: On -; Development Value: On -; Production Value: Off -; http://php.net/display-errors -display_errors = Off - -; The display of errors which occur during PHP's startup sequence are handled -; separately from display_errors. We strongly recommend you set this to 'off' -; for production servers to avoid leaking configuration details. -; Default Value: On -; Development Value: On -; Production Value: Off -; http://php.net/display-startup-errors -display_startup_errors = Off - -; Besides displaying errors, PHP can also log errors to locations such as a -; server-specific log, STDERR, or a location specified by the error_log -; directive found below. While errors should not be displayed on productions -; servers they should still be monitored and logging is a great way to do that. -; Default Value: Off -; Development Value: On -; Production Value: On -; http://php.net/log-errors -log_errors = On - -; Set maximum length of log_errors. In error_log information about the source is -; added. The default is 1024 and 0 allows to not apply any maximum length at all. -; http://php.net/log-errors-max-len -log_errors_max_len = 1024 - -; Do not log repeated messages. Repeated errors must occur in same file on same -; line unless ignore_repeated_source is set true. -; http://php.net/ignore-repeated-errors -ignore_repeated_errors = Off - -; Ignore source of message when ignoring repeated messages. When this setting -; is On you will not log errors with repeated messages from different files or -; source lines. -; http://php.net/ignore-repeated-source -ignore_repeated_source = Off - -; If this parameter is set to Off, then memory leaks will not be shown (on -; stdout or in the log). This is only effective in a debug compile, and if -; error reporting includes E_WARNING in the allowed list -; http://php.net/report-memleaks -report_memleaks = On - -; This setting is off by default. -;report_zend_debug = 0 - -; Turn off normal error reporting and emit XML-RPC error XML -; http://php.net/xmlrpc-errors -;xmlrpc_errors = 0 - -; An XML-RPC faultCode -;xmlrpc_error_number = 0 - -; When PHP displays or logs an error, it has the capability of formatting the -; error message as HTML for easier reading. This directive controls whether -; the error message is formatted as HTML or not. -; Note: This directive is hardcoded to Off for the CLI SAPI -; Default Value: On -; Development Value: On -; Production value: On -; http://php.net/html-errors -html_errors = On - -; If html_errors is set to On *and* docref_root is not empty, then PHP -; produces clickable error messages that direct to a page describing the error -; or function causing the error in detail. -; You can download a copy of the PHP manual from http://php.net/docs -; and change docref_root to the base URL of your local copy including the -; leading '/'. You must also specify the file extension being used including -; the dot. PHP's default behavior is to leave these settings empty, in which -; case no links to documentation are generated. -; Note: Never use this feature for production boxes. -; http://php.net/docref-root -; Examples -;docref_root = "/phpmanual/" - -; http://php.net/docref-ext -;docref_ext = .html - -; String to output before an error message. PHP's default behavior is to leave -; this setting blank. -; http://php.net/error-prepend-string -; Example: -;error_prepend_string = "" - -; String to output after an error message. PHP's default behavior is to leave -; this setting blank. -; http://php.net/error-append-string -; Example: -;error_append_string = "" - -; Log errors to specified file. PHP's default behavior is to leave this value -; empty. -; http://php.net/error-log -; Example: -;error_log = php_errors.log -; Log errors to syslog (Event Log on Windows). -;error_log = syslog - -; The syslog ident is a string which is prepended to every message logged -; to syslog. Only used when error_log is set to syslog. -;syslog.ident = php - -; The syslog facility is used to specify what type of program is logging -; the message. Only used when error_log is set to syslog. -;syslog.facility = user - -; Set this to disable filtering control characters (the default). -; Some loggers only accept NVT-ASCII, others accept anything that's not -; control characters. If your logger accepts everything, then no filtering -; is needed at all. -; Allowed values are: -; ascii (all printable ASCII characters and NL) -; no-ctrl (all characters except control characters) -; all (all characters) -; raw (like "all", but messages are not split at newlines) -; http://php.net/syslog.filter -;syslog.filter = ascii - -;windows.show_crt_warning -; Default value: 0 -; Development value: 0 -; Production value: 0 - -;;;;;;;;;;;;;;;;; -; Data Handling ; -;;;;;;;;;;;;;;;;; - -; The separator used in PHP generated URLs to separate arguments. -; PHP's default setting is "&". -; http://php.net/arg-separator.output -; Example: -;arg_separator.output = "&" - -; List of separator(s) used by PHP to parse input URLs into variables. -; PHP's default setting is "&". -; NOTE: Every character in this directive is considered as separator! -; http://php.net/arg-separator.input -; Example: -;arg_separator.input = ";&" - -; This directive determines which super global arrays are registered when PHP -; starts up. G,P,C,E & S are abbreviations for the following respective super -; globals: GET, POST, COOKIE, ENV and SERVER. There is a performance penalty -; paid for the registration of these arrays and because ENV is not as commonly -; used as the others, ENV is not recommended on productions servers. You -; can still get access to the environment variables through getenv() should you -; need to. -; Default Value: "EGPCS" -; Development Value: "GPCS" -; Production Value: "GPCS"; -; http://php.net/variables-order -variables_order = "EGPCS" - -; This directive determines which super global data (G,P & C) should be -; registered into the super global array REQUEST. If so, it also determines -; the order in which that data is registered. The values for this directive -; are specified in the same manner as the variables_order directive, -; EXCEPT one. Leaving this value empty will cause PHP to use the value set -; in the variables_order directive. It does not mean it will leave the super -; globals array REQUEST empty. -; Default Value: None -; Development Value: "GP" -; Production Value: "GP" -; http://php.net/request-order -request_order = "GP" - -; This directive determines whether PHP registers $argv & $argc each time it -; runs. $argv contains an array of all the arguments passed to PHP when a script -; is invoked. $argc contains an integer representing the number of arguments -; that were passed when the script was invoked. These arrays are extremely -; useful when running scripts from the command line. When this directive is -; enabled, registering these variables consumes CPU cycles and memory each time -; a script is executed. For performance reasons, this feature should be disabled -; on production servers. -; Note: This directive is hardcoded to On for the CLI SAPI -; Default Value: On -; Development Value: Off -; Production Value: Off -; http://php.net/register-argc-argv -register_argc_argv = Off - -; When enabled, the ENV, REQUEST and SERVER variables are created when they're -; first used (Just In Time) instead of when the script starts. If these -; variables are not used within a script, having this directive on will result -; in a performance gain. The PHP directive register_argc_argv must be disabled -; for this directive to have any effect. -; http://php.net/auto-globals-jit -auto_globals_jit = On - -; Whether PHP will read the POST data. -; This option is enabled by default. -; Most likely, you won't want to disable this option globally. It causes $_POST -; and $_FILES to always be empty; the only way you will be able to read the -; POST data will be through the php://input stream wrapper. This can be useful -; to proxy requests or to process the POST data in a memory efficient fashion. -; http://php.net/enable-post-data-reading -;enable_post_data_reading = Off - -; Maximum size of POST data that PHP will accept. -; Its value may be 0 to disable the limit. It is ignored if POST data reading -; is disabled through enable_post_data_reading. -; http://php.net/post-max-size -post_max_size = 8M - -; Automatically add files before PHP document. -; http://php.net/auto-prepend-file -auto_prepend_file = - -; Automatically add files after PHP document. -; http://php.net/auto-append-file -auto_append_file = - -; By default, PHP will output a media type using the Content-Type header. To -; disable this, simply set it to be empty. -; -; PHP's built-in default media type is set to text/html. -; http://php.net/default-mimetype -default_mimetype = "text/html" - -; PHP's default character set is set to UTF-8. -; http://php.net/default-charset -default_charset = "UTF-8" - -; PHP internal character encoding is set to empty. -; If empty, default_charset is used. -; http://php.net/internal-encoding -;internal_encoding = - -; PHP input character encoding is set to empty. -; If empty, default_charset is used. -; http://php.net/input-encoding -;input_encoding = - -; PHP output character encoding is set to empty. -; If empty, default_charset is used. -; See also output_buffer. -; http://php.net/output-encoding -;output_encoding = - -;;;;;;;;;;;;;;;;;;;;;;;;; -; Paths and Directories ; -;;;;;;;;;;;;;;;;;;;;;;;;; - -; UNIX: "/path1:/path2" -include_path = "../lib/php:@{HOME}/#{LIBDIR}" -; -; Windows: "\path1;\path2" -;include_path = ".;c:\php\includes" -; -; PHP's default setting for include_path is ".;/path/to/php/pear" -; http://php.net/include-path - -; The root of the PHP pages, used only if nonempty. -; if PHP was not compiled with FORCE_REDIRECT, you SHOULD set doc_root -; if you are running php as a CGI under any web server (other than IIS) -; see documentation for security issues. The alternate is to use the -; cgi.force_redirect configuration below -; http://php.net/doc-root -doc_root = - -; The directory under which PHP opens the script using /~username used only -; if nonempty. -; http://php.net/user-dir -user_dir = - -; Directory in which the loadable extensions (modules) reside. -; http://php.net/extension-dir -; -; On windows: -;extension_dir = "ext" -extension_dir = "@{HOME}/php/lib/php/extensions/no-debug-non-zts-20200930" - -; Directory where the temporary files should be placed. -; Defaults to the system default (see sys_get_temp_dir) -sys_temp_dir = "@{TMPDIR}" - -; Whether or not to enable the dl() function. The dl() function does NOT work -; properly in multithreaded servers, such as IIS or Zeus, and is automatically -; disabled on them. -; http://php.net/enable-dl -enable_dl = Off - -; cgi.force_redirect is necessary to provide security running PHP as a CGI under -; most web servers. Left undefined, PHP turns this on by default. You can -; turn it off here AT YOUR OWN RISK -; **You CAN safely turn this off for IIS, in fact, you MUST.** -; http://php.net/cgi.force-redirect -;cgi.force_redirect = 1 - -; if cgi.nph is enabled it will force cgi to always sent Status: 200 with -; every request. PHP's default behavior is to disable this feature. -;cgi.nph = 1 - -; if cgi.force_redirect is turned on, and you are not running under Apache or Netscape -; (iPlanet) web servers, you MAY need to set an environment variable name that PHP -; will look for to know it is OK to continue execution. Setting this variable MAY -; cause security issues, KNOW WHAT YOU ARE DOING FIRST. -; http://php.net/cgi.redirect-status-env -;cgi.redirect_status_env = - -; cgi.fix_pathinfo provides *real* PATH_INFO/PATH_TRANSLATED support for CGI. PHP's -; previous behaviour was to set PATH_TRANSLATED to SCRIPT_FILENAME, and to not grok -; what PATH_INFO is. For more information on PATH_INFO, see the cgi specs. Setting -; this to 1 will cause PHP CGI to fix its paths to conform to the spec. A setting -; of zero causes PHP to behave as before. Default is 1. You should fix your scripts -; to use SCRIPT_FILENAME rather than PATH_TRANSLATED. -; http://php.net/cgi.fix-pathinfo -;cgi.fix_pathinfo=1 - -; if cgi.discard_path is enabled, the PHP CGI binary can safely be placed outside -; of the web tree and people will not be able to circumvent .htaccess security. -;cgi.discard_path=1 - -; FastCGI under IIS supports the ability to impersonate -; security tokens of the calling client. This allows IIS to define the -; security context that the request runs under. mod_fastcgi under Apache -; does not currently support this feature (03/17/2002) -; Set to 1 if running under IIS. Default is zero. -; http://php.net/fastcgi.impersonate -;fastcgi.impersonate = 1 - -; Disable logging through FastCGI connection. PHP's default behavior is to enable -; this feature. -;fastcgi.logging = 0 - -; cgi.rfc2616_headers configuration option tells PHP what type of headers to -; use when sending HTTP response code. If set to 0, PHP sends Status: header that -; is supported by Apache. When this option is set to 1, PHP will send -; RFC2616 compliant header. -; Default is zero. -; http://php.net/cgi.rfc2616-headers -;cgi.rfc2616_headers = 0 - -; cgi.check_shebang_line controls whether CGI PHP checks for line starting with #! -; (shebang) at the top of the running script. This line might be needed if the -; script support running both as stand-alone script and via PHP CGI<. PHP in CGI -; mode skips this line and ignores its content if this directive is turned on. -; http://php.net/cgi.check-shebang-line -;cgi.check_shebang_line=1 - -;;;;;;;;;;;;;;;; -; File Uploads ; -;;;;;;;;;;;;;;;; - -; Whether to allow HTTP file uploads. -; http://php.net/file-uploads -file_uploads = On - -; Temporary directory for HTTP uploaded files (will use system default if not -; specified). -; http://php.net/upload-tmp-dir -upload_tmp_dir = "@{TMPDIR}" - -; Maximum allowed size for uploaded files. -; http://php.net/upload-max-filesize -upload_max_filesize = 2M - -; Maximum number of files that can be uploaded via a single request -max_file_uploads = 20 - -;;;;;;;;;;;;;;;;;; -; Fopen wrappers ; -;;;;;;;;;;;;;;;;;; - -; Whether to allow the treatment of URLs (like http:// or ftp://) as files. -; http://php.net/allow-url-fopen -allow_url_fopen = On - -; Whether to allow include/require to open URLs (like http:// or ftp://) as files. -; http://php.net/allow-url-include -allow_url_include = Off - -; Define the anonymous ftp password (your email address). PHP's default setting -; for this is empty. -; http://php.net/from -;from="john@doe.com" - -; Define the User-Agent string. PHP's default setting for this is empty. -; http://php.net/user-agent -;user_agent="PHP" - -; Default timeout for socket based streams (seconds) -; http://php.net/default-socket-timeout -default_socket_timeout = 60 - -; If your scripts have to deal with files from Macintosh systems, -; or you are running on a Mac and need to deal with files from -; unix or win32 systems, setting this flag will cause PHP to -; automatically detect the EOL character in those files so that -; fgets() and file() will work regardless of the source of the file. -; http://php.net/auto-detect-line-endings -;auto_detect_line_endings = Off - -;;;;;;;;;;;;;;;;;;;;;; -; Dynamic Extensions ; -;;;;;;;;;;;;;;;;;;;;;; - -; If you wish to have an extension loaded automatically, use the following -; syntax: -; -; extension=modulename -; -; For example: -; -; extension=mysqli -; -; When the extension library to load is not located in the default extension -; directory, You may specify an absolute path to the library file: -; -; extension=/path/to/extension/mysqli.so -; -; Note : The syntax used in previous PHP versions ('extension=.so' and -; 'extension='php_.dll') is supported for legacy reasons and may be -; deprecated in a future PHP major version. So, when it is possible, please -; move to the new ('extension=) syntax. -; -; Notes for Windows environments : -; -; - Many DLL files are located in the extensions/ (PHP 4) or ext/ (PHP 5+) -; extension folders as well as the separate PECL DLL download (PHP 5+). -; Be sure to appropriately set the extension_dir directive. -; -#{PHP_EXTENSIONS} -#{ZEND_EXTENSIONS} - -;;;;;;;;;;;;;;;;;;; -; Module Settings ; -;;;;;;;;;;;;;;;;;;; - -[CLI Server] -; Whether the CLI web server uses ANSI color coding in its terminal output. -cli_server.color = On - -[Date] -; Defines the default timezone used by the date functions -; http://php.net/date.timezone -date.timezone = UTC - -; http://php.net/date.default-latitude -;date.default_latitude = 31.7667 - -; http://php.net/date.default-longitude -;date.default_longitude = 35.2333 - -; http://php.net/date.sunrise-zenith -;date.sunrise_zenith = 90.833333 - -; http://php.net/date.sunset-zenith -;date.sunset_zenith = 90.833333 - -[filter] -; http://php.net/filter.default -;filter.default = unsafe_raw - -; http://php.net/filter.default-flags -;filter.default_flags = - -[iconv] -; Use of this INI entry is deprecated, use global input_encoding instead. -; If empty, default_charset or input_encoding or iconv.input_encoding is used. -; The precedence is: default_charset < input_encoding < iconv.input_encoding -;iconv.input_encoding = - -; Use of this INI entry is deprecated, use global internal_encoding instead. -; If empty, default_charset or internal_encoding or iconv.internal_encoding is used. -; The precedence is: default_charset < internal_encoding < iconv.internal_encoding -;iconv.internal_encoding = - -; Use of this INI entry is deprecated, use global output_encoding instead. -; If empty, default_charset or output_encoding or iconv.output_encoding is used. -; The precedence is: default_charset < output_encoding < iconv.output_encoding -; To use an output encoding conversion, iconv's output handler must be set -; otherwise output encoding conversion cannot be performed. -;iconv.output_encoding = - -[imap] -; rsh/ssh logins are disabled by default. Use this INI entry if you want to -; enable them. Note that the IMAP library does not filter mailbox names before -; passing them to rsh/ssh command, thus passing untrusted data to this function -; with rsh/ssh enabled is insecure. -;imap.enable_insecure_rsh=0 - -[intl] -;intl.default_locale = -; This directive allows you to produce PHP errors when some error -; happens within intl functions. The value is the level of the error produced. -; Default is 0, which does not produce any errors. -;intl.error_level = E_WARNING -;intl.use_exceptions = 0 - -[sqlite3] -; Directory pointing to SQLite3 extensions -; http://php.net/sqlite3.extension-dir -;sqlite3.extension_dir = - -; SQLite defensive mode flag (only available from SQLite 3.26+) -; When the defensive flag is enabled, language features that allow ordinary -; SQL to deliberately corrupt the database file are disabled. This forbids -; writing directly to the schema, shadow tables (eg. FTS data tables), or -; the sqlite_dbpage virtual table. -; https://www.sqlite.org/c3ref/c_dbconfig_defensive.html -; (for older SQLite versions, this flag has no use) -;sqlite3.defensive = 1 - -[Pcre] -; PCRE library backtracking limit. -; http://php.net/pcre.backtrack-limit -;pcre.backtrack_limit=100000 - -; PCRE library recursion limit. -; Please note that if you set this value to a high number you may consume all -; the available process stack and eventually crash PHP (due to reaching the -; stack size limit imposed by the Operating System). -; http://php.net/pcre.recursion-limit -;pcre.recursion_limit=100000 - -; Enables or disables JIT compilation of patterns. This requires the PCRE -; library to be compiled with JIT support. -;pcre.jit=1 - -[Pdo] -; Whether to pool ODBC connections. Can be one of "strict", "relaxed" or "off" -; http://php.net/pdo-odbc.connection-pooling -;pdo_odbc.connection_pooling=strict - -[Pdo_mysql] -; Default socket name for local MySQL connects. If empty, uses the built-in -; MySQL defaults. -pdo_mysql.default_socket= - -[Phar] -; http://php.net/phar.readonly -;phar.readonly = On - -; http://php.net/phar.require-hash -;phar.require_hash = On - -;phar.cache_list = - -[mail function] -; For Win32 only. -; http://php.net/smtp -SMTP = localhost -; http://php.net/smtp-port -smtp_port = 25 - -; For Win32 only. -; http://php.net/sendmail-from -;sendmail_from = me@example.com - -; For Unix only. You may supply arguments as well (default: "sendmail -t -i"). -; http://php.net/sendmail-path -;sendmail_path = - -; Force the addition of the specified parameters to be passed as extra parameters -; to the sendmail binary. These parameters will always replace the value of -; the 5th parameter to mail(). -;mail.force_extra_parameters = - -; Add X-PHP-Originating-Script: that will include uid of the script followed by the filename -mail.add_x_header = Off - -; The path to a log file that will log all mail() calls. Log entries include -; the full path of the script, line number, To address and headers. -;mail.log = -; Log mail to syslog (Event Log on Windows). -;mail.log = syslog - -[ODBC] -; http://php.net/odbc.default-db -;odbc.default_db = Not yet implemented - -; http://php.net/odbc.default-user -;odbc.default_user = Not yet implemented - -; http://php.net/odbc.default-pw -;odbc.default_pw = Not yet implemented - -; Controls the ODBC cursor model. -; Default: SQL_CURSOR_STATIC (default). -;odbc.default_cursortype - -; Allow or prevent persistent links. -; http://php.net/odbc.allow-persistent -odbc.allow_persistent = On - -; Check that a connection is still valid before reuse. -; http://php.net/odbc.check-persistent -odbc.check_persistent = On - -; Maximum number of persistent links. -1 means no limit. -; http://php.net/odbc.max-persistent -odbc.max_persistent = -1 - -; Maximum number of links (persistent + non-persistent). -1 means no limit. -; http://php.net/odbc.max-links -odbc.max_links = -1 - -; Handling of LONG fields. Returns number of bytes to variables. 0 means -; passthru. -; http://php.net/odbc.defaultlrl -odbc.defaultlrl = 4096 - -; Handling of binary data. 0 means passthru, 1 return as is, 2 convert to char. -; See the documentation on odbc_binmode and odbc_longreadlen for an explanation -; of odbc.defaultlrl and odbc.defaultbinmode -; http://php.net/odbc.defaultbinmode -odbc.defaultbinmode = 1 - -[Interbase] -; Allow or prevent persistent links. -ibase.allow_persistent = 1 -; Maximum number of persistent links. -1 means no limit. -ibase.max_persistent = -1 -; Maximum number of links (persistent + non-persistent). -1 means no limit. -ibase.max_links = -1 -; Default database name for ibase_connect(). -;ibase.default_db = -; Default username for ibase_connect(). -;ibase.default_user = -; Default password for ibase_connect(). -;ibase.default_password = -; Default charset for ibase_connect(). -;ibase.default_charset = -; Default timestamp format. -ibase.timestampformat = "%Y-%m-%d %H:%M:%S" -; Default date format. -ibase.dateformat = "%Y-%m-%d" -; Default time format. -ibase.timeformat = "%H:%M:%S" - -[MySQLi] - -; Maximum number of persistent links. -1 means no limit. -; http://php.net/mysqli.max-persistent -mysqli.max_persistent = -1 - -; Allow accessing, from PHP's perspective, local files with LOAD DATA statements -; http://php.net/mysqli.allow_local_infile -;mysqli.allow_local_infile = On - -; Allow or prevent persistent links. -; http://php.net/mysqli.allow-persistent -mysqli.allow_persistent = On - -; Maximum number of links. -1 means no limit. -; http://php.net/mysqli.max-links -mysqli.max_links = -1 - -; Default port number for mysqli_connect(). If unset, mysqli_connect() will use -; the $MYSQL_TCP_PORT or the mysql-tcp entry in /etc/services or the -; compile-time value defined MYSQL_PORT (in that order). Win32 will only look -; at MYSQL_PORT. -; http://php.net/mysqli.default-port -mysqli.default_port = 3306 - -; Default socket name for local MySQL connects. If empty, uses the built-in -; MySQL defaults. -; http://php.net/mysqli.default-socket -mysqli.default_socket = - -; Default host for mysqli_connect() (doesn't apply in safe mode). -; http://php.net/mysqli.default-host -mysqli.default_host = - -; Default user for mysqli_connect() (doesn't apply in safe mode). -; http://php.net/mysqli.default-user -mysqli.default_user = - -; Default password for mysqli_connect() (doesn't apply in safe mode). -; Note that this is generally a *bad* idea to store passwords in this file. -; *Any* user with PHP access can run 'echo get_cfg_var("mysqli.default_pw") -; and reveal this password! And of course, any users with read access to this -; file will be able to reveal the password as well. -; http://php.net/mysqli.default-pw -mysqli.default_pw = - -; Allow or prevent reconnect -mysqli.reconnect = Off - -[mysqlnd] -; Enable / Disable collection of general statistics by mysqlnd which can be -; used to tune and monitor MySQL operations. -mysqlnd.collect_statistics = On - -; Enable / Disable collection of memory usage statistics by mysqlnd which can be -; used to tune and monitor MySQL operations. -mysqlnd.collect_memory_statistics = Off - -; Records communication from all extensions using mysqlnd to the specified log -; file. -; http://php.net/mysqlnd.debug -;mysqlnd.debug = - -; Defines which queries will be logged. -;mysqlnd.log_mask = 0 - -; Default size of the mysqlnd memory pool, which is used by result sets. -;mysqlnd.mempool_default_size = 16000 - -; Size of a pre-allocated buffer used when sending commands to MySQL in bytes. -;mysqlnd.net_cmd_buffer_size = 2048 - -; Size of a pre-allocated buffer used for reading data sent by the server in -; bytes. -;mysqlnd.net_read_buffer_size = 32768 - -; Timeout for network requests in seconds. -;mysqlnd.net_read_timeout = 31536000 - -; SHA-256 Authentication Plugin related. File with the MySQL server public RSA -; key. -;mysqlnd.sha256_server_public_key = - -[OCI8] - -; Connection: Enables privileged connections using external -; credentials (OCI_SYSOPER, OCI_SYSDBA) -; http://php.net/oci8.privileged-connect -;oci8.privileged_connect = Off - -; Connection: The maximum number of persistent OCI8 connections per -; process. Using -1 means no limit. -; http://php.net/oci8.max-persistent -;oci8.max_persistent = -1 - -; Connection: The maximum number of seconds a process is allowed to -; maintain an idle persistent connection. Using -1 means idle -; persistent connections will be maintained forever. -; http://php.net/oci8.persistent-timeout -;oci8.persistent_timeout = -1 - -; Connection: The number of seconds that must pass before issuing a -; ping during oci_pconnect() to check the connection validity. When -; set to 0, each oci_pconnect() will cause a ping. Using -1 disables -; pings completely. -; http://php.net/oci8.ping-interval -;oci8.ping_interval = 60 - -; Connection: Set this to a user chosen connection class to be used -; for all pooled server requests with Oracle 11g Database Resident -; Connection Pooling (DRCP). To use DRCP, this value should be set to -; the same string for all web servers running the same application, -; the database pool must be configured, and the connection string must -; specify to use a pooled server. -;oci8.connection_class = - -; High Availability: Using On lets PHP receive Fast Application -; Notification (FAN) events generated when a database node fails. The -; database must also be configured to post FAN events. -;oci8.events = Off - -; Tuning: This option enables statement caching, and specifies how -; many statements to cache. Using 0 disables statement caching. -; http://php.net/oci8.statement-cache-size -;oci8.statement_cache_size = 20 - -; Tuning: Enables statement prefetching and sets the default number of -; rows that will be fetched automatically after statement execution. -; http://php.net/oci8.default-prefetch -;oci8.default_prefetch = 100 - -; Compatibility. Using On means oci_close() will not close -; oci_connect() and oci_new_connect() connections. -; http://php.net/oci8.old-oci-close-semantics -;oci8.old_oci_close_semantics = Off - -[PostgreSQL] -; Allow or prevent persistent links. -; http://php.net/pgsql.allow-persistent -pgsql.allow_persistent = On - -; Detect broken persistent links always with pg_pconnect(). -; Auto reset feature requires a little overheads. -; http://php.net/pgsql.auto-reset-persistent -pgsql.auto_reset_persistent = Off - -; Maximum number of persistent links. -1 means no limit. -; http://php.net/pgsql.max-persistent -pgsql.max_persistent = -1 - -; Maximum number of links (persistent+non persistent). -1 means no limit. -; http://php.net/pgsql.max-links -pgsql.max_links = -1 - -; Ignore PostgreSQL backends Notice message or not. -; Notice message logging require a little overheads. -; http://php.net/pgsql.ignore-notice -pgsql.ignore_notice = 0 - -; Log PostgreSQL backends Notice message or not. -; Unless pgsql.ignore_notice=0, module cannot log notice message. -; http://php.net/pgsql.log-notice -pgsql.log_notice = 0 - -[bcmath] -; Number of decimal digits for all bcmath functions. -; http://php.net/bcmath.scale -bcmath.scale = 0 - -[browscap] -; http://php.net/browscap -;browscap = extra/browscap.ini - -[Session] -; Handler used to store/retrieve data. -; http://php.net/session.save-handler -session.save_handler = files - -; Argument passed to save_handler. In the case of files, this is the path -; where data files are stored. Note: Windows users have to change this -; variable in order to use PHP's session functions. -; -; The path can be defined as: -; -; session.save_path = "N;/path" -; -; where N is an integer. Instead of storing all the session files in -; /path, what this will do is use subdirectories N-levels deep, and -; store the session data in those directories. This is useful if -; your OS has problems with many files in one directory, and is -; a more efficient layout for servers that handle many sessions. -; -; NOTE 1: PHP will not create this directory structure automatically. -; You can use the script in the ext/session dir for that purpose. -; NOTE 2: See the section on garbage collection below if you choose to -; use subdirectories for session storage -; -; The file storage module creates files using mode 600 by default. -; You can change that by using -; -; session.save_path = "N;MODE;/path" -; -; where MODE is the octal representation of the mode. Note that this -; does not overwrite the process's umask. -; http://php.net/session.save-path -session.save_path = "@{TMPDIR}" - -; Whether to use strict session mode. -; Strict session mode does not accept an uninitialized session ID, and -; regenerates the session ID if the browser sends an uninitialized session ID. -; Strict mode protects applications from session fixation via a session adoption -; vulnerability. It is disabled by default for maximum compatibility, but -; enabling it is encouraged. -; https://wiki.php.net/rfc/strict_sessions -session.use_strict_mode = 0 - -; Whether to use cookies. -; http://php.net/session.use-cookies -session.use_cookies = 1 - -; http://php.net/session.cookie-secure -;session.cookie_secure = - -; This option forces PHP to fetch and use a cookie for storing and maintaining -; the session id. We encourage this operation as it's very helpful in combating -; session hijacking when not specifying and managing your own session id. It is -; not the be-all and end-all of session hijacking defense, but it's a good start. -; http://php.net/session.use-only-cookies -session.use_only_cookies = 1 - -; Name of the session (used as cookie name). -; http://php.net/session.name -session.name = JSESSIONID - -; Initialize session on request startup. -; http://php.net/session.auto-start -session.auto_start = 0 - -; Lifetime in seconds of cookie or, if 0, until browser is restarted. -; http://php.net/session.cookie-lifetime -session.cookie_lifetime = 0 - -; The path for which the cookie is valid. -; http://php.net/session.cookie-path -session.cookie_path = / - -; The domain for which the cookie is valid. -; http://php.net/session.cookie-domain -session.cookie_domain = - -; Whether or not to add the httpOnly flag to the cookie, which makes it -; inaccessible to browser scripting languages such as JavaScript. -; http://php.net/session.cookie-httponly -session.cookie_httponly = On - -; Add SameSite attribute to cookie to help mitigate Cross-Site Request Forgery (CSRF/XSRF) -; Current valid values are "Strict", "Lax" or "None". When using "None", -; make sure to include the quotes, as `none` is interpreted like `false` in ini files. -; https://tools.ietf.org/html/draft-west-first-party-cookies-07 -session.cookie_samesite = - -; Handler used to serialize data. php is the standard serializer of PHP. -; http://php.net/session.serialize-handler -session.serialize_handler = php - -; Defines the probability that the 'garbage collection' process is started on every -; session initialization. The probability is calculated by using gc_probability/gc_divisor, -; e.g. 1/100 means there is a 1% chance that the GC process starts on each request. -; Default Value: 1 -; Development Value: 1 -; Production Value: 1 -; http://php.net/session.gc-probability -session.gc_probability = 1 - -; Defines the probability that the 'garbage collection' process is started on every -; session initialization. The probability is calculated by using gc_probability/gc_divisor, -; e.g. 1/100 means there is a 1% chance that the GC process starts on each request. -; For high volume production servers, using a value of 1000 is a more efficient approach. -; Default Value: 100 -; Development Value: 1000 -; Production Value: 1000 -; http://php.net/session.gc-divisor -session.gc_divisor = 1000 - -; After this number of seconds, stored data will be seen as 'garbage' and -; cleaned up by the garbage collection process. -; http://php.net/session.gc-maxlifetime -session.gc_maxlifetime = 1440 - -; NOTE: If you are using the subdirectory option for storing session files -; (see session.save_path above), then garbage collection does *not* -; happen automatically. You will need to do your own garbage -; collection through a shell script, cron entry, or some other method. -; For example, the following script is the equivalent of setting -; session.gc_maxlifetime to 1440 (1440 seconds = 24 minutes): -; find /path/to/sessions -cmin +24 -type f | xargs rm - -; Check HTTP Referer to invalidate externally stored URLs containing ids. -; HTTP_REFERER has to contain this substring for the session to be -; considered as valid. -; http://php.net/session.referer-check -session.referer_check = - -; Set to {nocache,private,public,} to determine HTTP caching aspects -; or leave this empty to avoid sending anti-caching headers. -; http://php.net/session.cache-limiter -session.cache_limiter = nocache - -; Document expires after n minutes. -; http://php.net/session.cache-expire -session.cache_expire = 180 - -; trans sid support is disabled by default. -; Use of trans sid may risk your users' security. -; Use this option with caution. -; - User may send URL contains active session ID -; to other person via. email/irc/etc. -; - URL that contains active session ID may be stored -; in publicly accessible computer. -; - User may access your site with the same session ID -; always using URL stored in browser's history or bookmarks. -; http://php.net/session.use-trans-sid -session.use_trans_sid = 0 - -; Set session ID character length. This value could be between 22 to 256. -; Shorter length than default is supported only for compatibility reason. -; Users should use 32 or more chars. -; http://php.net/session.sid-length -; Default Value: 32 -; Development Value: 26 -; Production Value: 26 -session.sid_length = 26 - -; The URL rewriter will look for URLs in a defined set of HTML tags. -;
is special; if you include them here, the rewriter will -; add a hidden field with the info which is otherwise appended -; to URLs. tag's action attribute URL will not be modified -; unless it is specified. -; Note that all valid entries require a "=", even if no value follows. -; Default Value: "a=href,area=href,frame=src,form=" -; Development Value: "a=href,area=href,frame=src,form=" -; Production Value: "a=href,area=href,frame=src,form=" -; http://php.net/url-rewriter.tags -session.trans_sid_tags = "a=href,area=href,frame=src,form=" - -; URL rewriter does not rewrite absolute URLs by default. -; To enable rewrites for absolute paths, target hosts must be specified -; at RUNTIME. i.e. use ini_set() -; tags is special. PHP will check action attribute's URL regardless -; of session.trans_sid_tags setting. -; If no host is defined, HTTP_HOST will be used for allowed host. -; Example value: php.net,www.php.net,wiki.php.net -; Use "," for multiple hosts. No spaces are allowed. -; Default Value: "" -; Development Value: "" -; Production Value: "" -;session.trans_sid_hosts="" - -; Define how many bits are stored in each character when converting -; the binary hash data to something readable. -; Possible values: -; 4 (4 bits: 0-9, a-f) -; 5 (5 bits: 0-9, a-v) -; 6 (6 bits: 0-9, a-z, A-Z, "-", ",") -; Default Value: 4 -; Development Value: 5 -; Production Value: 5 -; http://php.net/session.hash-bits-per-character -session.sid_bits_per_character = 5 - -; Enable upload progress tracking in $_SESSION -; Default Value: On -; Development Value: On -; Production Value: On -; http://php.net/session.upload-progress.enabled -;session.upload_progress.enabled = On - -; Cleanup the progress information as soon as all POST data has been read -; (i.e. upload completed). -; Default Value: On -; Development Value: On -; Production Value: On -; http://php.net/session.upload-progress.cleanup -;session.upload_progress.cleanup = On - -; A prefix used for the upload progress key in $_SESSION -; Default Value: "upload_progress_" -; Development Value: "upload_progress_" -; Production Value: "upload_progress_" -; http://php.net/session.upload-progress.prefix -;session.upload_progress.prefix = "upload_progress_" - -; The index name (concatenated with the prefix) in $_SESSION -; containing the upload progress information -; Default Value: "PHP_SESSION_UPLOAD_PROGRESS" -; Development Value: "PHP_SESSION_UPLOAD_PROGRESS" -; Production Value: "PHP_SESSION_UPLOAD_PROGRESS" -; http://php.net/session.upload-progress.name -;session.upload_progress.name = "PHP_SESSION_UPLOAD_PROGRESS" - -; How frequently the upload progress should be updated. -; Given either in percentages (per-file), or in bytes -; Default Value: "1%" -; Development Value: "1%" -; Production Value: "1%" -; http://php.net/session.upload-progress.freq -;session.upload_progress.freq = "1%" - -; The minimum delay between updates, in seconds -; Default Value: 1 -; Development Value: 1 -; Production Value: 1 -; http://php.net/session.upload-progress.min-freq -;session.upload_progress.min_freq = "1" - -; Only write session data when session data is changed. Enabled by default. -; http://php.net/session.lazy-write -;session.lazy_write = On - -[Assertion] -; Switch whether to compile assertions at all (to have no overhead at run-time) -; -1: Do not compile at all -; 0: Jump over assertion at run-time -; 1: Execute assertions -; Changing from or to a negative value is only possible in php.ini! (For turning assertions on and off at run-time, see assert.active, when zend.assertions = 1) -; Default Value: 1 -; Development Value: 1 -; Production Value: -1 -; http://php.net/zend.assertions -zend.assertions = -1 - -; Assert(expr); active by default. -; http://php.net/assert.active -;assert.active = On - -; Throw an AssertionError on failed assertions -; http://php.net/assert.exception -;assert.exception = On - -; Issue a PHP warning for each failed assertion. (Overridden by assert.exception if active) -; http://php.net/assert.warning -;assert.warning = On - -; Don't bail out by default. -; http://php.net/assert.bail -;assert.bail = Off - -; User-function to be called if an assertion fails. -; http://php.net/assert.callback -;assert.callback = 0 - -[COM] -; path to a file containing GUIDs, IIDs or filenames of files with TypeLibs -; http://php.net/com.typelib-file -;com.typelib_file = - -; allow Distributed-COM calls -; http://php.net/com.allow-dcom -;com.allow_dcom = true - -; autoregister constants of a component's typlib on com_load() -; http://php.net/com.autoregister-typelib -;com.autoregister_typelib = true - -; register constants casesensitive -; http://php.net/com.autoregister-casesensitive -;com.autoregister_casesensitive = false - -; show warnings on duplicate constant registrations -; http://php.net/com.autoregister-verbose -;com.autoregister_verbose = true - -; The default character set code-page to use when passing strings to and from COM objects. -; Default: system ANSI code page -;com.code_page= - -; The version of the .NET framework to use. The value of the setting are the first three parts -; of the framework's version number, separated by dots, and prefixed with "v", e.g. "v4.0.30319". -;com.dotnet_version= - -[mbstring] -; language for internal character representation. -; This affects mb_send_mail() and mbstring.detect_order. -; http://php.net/mbstring.language -;mbstring.language = Japanese - -; Use of this INI entry is deprecated, use global internal_encoding instead. -; internal/script encoding. -; Some encoding cannot work as internal encoding. (e.g. SJIS, BIG5, ISO-2022-*) -; If empty, default_charset or internal_encoding or iconv.internal_encoding is used. -; The precedence is: default_charset < internal_encoding < iconv.internal_encoding -;mbstring.internal_encoding = - -; Use of this INI entry is deprecated, use global input_encoding instead. -; http input encoding. -; mbstring.encoding_translation = On is needed to use this setting. -; If empty, default_charset or input_encoding or mbstring.input is used. -; The precedence is: default_charset < input_encoding < mbstring.http_input -; http://php.net/mbstring.http-input -;mbstring.http_input = - -; Use of this INI entry is deprecated, use global output_encoding instead. -; http output encoding. -; mb_output_handler must be registered as output buffer to function. -; If empty, default_charset or output_encoding or mbstring.http_output is used. -; The precedence is: default_charset < output_encoding < mbstring.http_output -; To use an output encoding conversion, mbstring's output handler must be set -; otherwise output encoding conversion cannot be performed. -; http://php.net/mbstring.http-output -;mbstring.http_output = - -; enable automatic encoding translation according to -; mbstring.internal_encoding setting. Input chars are -; converted to internal encoding by setting this to On. -; Note: Do _not_ use automatic encoding translation for -; portable libs/applications. -; http://php.net/mbstring.encoding-translation -;mbstring.encoding_translation = Off - -; automatic encoding detection order. -; "auto" detect order is changed according to mbstring.language -; http://php.net/mbstring.detect-order -;mbstring.detect_order = auto - -; substitute_character used when character cannot be converted -; one from another -; http://php.net/mbstring.substitute-character -;mbstring.substitute_character = none - -; Enable strict encoding detection. -;mbstring.strict_detection = Off - -; This directive specifies the regex pattern of content types for which mb_output_handler() -; is activated. -; Default: mbstring.http_output_conv_mimetype=^(text/|application/xhtml\+xml) -;mbstring.http_output_conv_mimetype= - -; This directive specifies maximum stack depth for mbstring regular expressions. It is similar -; to the pcre.recursion_limit for PCRE. -;mbstring.regex_stack_limit=100000 - -; This directive specifies maximum retry count for mbstring regular expressions. It is similar -; to the pcre.backtrack_limit for PCRE. -;mbstring.regex_retry_limit=1000000 - -[gd] -; Tell the jpeg decode to ignore warnings and try to create -; a gd image. The warning will then be displayed as notices -; disabled by default -; http://php.net/gd.jpeg-ignore-warning -;gd.jpeg_ignore_warning = 1 - -[exif] -; Exif UNICODE user comments are handled as UCS-2BE/UCS-2LE and JIS as JIS. -; With mbstring support this will automatically be converted into the encoding -; given by corresponding encode setting. When empty mbstring.internal_encoding -; is used. For the decode settings you can distinguish between motorola and -; intel byte order. A decode setting cannot be empty. -; http://php.net/exif.encode-unicode -;exif.encode_unicode = ISO-8859-15 - -; http://php.net/exif.decode-unicode-motorola -;exif.decode_unicode_motorola = UCS-2BE - -; http://php.net/exif.decode-unicode-intel -;exif.decode_unicode_intel = UCS-2LE - -; http://php.net/exif.encode-jis -;exif.encode_jis = - -; http://php.net/exif.decode-jis-motorola -;exif.decode_jis_motorola = JIS - -; http://php.net/exif.decode-jis-intel -;exif.decode_jis_intel = JIS - -[Tidy] -; The path to a default tidy configuration file to use when using tidy -; http://php.net/tidy.default-config -;tidy.default_config = /usr/local/lib/php/default.tcfg - -; Should tidy clean and repair output automatically? -; WARNING: Do not use this option if you are generating non-html content -; such as dynamic images -; http://php.net/tidy.clean-output -tidy.clean_output = Off - -[soap] -; Enables or disables WSDL caching feature. -; http://php.net/soap.wsdl-cache-enabled -soap.wsdl_cache_enabled=1 - -; Sets the directory name where SOAP extension will put cache files. -; http://php.net/soap.wsdl-cache-dir -soap.wsdl_cache_dir="@{TMPDIR}" - -; (time to live) Sets the number of second while cached file will be used -; instead of original one. -; http://php.net/soap.wsdl-cache-ttl -soap.wsdl_cache_ttl=86400 - -; Sets the size of the cache limit. (Max. number of WSDL files to cache) -soap.wsdl_cache_limit = 5 - -[sysvshm] -; A default size of the shared memory segment -;sysvshm.init_mem = 10000 - -[ldap] -; Sets the maximum number of open links or -1 for unlimited. -ldap.max_links = -1 - -[dba] -;dba.default_handler= - -[opcache] -; Determines if Zend OPCache is enabled -;opcache.enable=1 - -; Determines if Zend OPCache is enabled for the CLI version of PHP -;opcache.enable_cli=0 - -; The OPcache shared memory storage size. -;opcache.memory_consumption=128 - -; The amount of memory for interned strings in Mbytes. -;opcache.interned_strings_buffer=8 - -; The maximum number of keys (scripts) in the OPcache hash table. -; Only numbers between 200 and 1000000 are allowed. -;opcache.max_accelerated_files=10000 - -; The maximum percentage of "wasted" memory until a restart is scheduled. -;opcache.max_wasted_percentage=5 - -; When this directive is enabled, the OPcache appends the current working -; directory to the script key, thus eliminating possible collisions between -; files with the same name (basename). Disabling the directive improves -; performance, but may break existing applications. -;opcache.use_cwd=1 - -; When disabled, you must reset the OPcache manually or restart the -; webserver for changes to the filesystem to take effect. -;opcache.validate_timestamps=1 - -; How often (in seconds) to check file timestamps for changes to the shared -; memory storage allocation. ("1" means validate once per second, but only -; once per request. "0" means always validate) -;opcache.revalidate_freq=2 - -; Enables or disables file search in include_path optimization -;opcache.revalidate_path=0 - -; If disabled, all PHPDoc comments are dropped from the code to reduce the -; size of the optimized code. -;opcache.save_comments=1 - -; If enabled, compilation warnings (including notices and deprecations) will -; be recorded and replayed each time a file is included. Otherwise, compilation -; warnings will only be emitted when the file is first cached. -;opcache.record_warnings=0 - -; Allow file existence override (file_exists, etc.) performance feature. -;opcache.enable_file_override=0 - -; A bitmask, where each bit enables or disables the appropriate OPcache -; passes -;opcache.optimization_level=0x7FFFBFFF - -;opcache.dups_fix=0 - -; The location of the OPcache blacklist file (wildcards allowed). -; Each OPcache blacklist file is a text file that holds the names of files -; that should not be accelerated. The file format is to add each filename -; to a new line. The filename may be a full path or just a file prefix -; (i.e., /var/www/x blacklists all the files and directories in /var/www -; that start with 'x'). Line starting with a ; are ignored (comments). -;opcache.blacklist_filename= - -; Allows exclusion of large files from being cached. By default all files -; are cached. -;opcache.max_file_size=0 - -; Check the cache checksum each N requests. -; The default value of "0" means that the checks are disabled. -;opcache.consistency_checks=0 - -; How long to wait (in seconds) for a scheduled restart to begin if the cache -; is not being accessed. -;opcache.force_restart_timeout=180 - -; OPcache error_log file name. Empty string assumes "stderr". -;opcache.error_log= - -; All OPcache errors go to the Web server log. -; By default, only fatal errors (level 0) or errors (level 1) are logged. -; You can also enable warnings (level 2), info messages (level 3) or -; debug messages (level 4). -;opcache.log_verbosity_level=1 - -; Preferred Shared Memory back-end. Leave empty and let the system decide. -;opcache.preferred_memory_model= - -; Protect the shared memory from unexpected writing during script execution. -; Useful for internal debugging only. -;opcache.protect_memory=0 - -; Allows calling OPcache API functions only from PHP scripts which path is -; started from specified string. The default "" means no restriction -;opcache.restrict_api= - -; Mapping base of shared memory segments (for Windows only). All the PHP -; processes have to map shared memory into the same address space. This -; directive allows to manually fix the "Unable to reattach to base address" -; errors. -;opcache.mmap_base= - -; Facilitates multiple OPcache instances per user (for Windows only). All PHP -; processes with the same cache ID and user share an OPcache instance. -;opcache.cache_id= - -; Enables and sets the second level cache directory. -; It should improve performance when SHM memory is full, at server restart or -; SHM reset. The default "" disables file based caching. -;opcache.file_cache= - -; Enables or disables opcode caching in shared memory. -;opcache.file_cache_only=0 - -; Enables or disables checksum validation when script loaded from file cache. -;opcache.file_cache_consistency_checks=1 - -; Implies opcache.file_cache_only=1 for a certain process that failed to -; reattach to the shared memory (for Windows only). Explicitly enabled file -; cache is required. -;opcache.file_cache_fallback=1 - -; Enables or disables copying of PHP code (text segment) into HUGE PAGES. -; This should improve performance, but requires appropriate OS configuration. -;opcache.huge_code_pages=1 - -; Validate cached file permissions. -;opcache.validate_permission=0 - -; Prevent name collisions in chroot'ed environment. -;opcache.validate_root=0 - -; If specified, it produces opcode dumps for debugging different stages of -; optimizations. -;opcache.opt_debug_level=0 - -; Specifies a PHP script that is going to be compiled and executed at server -; start-up. -; http://php.net/opcache.preload -;opcache.preload= - -; Preloading code as root is not allowed for security reasons. This directive -; facilitates to let the preloading to be run as another user. -; http://php.net/opcache.preload_user -;opcache.preload_user= - -; Prevents caching files that are less than this number of seconds old. It -; protects from caching of incompletely updated files. In case all file updates -; on your site are atomic, you may increase performance by setting it to "0". -;opcache.file_update_protection=2 - -; Absolute path used to store shared lockfiles (for *nix only). -;opcache.lockfile_path=/tmp - -[curl] -; A default value for the CURLOPT_CAINFO option. This is required to be an -; absolute path. -;curl.cainfo = - -[openssl] -; The location of a Certificate Authority (CA) file on the local filesystem -; to use when verifying the identity of SSL/TLS peers. Most users should -; not specify a value for this directive as PHP will attempt to use the -; OS-managed cert stores in its absence. If specified, this value may still -; be overridden on a per-stream basis via the "cafile" SSL stream context -; option. -;openssl.cafile= - -; If openssl.cafile is not specified or if the CA file is not found, the -; directory pointed to by openssl.capath is searched for a suitable -; certificate. This value must be a correctly hashed certificate directory. -; Most users should not specify a value for this directive as PHP will -; attempt to use the OS-managed cert stores in its absence. If specified, -; this value may still be overridden on a per-stream basis via the "capath" -; SSL stream context option. -;openssl.capath= - -; Local Variables: -; tab-width: 4 -; End: diff --git a/defaults/options.json b/defaults/options.json index 6b07f0876..5d5e6ceb9 100644 --- a/defaults/options.json +++ b/defaults/options.json @@ -1 +1 @@ -{"STACK":"trusty","LIBDIR":"lib","WEBDIR":"htdocs","WEB_SERVER":"httpd","PHP_VM":"php","ADMIN_EMAIL":"admin@localhost","HTTPD_STRIP":false,"HTTPD_MODULES_STRIP":true,"NGINX_STRIP":false,"PHP_STRIP":false,"PHP_MODULES_STRIP":true,"PHP_MODULES":[],"PHP_EXTENSIONS":["bz2","zlib","curl"],"ZEND_EXTENSIONS":[],"PHP_DEFAULT":"8.1.26","PHP_80_LATEST":"8.0.30","PHP_81_LATEST":"8.1.26","PHP_82_LATEST":"8.2.13"} +{"STACK":"trusty","LIBDIR":"lib","WEBDIR":"htdocs","WEB_SERVER":"httpd","PHP_VM":"php","ADMIN_EMAIL":"admin@localhost","HTTPD_STRIP":false,"HTTPD_MODULES_STRIP":true,"NGINX_STRIP":false,"PHP_STRIP":false,"PHP_MODULES_STRIP":true,"PHP_MODULES":[],"PHP_EXTENSIONS":["bz2","zlib","curl"],"ZEND_EXTENSIONS":[],"PHP_DEFAULT":"8.1.26","PHP_81_LATEST":"8.1.26","PHP_82_LATEST":"8.2.13"} diff --git a/go.mod b/go.mod index 9689710ad..9288bf52a 100644 --- a/go.mod +++ b/go.mod @@ -2,28 +2,28 @@ module github.com/cloudfoundry/php-buildpack require ( github.com/blang/semver v3.5.1+incompatible - github.com/cloudfoundry/libbuildpack v0.0.0-20230404152448-8da916cb09fe + github.com/cloudfoundry/libbuildpack v0.0.0-20231211162543-86d10e150195 github.com/onsi/ginkgo v1.16.5 - github.com/onsi/gomega v1.27.6 + github.com/onsi/gomega v1.30.0 ) require ( code.cloudfoundry.org/lager v2.0.0+incompatible // indirect github.com/Masterminds/semver v1.5.0 // indirect - github.com/cenkalti/backoff/v4 v4.2.0 // indirect - github.com/elazarl/goproxy v0.0.0-20221015165544-a0805db90819 // indirect + github.com/cenkalti/backoff/v4 v4.2.1 // indirect + github.com/elazarl/goproxy v0.0.0-20231117061959-7cc037d33fb5 // indirect github.com/elazarl/goproxy/ext v0.0.0-20210110162100-a92cc753f88e // indirect - github.com/fsnotify/fsnotify v1.6.0 // indirect - github.com/google/go-cmp v0.5.9 // indirect - github.com/nxadm/tail v1.4.8 // indirect + github.com/fsnotify/fsnotify v1.7.0 // indirect + github.com/google/go-cmp v0.6.0 // indirect + github.com/nxadm/tail v1.4.11 // indirect github.com/paketo-buildpacks/packit v1.3.1 // indirect github.com/pkg/errors v0.9.1 // indirect - github.com/tidwall/gjson v1.14.4 // indirect + github.com/tidwall/gjson v1.17.0 // indirect github.com/tidwall/match v1.1.1 // indirect github.com/tidwall/pretty v1.2.1 // indirect - golang.org/x/net v0.8.0 // indirect - golang.org/x/sys v0.6.0 // indirect - golang.org/x/text v0.8.0 // indirect + golang.org/x/net v0.19.0 // indirect + golang.org/x/sys v0.15.0 // indirect + golang.org/x/text v0.14.0 // indirect gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c // indirect gopkg.in/tomb.v1 v1.0.0-20141024135613-dd632973f1e7 // indirect gopkg.in/yaml.v2 v2.4.0 // indirect diff --git a/go.sum b/go.sum index 0c7ead34d..415010c36 100644 --- a/go.sum +++ b/go.sum @@ -9,9 +9,13 @@ github.com/blang/semver v3.5.1+incompatible h1:cQNTCjp13qL8KC3Nbxr/y2Bqb63oX6wdn github.com/blang/semver v3.5.1+incompatible/go.mod h1:kRBLl5iJ+tD4TcOOxsy/0fnwebNt5EWlYSAyrTnjyyk= github.com/cenkalti/backoff/v4 v4.2.0 h1:HN5dHm3WBOgndBH6E8V0q2jIYIR3s9yglV8k/+MN3u4= github.com/cenkalti/backoff/v4 v4.2.0/go.mod h1:Y3VNntkOUPxTVeUxJ/G5vcM//AlwfmyYozVcomhLiZE= +github.com/cenkalti/backoff/v4 v4.2.1 h1:y4OZtCnogmCPw98Zjyt5a6+QwPLGkiQsYW5oUqylYbM= +github.com/cenkalti/backoff/v4 v4.2.1/go.mod h1:Y3VNntkOUPxTVeUxJ/G5vcM//AlwfmyYozVcomhLiZE= github.com/cheggaaa/pb/v3 v3.0.8/go.mod h1:UICbiLec/XO6Hw6k+BHEtHeQFzzBH4i2/qk/ow1EJTA= github.com/cloudfoundry/libbuildpack v0.0.0-20230404152448-8da916cb09fe h1:Afnp+boYp9jHxEKxQYDfzDzvXSUVCq0Y36nSzQytFNg= github.com/cloudfoundry/libbuildpack v0.0.0-20230404152448-8da916cb09fe/go.mod h1:fQrqQYHrwEuf/wepBMR/o/t+BtAWgjXUepwoVE7/iBo= +github.com/cloudfoundry/libbuildpack v0.0.0-20231211162543-86d10e150195 h1:Ce1OJ2y7+LxC5ISEnC5amSu2Q7xsxJTb37g4l0Lt9+c= +github.com/cloudfoundry/libbuildpack v0.0.0-20231211162543-86d10e150195/go.mod h1:fQrqQYHrwEuf/wepBMR/o/t+BtAWgjXUepwoVE7/iBo= github.com/creack/pty v1.1.9/go.mod h1:oKZEueFk5CKHvIhNR5MUki03XCEU+Q6VDXinZuGJ33E= github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= @@ -19,6 +23,8 @@ github.com/dsnet/compress v0.0.1/go.mod h1:Aw8dCMJ7RioblQeTqt88akK31OvO8Dhf5Jflh github.com/dsnet/golib v0.0.0-20171103203638-1ea166775780/go.mod h1:Lj+Z9rebOhdfkVLjJ8T6VcRQv3SXugXy999NBtR9aFY= github.com/elazarl/goproxy v0.0.0-20221015165544-a0805db90819 h1:RIB4cRk+lBqKK3Oy0r2gRX4ui7tuhiZq2SuTtTCi0/0= github.com/elazarl/goproxy v0.0.0-20221015165544-a0805db90819/go.mod h1:Ro8st/ElPeALwNFlcTpWmkr6IoMFfkjXAvTHpevnDsM= +github.com/elazarl/goproxy v0.0.0-20231117061959-7cc037d33fb5 h1:m62nsMU279qRD9PQSWD1l66kmkXzuYcnVJqL4XLeV2M= +github.com/elazarl/goproxy v0.0.0-20231117061959-7cc037d33fb5/go.mod h1:Ro8st/ElPeALwNFlcTpWmkr6IoMFfkjXAvTHpevnDsM= github.com/elazarl/goproxy/ext v0.0.0-20190711103511-473e67f1d7d2/go.mod h1:gNh8nYJoAm43RfaxurUnxr+N1PwuFV3ZMl/efxlIlY8= github.com/elazarl/goproxy/ext v0.0.0-20210110162100-a92cc753f88e h1:CQn2/8fi3kmpT9BTiHEELgdxAOQNVZc9GoPA4qnQzrs= github.com/elazarl/goproxy/ext v0.0.0-20210110162100-a92cc753f88e/go.mod h1:gNh8nYJoAm43RfaxurUnxr+N1PwuFV3ZMl/efxlIlY8= @@ -27,6 +33,8 @@ github.com/fsnotify/fsnotify v1.4.7/go.mod h1:jwhsz4b93w/PPRr/qN1Yymfu8t87LnFCMo github.com/fsnotify/fsnotify v1.4.9/go.mod h1:znqG4EE+3YCdAaPaxE2ZRY/06pZUdp0tY4IgpuI1SZQ= github.com/fsnotify/fsnotify v1.6.0 h1:n+5WquG0fcWoWp6xPWfHdbskMCQaFnG6PfBrh1Ky4HY= github.com/fsnotify/fsnotify v1.6.0/go.mod h1:sl3t1tCWJFWoRz9R8WJCbQihKKwmorjAbSClcnxKAGw= +github.com/fsnotify/fsnotify v1.7.0 h1:8JEhPFa5W2WU7YfeZzPNqzMP6Lwt7L2715Ggo0nosvA= +github.com/fsnotify/fsnotify v1.7.0/go.mod h1:40Bi/Hjc2AVfZrqy+aj+yEI+/bRxZnMJyTJwOpGvigM= github.com/gabriel-vasile/mimetype v1.4.0/go.mod h1:fA8fi6KUiG7MgQQ+mEWotXoEOvmxRtOJlERCzSmRvr8= github.com/go-logr/logr v1.2.3 h1:2DntVwHkVopvECVRSlL5PSo9eG+cAkDCuckLubN+rq0= github.com/go-task/slim-sprig v0.0.0-20210107165309-348f09dbbbc0/go.mod h1:fyg7847qk6SyHyPtNmDHnmrv/HOrqktSC+C9fM+CJOE= @@ -48,6 +56,8 @@ github.com/google/go-cmp v0.4.0/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/ github.com/google/go-cmp v0.5.5/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE= github.com/google/go-cmp v0.5.9 h1:O2Tfq5qg4qc4AmwVlvv0oLiVAGB7enBSJ2x2DqQFi38= github.com/google/go-cmp v0.5.9/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= +github.com/google/go-cmp v0.6.0 h1:ofyhxvXcZhMsU5ulbFiLKl/XBFqE1GSq7atu8tAmTRI= +github.com/google/go-cmp v0.6.0/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= github.com/google/pprof v0.0.0-20210407192527-94a9f03dee38 h1:yAJXTCF9TqKcTiHJAE8dj7HMvPfh66eeA2JYW7eFpSE= github.com/hpcloud/tail v1.0.0/go.mod h1:ab1qPbhIpdTxEkNHXyeSf5vhxWSCs/tWer42PpOxQnU= github.com/jarcoal/httpmock v1.3.0 h1:2RJ8GP0IIaWwcC9Fp2BmVi8Kog3v2Hn7VXM3fTd+nuc= @@ -66,17 +76,22 @@ github.com/niemeyer/pretty v0.0.0-20200227124842-a10e7caefd8e/go.mod h1:zD1mROLA github.com/nxadm/tail v1.4.4/go.mod h1:kenIhsEOeOJmVchQTgglprH7qJGnHDVpk1VPCcaMI8A= github.com/nxadm/tail v1.4.8 h1:nPr65rt6Y5JFSKQO7qToXr7pePgD6Gwiw05lkbyAQTE= github.com/nxadm/tail v1.4.8/go.mod h1:+ncqLTQzXmGhMZNUePPaPqPvBxHAIsmXswZKocGu+AU= +github.com/nxadm/tail v1.4.11 h1:8feyoE3OzPrcshW5/MJ4sGESc5cqmGkGCWlco4l0bqY= +github.com/nxadm/tail v1.4.11/go.mod h1:OTaG3NK980DZzxbRq6lEuzgU+mug70nY11sMd4JXXHc= github.com/onsi/ginkgo v1.6.0/go.mod h1:lLunBs/Ym6LB5Z9jYTR76FiuTmxDTDusOGeTQH+WWjE= github.com/onsi/ginkgo v1.12.1/go.mod h1:zj2OWP4+oCPe1qIXoGWkgMRwljMUYCdkwsT2108oapk= github.com/onsi/ginkgo v1.16.4/go.mod h1:dX+/inL/fNMqNlz0e9LfyB9TswhZpCVdJM/Z6Vvnwo0= github.com/onsi/ginkgo v1.16.5 h1:8xi0RTUf59SOSfEtZMvwTvXYMzG4gV23XVHOZiXNtnE= github.com/onsi/ginkgo v1.16.5/go.mod h1:+E8gABHa3K6zRBolWtd+ROzc/U5bkGt0FwiG042wbpU= github.com/onsi/ginkgo/v2 v2.9.2 h1:BA2GMJOtfGAfagzYtrAlufIP0lq6QERkFmHLMLPwFSU= +github.com/onsi/ginkgo/v2 v2.13.0 h1:0jY9lJquiL8fcf3M4LAXN5aMlS/b2BV86HFFPCPMgE4= github.com/onsi/gomega v1.7.1/go.mod h1:XdKZgCCFLUoM/7CFJVPcG8C1xQ1AJ0vpAezJrB7JYyY= github.com/onsi/gomega v1.10.1/go.mod h1:iN09h71vgCQne3DLsj+A5owkum+a2tYe+TOCB1ybHNo= github.com/onsi/gomega v1.17.0/go.mod h1:HnhC7FXeEQY45zxNK3PPoIUhzk/80Xly9PcubAlGdZY= github.com/onsi/gomega v1.27.6 h1:ENqfyGeS5AX/rlXDd/ETokDz93u0YufY1Pgxuy/PvWE= github.com/onsi/gomega v1.27.6/go.mod h1:PIQNjfQwkP3aQAH7lf7j87O/5FiNr+ZR8+ipb+qQlhg= +github.com/onsi/gomega v1.30.0 h1:hvMK7xYz4D3HapigLTeGdId/NcfQx1VHMJc60ew99+8= +github.com/onsi/gomega v1.30.0/go.mod h1:9sxs+SwGrKI0+PWe4Fxa9tFQQBG5xSsSbMXOI8PPpoQ= github.com/paketo-buildpacks/packit v1.3.1 h1:DJAfqsDadRllr/OPYDONxJEOHbYUMWE1NIPPArq4b7w= github.com/paketo-buildpacks/packit v1.3.1/go.mod h1:v0jVFr3GNcM9JDwwuIAzYNV4Le1L728uMSNhjUybXVA= github.com/pelletier/go-toml v1.9.4/go.mod h1:u1nR/EPcESfeI/szUZKdtJ0xRNbUoANCkoOuaOx1Y+c= @@ -92,6 +107,8 @@ github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+ github.com/stretchr/testify v1.5.1/go.mod h1:5W2xD1RspED5o8YsWQXVCued0rvSQ+mT+I5cxcmMvtA= github.com/tidwall/gjson v1.14.4 h1:uo0p8EbA09J7RQaflQ1aBRffTR7xedD2bcIVSYxLnkM= github.com/tidwall/gjson v1.14.4/go.mod h1:/wbyibRr2FHMks5tjHJ5F8dMZh3AcwJEMf5vlfC0lxk= +github.com/tidwall/gjson v1.17.0 h1:/Jocvlh98kcTfpN2+JzGQWQcqrPQwDrVEMApx/M5ZwM= +github.com/tidwall/gjson v1.17.0/go.mod h1:/wbyibRr2FHMks5tjHJ5F8dMZh3AcwJEMf5vlfC0lxk= github.com/tidwall/match v1.1.1 h1:+Ho715JplO36QYgwN9PGYNhgZvoUSc9X2c80KVTi+GA= github.com/tidwall/match v1.1.1/go.mod h1:eRSPERbgtNPcGhD8UCthc6PmLEQXEWd3PRB5JTxsfmM= github.com/tidwall/pretty v1.2.0/go.mod h1:ITEVvHYasfjBbM0u2Pg8T2nJnzm8xPwvNhhsoaGGjNU= @@ -114,6 +131,8 @@ golang.org/x/net v0.0.0-20210505024714-0287a6fb4125/go.mod h1:9nx3DQGgdP8bBQD5qx golang.org/x/net v0.0.0-20210525063256-abc453219eb5/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y= golang.org/x/net v0.8.0 h1:Zrh2ngAOFYneWTAIAPethzeaQLuHwhuBkuV6ZiRnUaQ= golang.org/x/net v0.8.0/go.mod h1:QVkue5JL9kW//ek3r6jTKnTFis1tRmNAW2P1shuFdJc= +golang.org/x/net v0.19.0 h1:zTwKpTd2XuCqf8huc7Fo2iSy+4RHPd10s4KzeTnVr1c= +golang.org/x/net v0.19.0/go.mod h1:CfAk/cbD4CthTvqiEl8NpboMuiuOYsAr/7NOjZJtv1U= golang.org/x/sync v0.0.0-20180314180146-1d60e4601c6f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20201020160332-67f06af15bc9/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= @@ -135,16 +154,21 @@ golang.org/x/sys v0.0.0-20210603125802-9665404d3644/go.mod h1:oPkhp1MJrh7nUepCBc golang.org/x/sys v0.0.0-20220908164124-27713097b956/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.6.0 h1:MVltZSvRTcU2ljQOhs94SXPftV6DCNnZViHeQps87pQ= golang.org/x/sys v0.6.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.15.0 h1:h48lPFYpsTvQJZF4EKyI4aLHaev3CxivZmv7yZig9pc= +golang.org/x/sys v0.15.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.8.0 h1:57P1ETyNKtuIjB4SRd15iJxuhj8Gc416Y78H3qgMh68= golang.org/x/text v0.8.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8= +golang.org/x/text v0.14.0 h1:ScX5w1eTa3QqT8oi6+ziP7dTV1S2+ALU0bI+0zXKWiQ= +golang.org/x/text v0.14.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU= golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo= golang.org/x/tools v0.0.0-20201224043029-2b0845dc783e/go.mod h1:emZCQorbCU4vsT4fOWvOPXz4eW1wZW4PmDk9uLelYpA= golang.org/x/tools v0.7.0 h1:W4OVu8VVOaIO0yzWMNdepAulS7YfoS3Zabrm8DOXXU4= +golang.org/x/tools v0.12.0 h1:YW6HUoUmYBpwSgyaGaZq1fHjrBjX1rlpZ54T6mu2kss= golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20191011141410-1b5146add898/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20191204190536-9bdfabe68543/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= diff --git a/manifest.yml b/manifest.yml index 08a88357d..a46b03456 100644 --- a/manifest.yml +++ b/manifest.yml @@ -40,11 +40,6 @@ url_to_dependency_map: name: composer version: "$1" dependency_deprecation_dates: -- version_line: 8.0.x - name: php - date: 2023-11-26 - link: http://php.net/supported-versions.php - match: 8.0.\d+ - version_line: 8.1.x name: php date: 2024-11-25 @@ -130,258 +125,6 @@ dependencies: - cflinuxfs4 source: http://nginx.org/download/nginx-1.25.3.tar.gz source_sha256: 64c5b975ca287939e828303fa857d22f142b251f17808dfe41733512d9cded86 -- name: php - version: 8.0.29 - uri: https://buildpacks.cloudfoundry.org/dependencies/php/php_8.0.29_linux_x64_cflinuxfs3-dev_f9d06214.tgz - sha256: f9d062148896bb177ec93a180a7dcd5bdb40f19b99e29f6b13fca68d650f1e0a - cf_stacks: - - cflinuxfs3 - source: https://php.net/distributions/php-8.0.29.tar.gz - source_sha256: db6ee08df5706365f624cde1cffb20ad6de1effe59d7e886337213a09f2e2684 - dependencies: - - name: amqp - version: 2.1.1 - - name: apcu - version: 5.1.23 - - name: bz2 - version: - - name: curl - version: - - name: dba - version: - - name: enchant - - name: exif - version: - - name: fileinfo - version: - - name: ftp - version: - - name: gd - - name: gettext - version: - - name: gmp - version: - - name: igbinary - version: 3.2.14 - - name: imagick - version: 3.7.0 - - name: imap - version: - - name: ldap - version: - - name: lzf - version: - - name: mailparse - version: 3.1.6 - - name: maxminddb - version: 1.11.0 - - name: mbstring - version: - - name: memcached - version: 3.2.0 - - name: mongodb - version: 1.17.0 - - name: msgpack - version: 2.2.0 - - name: mysqli - version: - - name: oauth - version: 2.0.7 - - name: opcache - version: - - name: openssl - version: - - name: pcntl - version: - - name: pdo - version: - - name: pdo_firebird - - name: pdo_mysql - version: - - name: pdo_odbc - - name: pdo_pgsql - version: - - name: pdo_sqlite - version: - - name: pdo_sqlsrv - version: 5.11.1 - - name: pgsql - version: - - name: phalcon - version: 5.4.0 - - name: phpiredis - version: 1.0.1 - - name: pspell - version: - - name: psr - version: 1.2.0 - - name: rdkafka - version: 6.0.3 - - name: readline - - name: redis - version: 6.0.2 - - name: shmop - version: - - name: snmp - - name: soap - version: - - name: sockets - version: - - name: sodium - - name: solr - version: 2.6.0 - - name: sqlsrv - version: 5.11.1 - - name: ssh2 - version: '1.4' - - name: stomp - version: 2.0.3 - - name: sysvmsg - version: - - name: sysvsem - version: - - name: sysvshm - version: - - name: tideways_xhprof - version: 5.0.4 - - name: tidy - - name: xdebug - version: 3.2.2 - - name: xsl - version: - - name: yaf - version: 3.3.5 - - name: yaml - version: 2.2.3 - - name: zip - - name: zlib - version: -- name: php - version: 8.0.30 - uri: https://buildpacks.cloudfoundry.org/dependencies/php/php_8.0.30_linux_x64_cflinuxfs3-dev_d6db13c4.tgz - sha256: d6db13c488866c49cfb7a00b55e84ec13ca14b5be5dfb24d94b239101b37444f - cf_stacks: - - cflinuxfs3 - source: https://php.net/distributions/php-8.0.30.tar.gz - source_sha256: 449d2048fcb20a314d8c218097c6d1047a9f1c5bb72aa54d5d3eba0a27a4c80c - dependencies: - - name: amqp - version: 2.1.1 - - name: apcu - version: 5.1.23 - - name: bz2 - version: - - name: curl - version: - - name: dba - version: - - name: enchant - - name: exif - version: - - name: fileinfo - version: - - name: ftp - version: - - name: gd - - name: gettext - version: - - name: gmp - version: - - name: igbinary - version: 3.2.14 - - name: imagick - version: 3.7.0 - - name: imap - version: - - name: ldap - version: - - name: lzf - version: - - name: mailparse - version: 3.1.6 - - name: maxminddb - version: 1.11.0 - - name: mbstring - version: - - name: memcached - version: 3.2.0 - - name: mongodb - version: 1.17.0 - - name: msgpack - version: 2.2.0 - - name: mysqli - version: - - name: oauth - version: 2.0.7 - - name: opcache - version: - - name: openssl - version: - - name: pcntl - version: - - name: pdo - version: - - name: pdo_firebird - - name: pdo_mysql - version: - - name: pdo_odbc - - name: pdo_pgsql - version: - - name: pdo_sqlite - version: - - name: pdo_sqlsrv - version: 5.11.1 - - name: pgsql - version: - - name: phalcon - version: 5.4.0 - - name: phpiredis - version: 1.0.1 - - name: pspell - version: - - name: psr - version: 1.2.0 - - name: rdkafka - version: 6.0.3 - - name: readline - - name: redis - version: 6.0.2 - - name: shmop - version: - - name: snmp - - name: soap - version: - - name: sockets - version: - - name: sodium - - name: solr - version: 2.6.0 - - name: sqlsrv - version: 5.11.1 - - name: ssh2 - version: '1.4' - - name: stomp - version: 2.0.3 - - name: sysvmsg - version: - - name: sysvsem - version: - - name: sysvshm - version: - - name: tideways_xhprof - version: 5.0.4 - - name: tidy - - name: xdebug - version: 3.2.2 - - name: xsl - version: - - name: yaf - version: 3.3.5 - - name: yaml - version: 2.2.3 - - name: zip - - name: zlib - version: - name: php version: 8.1.25 uri: https://buildpacks.cloudfoundry.org/dependencies/php/php_8.1.25_linux_x64_cflinuxfs3-dev_e7fa18f2.tgz diff --git a/src/php/unit/available_versions_test.go b/src/php/unit/available_versions_test.go index 9b16d9038..b424bd609 100644 --- a/src/php/unit/available_versions_test.go +++ b/src/php/unit/available_versions_test.go @@ -24,18 +24,18 @@ var _ = Describe("Options.JSON", func() { versions = manifest.AllDependencyVersions("php") }) - It("PHP_80_LATEST will have the latest 8.0 version", func() { - latest, err := libbuildpack.FindMatchingVersion("8.0.x", versions) + It("PHP_81_LATEST will have the latest 8.1 version", func() { + latest, err := libbuildpack.FindMatchingVersion("8.1.x", versions) Expect(err).NotTo(HaveOccurred()) - Expect(defaults["PHP_80_LATEST"]).To(Equal(latest)) + Expect(defaults["PHP_81_LATEST"]).To(Equal(latest)) }) - It("PHP_81_LATEST will have the latest 8.1 version", func() { - latest, err := libbuildpack.FindMatchingVersion("8.1.x", versions) + It("PHP_82_LATEST will have the latest 8.2 version", func() { + latest, err := libbuildpack.FindMatchingVersion("8.2.x", versions) Expect(err).NotTo(HaveOccurred()) - Expect(defaults["PHP_81_LATEST"]).To(Equal(latest)) + Expect(defaults["PHP_82_LATEST"]).To(Equal(latest)) }) It("PHP_DEFAULT will have the latest 8.1 version", func() { diff --git a/tests/test_compile_helpers.py b/tests/test_compile_helpers.py index fc00474df..a7e565455 100644 --- a/tests/test_compile_helpers.py +++ b/tests/test_compile_helpers.py @@ -335,6 +335,6 @@ def test_find_all_php_versions(self): manifest = load_manifest(ctx) dependencies = manifest['dependencies'] versions = find_all_php_versions(dependencies) - eq_(2, len([v for v in versions if v.startswith('8.0.')])) eq_(2, len([v for v in versions if v.startswith('8.1.')])) + eq_(2, len([v for v in versions if v.startswith('8.2.')])) diff --git a/vendor/github.com/elazarl/goproxy/https.go b/vendor/github.com/elazarl/goproxy/https.go index 5a601a800..608863fad 100644 --- a/vendor/github.com/elazarl/goproxy/https.go +++ b/vendor/github.com/elazarl/goproxy/https.go @@ -4,6 +4,7 @@ import ( "bufio" "crypto/tls" "errors" + "fmt" "io" "io/ioutil" "net" @@ -129,6 +130,7 @@ func (proxy *ProxyHttpServer) handleHttps(w http.ResponseWriter, r *http.Request } targetSiteCon, err := proxy.connectDial(ctx, "tcp", host) if err != nil { + ctx.Warnf("Error dialing to %s: %s", host, err.Error()) httpError(proxyClient, ctx, err) return } @@ -246,11 +248,20 @@ func (proxy *ProxyHttpServer) handleHttps(w http.ResponseWriter, r *http.Request return } if err != nil { - ctx.Warnf("Illegal URL %s", "https://"+r.Host+req.URL.Path) + if req.URL != nil { + ctx.Warnf("Illegal URL %s", "https://"+r.Host+req.URL.Path) + } else { + ctx.Warnf("Illegal URL %s", "https://"+r.Host) + } return } removeProxyHeaders(ctx, req) - resp, err = ctx.RoundTrip(req) + resp, err = func() (*http.Response, error) { + // explicitly discard request body to avoid data races in certain RoundTripper implementations + // see https://github.com/golang/go/issues/61596#issuecomment-1652345131 + defer req.Body.Close() + return ctx.RoundTrip(req) + }() if err != nil { ctx.Warnf("Cannot read TLS response from mitm'd server %v", err) return @@ -324,7 +335,8 @@ func (proxy *ProxyHttpServer) handleHttps(w http.ResponseWriter, r *http.Request } func httpError(w io.WriteCloser, ctx *ProxyCtx, err error) { - if _, err := io.WriteString(w, "HTTP/1.1 502 Bad Gateway\r\n\r\n"); err != nil { + errStr := fmt.Sprintf("HTTP/1.1 502 Bad Gateway\r\nContent-Type: text/plain\r\nContent-Length: %d\r\n\r\n%s", len(err.Error()), err.Error()) + if _, err := io.WriteString(w, errStr); err != nil { ctx.Warnf("Error responding to client: %s", err) } if err := w.Close(); err != nil { @@ -369,7 +381,7 @@ func (proxy *ProxyHttpServer) NewConnectDialToProxyWithHandler(https_proxy strin return nil } if u.Scheme == "" || u.Scheme == "http" { - if strings.IndexRune(u.Host, ':') == -1 { + if !strings.ContainsRune(u.Host, ':') { u.Host += ":80" } return func(network, addr string) (net.Conn, error) { @@ -409,7 +421,7 @@ func (proxy *ProxyHttpServer) NewConnectDialToProxyWithHandler(https_proxy strin } } if u.Scheme == "https" || u.Scheme == "wss" { - if strings.IndexRune(u.Host, ':') == -1 { + if !strings.ContainsRune(u.Host, ':') { u.Host += ":443" } return func(network, addr string) (net.Conn, error) { diff --git a/vendor/github.com/fsnotify/fsnotify/.cirrus.yml b/vendor/github.com/fsnotify/fsnotify/.cirrus.yml new file mode 100644 index 000000000..ffc7b992b --- /dev/null +++ b/vendor/github.com/fsnotify/fsnotify/.cirrus.yml @@ -0,0 +1,13 @@ +freebsd_task: + name: 'FreeBSD' + freebsd_instance: + image_family: freebsd-13-2 + install_script: + - pkg update -f + - pkg install -y go + test_script: + # run tests as user "cirrus" instead of root + - pw useradd cirrus -m + - chown -R cirrus:cirrus . + - FSNOTIFY_BUFFER=4096 sudo --preserve-env=FSNOTIFY_BUFFER -u cirrus go test -parallel 1 -race ./... + - sudo --preserve-env=FSNOTIFY_BUFFER -u cirrus go test -parallel 1 -race ./... diff --git a/vendor/github.com/fsnotify/fsnotify/.gitignore b/vendor/github.com/fsnotify/fsnotify/.gitignore index 1d89d85ce..391cc076b 100644 --- a/vendor/github.com/fsnotify/fsnotify/.gitignore +++ b/vendor/github.com/fsnotify/fsnotify/.gitignore @@ -4,3 +4,4 @@ # Output of go build ./cmd/fsnotify /fsnotify +/fsnotify.exe diff --git a/vendor/github.com/fsnotify/fsnotify/CHANGELOG.md b/vendor/github.com/fsnotify/fsnotify/CHANGELOG.md index 77f9593bd..e0e575754 100644 --- a/vendor/github.com/fsnotify/fsnotify/CHANGELOG.md +++ b/vendor/github.com/fsnotify/fsnotify/CHANGELOG.md @@ -1,16 +1,87 @@ # Changelog -All notable changes to this project will be documented in this file. +Unreleased +---------- +Nothing yet. -The format is based on [Keep a Changelog](https://keepachangelog.com/en/1.0.0/), -and this project adheres to [Semantic Versioning](https://semver.org/spec/v2.0.0.html). +1.7.0 - 2023-10-22 +------------------ +This version of fsnotify needs Go 1.17. -## [Unreleased] +### Additions -Nothing yet. +- illumos: add FEN backend to support illumos and Solaris. ([#371]) + +- all: add `NewBufferedWatcher()` to use a buffered channel, which can be useful + in cases where you can't control the kernel buffer and receive a large number + of events in bursts. ([#550], [#572]) + +- all: add `AddWith()`, which is identical to `Add()` but allows passing + options. ([#521]) + +- windows: allow setting the ReadDirectoryChangesW() buffer size with + `fsnotify.WithBufferSize()`; the default of 64K is the highest value that + works on all platforms and is enough for most purposes, but in some cases a + highest buffer is needed. ([#521]) + +### Changes and fixes + +- inotify: remove watcher if a watched path is renamed ([#518]) + + After a rename the reported name wasn't updated, or even an empty string. + Inotify doesn't provide any good facilities to update it, so just remove the + watcher. This is already how it worked on kqueue and FEN. + + On Windows this does work, and remains working. + +- windows: don't listen for file attribute changes ([#520]) + + File attribute changes are sent as `FILE_ACTION_MODIFIED` by the Windows API, + with no way to see if they're a file write or attribute change, so would show + up as a fsnotify.Write event. This is never useful, and could result in many + spurious Write events. + +- windows: return `ErrEventOverflow` if the buffer is full ([#525]) + + Before it would merely return "short read", making it hard to detect this + error. + +- kqueue: make sure events for all files are delivered properly when removing a + watched directory ([#526]) + + Previously they would get sent with `""` (empty string) or `"."` as the path + name. + +- kqueue: don't emit spurious Create events for symbolic links ([#524]) + + The link would get resolved but kqueue would "forget" it already saw the link + itself, resulting on a Create for every Write event for the directory. + +- all: return `ErrClosed` on `Add()` when the watcher is closed ([#516]) + +- other: add `Watcher.Errors` and `Watcher.Events` to the no-op `Watcher` in + `backend_other.go`, making it easier to use on unsupported platforms such as + WASM, AIX, etc. ([#528]) + +- other: use the `backend_other.go` no-op if the `appengine` build tag is set; + Google AppEngine forbids usage of the unsafe package so the inotify backend + won't compile there. -## [1.6.0] - 2022-10-13 +[#371]: https://github.com/fsnotify/fsnotify/pull/371 +[#516]: https://github.com/fsnotify/fsnotify/pull/516 +[#518]: https://github.com/fsnotify/fsnotify/pull/518 +[#520]: https://github.com/fsnotify/fsnotify/pull/520 +[#521]: https://github.com/fsnotify/fsnotify/pull/521 +[#524]: https://github.com/fsnotify/fsnotify/pull/524 +[#525]: https://github.com/fsnotify/fsnotify/pull/525 +[#526]: https://github.com/fsnotify/fsnotify/pull/526 +[#528]: https://github.com/fsnotify/fsnotify/pull/528 +[#537]: https://github.com/fsnotify/fsnotify/pull/537 +[#550]: https://github.com/fsnotify/fsnotify/pull/550 +[#572]: https://github.com/fsnotify/fsnotify/pull/572 +1.6.0 - 2022-10-13 +------------------ This version of fsnotify needs Go 1.16 (this was already the case since 1.5.1, but not documented). It also increases the minimum Linux version to 2.6.32. diff --git a/vendor/github.com/fsnotify/fsnotify/README.md b/vendor/github.com/fsnotify/fsnotify/README.md index d4e6080fe..e480733d1 100644 --- a/vendor/github.com/fsnotify/fsnotify/README.md +++ b/vendor/github.com/fsnotify/fsnotify/README.md @@ -1,29 +1,31 @@ fsnotify is a Go library to provide cross-platform filesystem notifications on -Windows, Linux, macOS, and BSD systems. +Windows, Linux, macOS, BSD, and illumos. -Go 1.16 or newer is required; the full documentation is at +Go 1.17 or newer is required; the full documentation is at https://pkg.go.dev/github.com/fsnotify/fsnotify -**It's best to read the documentation at pkg.go.dev, as it's pinned to the last -released version, whereas this README is for the last development version which -may include additions/changes.** - --- Platform support: -| Adapter | OS | Status | -| --------------------- | ---------------| -------------------------------------------------------------| -| inotify | Linux 2.6.32+ | Supported | -| kqueue | BSD, macOS | Supported | -| ReadDirectoryChangesW | Windows | Supported | -| FSEvents | macOS | [Planned](https://github.com/fsnotify/fsnotify/issues/11) | -| FEN | Solaris 11 | [In Progress](https://github.com/fsnotify/fsnotify/pull/371) | -| fanotify | Linux 5.9+ | [Maybe](https://github.com/fsnotify/fsnotify/issues/114) | -| USN Journals | Windows | [Maybe](https://github.com/fsnotify/fsnotify/issues/53) | -| Polling | *All* | [Maybe](https://github.com/fsnotify/fsnotify/issues/9) | - -Linux and macOS should include Android and iOS, but these are currently untested. +| Backend | OS | Status | +| :-------------------- | :--------- | :------------------------------------------------------------------------ | +| inotify | Linux | Supported | +| kqueue | BSD, macOS | Supported | +| ReadDirectoryChangesW | Windows | Supported | +| FEN | illumos | Supported | +| fanotify | Linux 5.9+ | [Not yet](https://github.com/fsnotify/fsnotify/issues/114) | +| AHAFS | AIX | [aix branch]; experimental due to lack of maintainer and test environment | +| FSEvents | macOS | [Needs support in x/sys/unix][fsevents] | +| USN Journals | Windows | [Needs support in x/sys/windows][usn] | +| Polling | *All* | [Not yet](https://github.com/fsnotify/fsnotify/issues/9) | + +Linux and illumos should include Android and Solaris, but these are currently +untested. + +[fsevents]: https://github.com/fsnotify/fsnotify/issues/11#issuecomment-1279133120 +[usn]: https://github.com/fsnotify/fsnotify/issues/53#issuecomment-1279829847 +[aix branch]: https://github.com/fsnotify/fsnotify/issues/353#issuecomment-1284590129 Usage ----- @@ -83,20 +85,23 @@ run with: % go run ./cmd/fsnotify +Further detailed documentation can be found in godoc: +https://pkg.go.dev/github.com/fsnotify/fsnotify + FAQ --- ### Will a file still be watched when it's moved to another directory? No, not unless you are watching the location it was moved to. -### Are subdirectories watched too? +### Are subdirectories watched? No, you must add watches for any directory you want to watch (a recursive watcher is on the roadmap: [#18]). [#18]: https://github.com/fsnotify/fsnotify/issues/18 ### Do I have to watch the Error and Event channels in a goroutine? -As of now, yes (you can read both channels in the same goroutine using `select`, -you don't need a separate goroutine for both channels; see the example). +Yes. You can read both channels in the same goroutine using `select` (you don't +need a separate goroutine for both channels; see the example). ### Why don't notifications work with NFS, SMB, FUSE, /proc, or /sys? fsnotify requires support from underlying OS to work. The current NFS and SMB @@ -107,6 +112,32 @@ This could be fixed with a polling watcher ([#9]), but it's not yet implemented. [#9]: https://github.com/fsnotify/fsnotify/issues/9 +### Why do I get many Chmod events? +Some programs may generate a lot of attribute changes; for example Spotlight on +macOS, anti-virus programs, backup applications, and some others are known to do +this. As a rule, it's typically best to ignore Chmod events. They're often not +useful, and tend to cause problems. + +Spotlight indexing on macOS can result in multiple events (see [#15]). A +temporary workaround is to add your folder(s) to the *Spotlight Privacy +settings* until we have a native FSEvents implementation (see [#11]). + +[#11]: https://github.com/fsnotify/fsnotify/issues/11 +[#15]: https://github.com/fsnotify/fsnotify/issues/15 + +### Watching a file doesn't work well +Watching individual files (rather than directories) is generally not recommended +as many programs (especially editors) update files atomically: it will write to +a temporary file which is then moved to to destination, overwriting the original +(or some variant thereof). The watcher on the original file is now lost, as that +no longer exists. + +The upshot of this is that a power failure or crash won't leave a half-written +file. + +Watch the parent directory and use `Event.Name` to filter out files you're not +interested in. There is an example of this in `cmd/fsnotify/file.go`. + Platform-specific notes ----------------------- ### Linux @@ -151,11 +182,3 @@ these platforms. The sysctl variables `kern.maxfiles` and `kern.maxfilesperproc` can be used to control the maximum number of open files. - -### macOS -Spotlight indexing on macOS can result in multiple events (see [#15]). A temporary -workaround is to add your folder(s) to the *Spotlight Privacy settings* until we -have a native FSEvents implementation (see [#11]). - -[#11]: https://github.com/fsnotify/fsnotify/issues/11 -[#15]: https://github.com/fsnotify/fsnotify/issues/15 diff --git a/vendor/github.com/fsnotify/fsnotify/backend_fen.go b/vendor/github.com/fsnotify/fsnotify/backend_fen.go index 1a95ad8e7..28497f1dd 100644 --- a/vendor/github.com/fsnotify/fsnotify/backend_fen.go +++ b/vendor/github.com/fsnotify/fsnotify/backend_fen.go @@ -1,10 +1,19 @@ //go:build solaris // +build solaris +// Note: the documentation on the Watcher type and methods is generated from +// mkdoc.zsh + package fsnotify import ( "errors" + "fmt" + "os" + "path/filepath" + "sync" + + "golang.org/x/sys/unix" ) // Watcher watches a set of paths, delivering events on a channel. @@ -17,9 +26,9 @@ import ( // When a file is removed a Remove event won't be emitted until all file // descriptors are closed, and deletes will always emit a Chmod. For example: // -// fp := os.Open("file") -// os.Remove("file") // Triggers Chmod -// fp.Close() // Triggers Remove +// fp := os.Open("file") +// os.Remove("file") // Triggers Chmod +// fp.Close() // Triggers Remove // // This is the event that inotify sends, so not much can be changed about this. // @@ -33,16 +42,16 @@ import ( // // To increase them you can use sysctl or write the value to the /proc file: // -// # Default values on Linux 5.18 -// sysctl fs.inotify.max_user_watches=124983 -// sysctl fs.inotify.max_user_instances=128 +// # Default values on Linux 5.18 +// sysctl fs.inotify.max_user_watches=124983 +// sysctl fs.inotify.max_user_instances=128 // // To make the changes persist on reboot edit /etc/sysctl.conf or // /usr/lib/sysctl.d/50-default.conf (details differ per Linux distro; check // your distro's documentation): // -// fs.inotify.max_user_watches=124983 -// fs.inotify.max_user_instances=128 +// fs.inotify.max_user_watches=124983 +// fs.inotify.max_user_instances=128 // // Reaching the limit will result in a "no space left on device" or "too many open // files" error. @@ -58,14 +67,20 @@ import ( // control the maximum number of open files, as well as /etc/login.conf on BSD // systems. // -// # macOS notes +// # Windows notes +// +// Paths can be added as "C:\path\to\dir", but forward slashes +// ("C:/path/to/dir") will also work. // -// Spotlight indexing on macOS can result in multiple events (see [#15]). A -// temporary workaround is to add your folder(s) to the "Spotlight Privacy -// Settings" until we have a native FSEvents implementation (see [#11]). +// When a watched directory is removed it will always send an event for the +// directory itself, but may not send events for all files in that directory. +// Sometimes it will send events for all times, sometimes it will send no +// events, and often only for some files. // -// [#11]: https://github.com/fsnotify/fsnotify/issues/11 -// [#15]: https://github.com/fsnotify/fsnotify/issues/15 +// The default ReadDirectoryChangesW() buffer size is 64K, which is the largest +// value that is guaranteed to work with SMB filesystems. If you have many +// events in quick succession this may not be enough, and you will have to use +// [WithBufferSize] to increase the value. type Watcher struct { // Events sends the filesystem change events. // @@ -92,44 +107,129 @@ type Watcher struct { // initiated by the user may show up as one or multiple // writes, depending on when the system syncs things to // disk. For example when compiling a large Go program - // you may get hundreds of Write events, so you - // probably want to wait until you've stopped receiving - // them (see the dedup example in cmd/fsnotify). + // you may get hundreds of Write events, and you may + // want to wait until you've stopped receiving them + // (see the dedup example in cmd/fsnotify). + // + // Some systems may send Write event for directories + // when the directory content changes. // // fsnotify.Chmod Attributes were changed. On Linux this is also sent // when a file is removed (or more accurately, when a // link to an inode is removed). On kqueue it's sent - // and on kqueue when a file is truncated. On Windows - // it's never sent. + // when a file is truncated. On Windows it's never + // sent. Events chan Event // Errors sends any errors. + // + // ErrEventOverflow is used to indicate there are too many events: + // + // - inotify: There are too many queued events (fs.inotify.max_queued_events sysctl) + // - windows: The buffer size is too small; WithBufferSize() can be used to increase it. + // - kqueue, fen: Not used. Errors chan error + + mu sync.Mutex + port *unix.EventPort + done chan struct{} // Channel for sending a "quit message" to the reader goroutine + dirs map[string]struct{} // Explicitly watched directories + watches map[string]struct{} // Explicitly watched non-directories } // NewWatcher creates a new Watcher. func NewWatcher() (*Watcher, error) { - return nil, errors.New("FEN based watcher not yet supported for fsnotify\n") + return NewBufferedWatcher(0) } -// Close removes all watches and closes the events channel. +// NewBufferedWatcher creates a new Watcher with a buffered Watcher.Events +// channel. +// +// The main use case for this is situations with a very large number of events +// where the kernel buffer size can't be increased (e.g. due to lack of +// permissions). An unbuffered Watcher will perform better for almost all use +// cases, and whenever possible you will be better off increasing the kernel +// buffers instead of adding a large userspace buffer. +func NewBufferedWatcher(sz uint) (*Watcher, error) { + w := &Watcher{ + Events: make(chan Event, sz), + Errors: make(chan error), + dirs: make(map[string]struct{}), + watches: make(map[string]struct{}), + done: make(chan struct{}), + } + + var err error + w.port, err = unix.NewEventPort() + if err != nil { + return nil, fmt.Errorf("fsnotify.NewWatcher: %w", err) + } + + go w.readEvents() + return w, nil +} + +// sendEvent attempts to send an event to the user, returning true if the event +// was put in the channel successfully and false if the watcher has been closed. +func (w *Watcher) sendEvent(name string, op Op) (sent bool) { + select { + case w.Events <- Event{Name: name, Op: op}: + return true + case <-w.done: + return false + } +} + +// sendError attempts to send an error to the user, returning true if the error +// was put in the channel successfully and false if the watcher has been closed. +func (w *Watcher) sendError(err error) (sent bool) { + select { + case w.Errors <- err: + return true + case <-w.done: + return false + } +} + +func (w *Watcher) isClosed() bool { + select { + case <-w.done: + return true + default: + return false + } +} + +// Close removes all watches and closes the Events channel. func (w *Watcher) Close() error { - return nil + // Take the lock used by associateFile to prevent lingering events from + // being processed after the close + w.mu.Lock() + defer w.mu.Unlock() + if w.isClosed() { + return nil + } + close(w.done) + return w.port.Close() } // Add starts monitoring the path for changes. // -// A path can only be watched once; attempting to watch it more than once will -// return an error. Paths that do not yet exist on the filesystem cannot be -// added. A watch will be automatically removed if the path is deleted. +// A path can only be watched once; watching it more than once is a no-op and will +// not return an error. Paths that do not yet exist on the filesystem cannot be +// watched. // -// A path will remain watched if it gets renamed to somewhere else on the same -// filesystem, but the monitor will get removed if the path gets deleted and -// re-created, or if it's moved to a different filesystem. +// A watch will be automatically removed if the watched path is deleted or +// renamed. The exception is the Windows backend, which doesn't remove the +// watcher on renames. // // Notifications on network filesystems (NFS, SMB, FUSE, etc.) or special // filesystems (/proc, /sys, etc.) generally don't work. // +// Returns [ErrClosed] if [Watcher.Close] was called. +// +// See [Watcher.AddWith] for a version that allows adding options. +// // # Watching directories // // All files in a directory are monitored, including new files that are created @@ -139,15 +239,63 @@ func (w *Watcher) Close() error { // # Watching files // // Watching individual files (rather than directories) is generally not -// recommended as many tools update files atomically. Instead of "just" writing -// to the file a temporary file will be written to first, and if successful the -// temporary file is moved to to destination removing the original, or some -// variant thereof. The watcher on the original file is now lost, as it no -// longer exists. -// -// Instead, watch the parent directory and use Event.Name to filter out files -// you're not interested in. There is an example of this in [cmd/fsnotify/file.go]. -func (w *Watcher) Add(name string) error { +// recommended as many programs (especially editors) update files atomically: it +// will write to a temporary file which is then moved to to destination, +// overwriting the original (or some variant thereof). The watcher on the +// original file is now lost, as that no longer exists. +// +// The upshot of this is that a power failure or crash won't leave a +// half-written file. +// +// Watch the parent directory and use Event.Name to filter out files you're not +// interested in. There is an example of this in cmd/fsnotify/file.go. +func (w *Watcher) Add(name string) error { return w.AddWith(name) } + +// AddWith is like [Watcher.Add], but allows adding options. When using Add() +// the defaults described below are used. +// +// Possible options are: +// +// - [WithBufferSize] sets the buffer size for the Windows backend; no-op on +// other platforms. The default is 64K (65536 bytes). +func (w *Watcher) AddWith(name string, opts ...addOpt) error { + if w.isClosed() { + return ErrClosed + } + if w.port.PathIsWatched(name) { + return nil + } + + _ = getOptions(opts...) + + // Currently we resolve symlinks that were explicitly requested to be + // watched. Otherwise we would use LStat here. + stat, err := os.Stat(name) + if err != nil { + return err + } + + // Associate all files in the directory. + if stat.IsDir() { + err := w.handleDirectory(name, stat, true, w.associateFile) + if err != nil { + return err + } + + w.mu.Lock() + w.dirs[name] = struct{}{} + w.mu.Unlock() + return nil + } + + err = w.associateFile(name, stat, true) + if err != nil { + return err + } + + w.mu.Lock() + w.watches[name] = struct{}{} + w.mu.Unlock() return nil } @@ -157,6 +305,336 @@ func (w *Watcher) Add(name string) error { // /tmp/dir and /tmp/dir/subdir then you will need to remove both. // // Removing a path that has not yet been added returns [ErrNonExistentWatch]. +// +// Returns nil if [Watcher.Close] was called. func (w *Watcher) Remove(name string) error { + if w.isClosed() { + return nil + } + if !w.port.PathIsWatched(name) { + return fmt.Errorf("%w: %s", ErrNonExistentWatch, name) + } + + // The user has expressed an intent. Immediately remove this name from + // whichever watch list it might be in. If it's not in there the delete + // doesn't cause harm. + w.mu.Lock() + delete(w.watches, name) + delete(w.dirs, name) + w.mu.Unlock() + + stat, err := os.Stat(name) + if err != nil { + return err + } + + // Remove associations for every file in the directory. + if stat.IsDir() { + err := w.handleDirectory(name, stat, false, w.dissociateFile) + if err != nil { + return err + } + return nil + } + + err = w.port.DissociatePath(name) + if err != nil { + return err + } + return nil } + +// readEvents contains the main loop that runs in a goroutine watching for events. +func (w *Watcher) readEvents() { + // If this function returns, the watcher has been closed and we can close + // these channels + defer func() { + close(w.Errors) + close(w.Events) + }() + + pevents := make([]unix.PortEvent, 8) + for { + count, err := w.port.Get(pevents, 1, nil) + if err != nil && err != unix.ETIME { + // Interrupted system call (count should be 0) ignore and continue + if errors.Is(err, unix.EINTR) && count == 0 { + continue + } + // Get failed because we called w.Close() + if errors.Is(err, unix.EBADF) && w.isClosed() { + return + } + // There was an error not caused by calling w.Close() + if !w.sendError(err) { + return + } + } + + p := pevents[:count] + for _, pevent := range p { + if pevent.Source != unix.PORT_SOURCE_FILE { + // Event from unexpected source received; should never happen. + if !w.sendError(errors.New("Event from unexpected source received")) { + return + } + continue + } + + err = w.handleEvent(&pevent) + if err != nil { + if !w.sendError(err) { + return + } + } + } + } +} + +func (w *Watcher) handleDirectory(path string, stat os.FileInfo, follow bool, handler func(string, os.FileInfo, bool) error) error { + files, err := os.ReadDir(path) + if err != nil { + return err + } + + // Handle all children of the directory. + for _, entry := range files { + finfo, err := entry.Info() + if err != nil { + return err + } + err = handler(filepath.Join(path, finfo.Name()), finfo, false) + if err != nil { + return err + } + } + + // And finally handle the directory itself. + return handler(path, stat, follow) +} + +// handleEvent might need to emit more than one fsnotify event if the events +// bitmap matches more than one event type (e.g. the file was both modified and +// had the attributes changed between when the association was created and the +// when event was returned) +func (w *Watcher) handleEvent(event *unix.PortEvent) error { + var ( + events = event.Events + path = event.Path + fmode = event.Cookie.(os.FileMode) + reRegister = true + ) + + w.mu.Lock() + _, watchedDir := w.dirs[path] + _, watchedPath := w.watches[path] + w.mu.Unlock() + isWatched := watchedDir || watchedPath + + if events&unix.FILE_DELETE != 0 { + if !w.sendEvent(path, Remove) { + return nil + } + reRegister = false + } + if events&unix.FILE_RENAME_FROM != 0 { + if !w.sendEvent(path, Rename) { + return nil + } + // Don't keep watching the new file name + reRegister = false + } + if events&unix.FILE_RENAME_TO != 0 { + // We don't report a Rename event for this case, because Rename events + // are interpreted as referring to the _old_ name of the file, and in + // this case the event would refer to the new name of the file. This + // type of rename event is not supported by fsnotify. + + // inotify reports a Remove event in this case, so we simulate this + // here. + if !w.sendEvent(path, Remove) { + return nil + } + // Don't keep watching the file that was removed + reRegister = false + } + + // The file is gone, nothing left to do. + if !reRegister { + if watchedDir { + w.mu.Lock() + delete(w.dirs, path) + w.mu.Unlock() + } + if watchedPath { + w.mu.Lock() + delete(w.watches, path) + w.mu.Unlock() + } + return nil + } + + // If we didn't get a deletion the file still exists and we're going to have + // to watch it again. Let's Stat it now so that we can compare permissions + // and have what we need to continue watching the file + + stat, err := os.Lstat(path) + if err != nil { + // This is unexpected, but we should still emit an event. This happens + // most often on "rm -r" of a subdirectory inside a watched directory We + // get a modify event of something happening inside, but by the time we + // get here, the sudirectory is already gone. Clearly we were watching + // this path but now it is gone. Let's tell the user that it was + // removed. + if !w.sendEvent(path, Remove) { + return nil + } + // Suppress extra write events on removed directories; they are not + // informative and can be confusing. + return nil + } + + // resolve symlinks that were explicitly watched as we would have at Add() + // time. this helps suppress spurious Chmod events on watched symlinks + if isWatched { + stat, err = os.Stat(path) + if err != nil { + // The symlink still exists, but the target is gone. Report the + // Remove similar to above. + if !w.sendEvent(path, Remove) { + return nil + } + // Don't return the error + } + } + + if events&unix.FILE_MODIFIED != 0 { + if fmode.IsDir() { + if watchedDir { + if err := w.updateDirectory(path); err != nil { + return err + } + } else { + if !w.sendEvent(path, Write) { + return nil + } + } + } else { + if !w.sendEvent(path, Write) { + return nil + } + } + } + if events&unix.FILE_ATTRIB != 0 && stat != nil { + // Only send Chmod if perms changed + if stat.Mode().Perm() != fmode.Perm() { + if !w.sendEvent(path, Chmod) { + return nil + } + } + } + + if stat != nil { + // If we get here, it means we've hit an event above that requires us to + // continue watching the file or directory + return w.associateFile(path, stat, isWatched) + } + return nil +} + +func (w *Watcher) updateDirectory(path string) error { + // The directory was modified, so we must find unwatched entities and watch + // them. If something was removed from the directory, nothing will happen, + // as everything else should still be watched. + files, err := os.ReadDir(path) + if err != nil { + return err + } + + for _, entry := range files { + path := filepath.Join(path, entry.Name()) + if w.port.PathIsWatched(path) { + continue + } + + finfo, err := entry.Info() + if err != nil { + return err + } + err = w.associateFile(path, finfo, false) + if err != nil { + if !w.sendError(err) { + return nil + } + } + if !w.sendEvent(path, Create) { + return nil + } + } + return nil +} + +func (w *Watcher) associateFile(path string, stat os.FileInfo, follow bool) error { + if w.isClosed() { + return ErrClosed + } + // This is primarily protecting the call to AssociatePath but it is + // important and intentional that the call to PathIsWatched is also + // protected by this mutex. Without this mutex, AssociatePath has been seen + // to error out that the path is already associated. + w.mu.Lock() + defer w.mu.Unlock() + + if w.port.PathIsWatched(path) { + // Remove the old association in favor of this one If we get ENOENT, + // then while the x/sys/unix wrapper still thought that this path was + // associated, the underlying event port did not. This call will have + // cleared up that discrepancy. The most likely cause is that the event + // has fired but we haven't processed it yet. + err := w.port.DissociatePath(path) + if err != nil && err != unix.ENOENT { + return err + } + } + // FILE_NOFOLLOW means we watch symlinks themselves rather than their + // targets. + events := unix.FILE_MODIFIED | unix.FILE_ATTRIB | unix.FILE_NOFOLLOW + if follow { + // We *DO* follow symlinks for explicitly watched entries. + events = unix.FILE_MODIFIED | unix.FILE_ATTRIB + } + return w.port.AssociatePath(path, stat, + events, + stat.Mode()) +} + +func (w *Watcher) dissociateFile(path string, stat os.FileInfo, unused bool) error { + if !w.port.PathIsWatched(path) { + return nil + } + return w.port.DissociatePath(path) +} + +// WatchList returns all paths explicitly added with [Watcher.Add] (and are not +// yet removed). +// +// Returns nil if [Watcher.Close] was called. +func (w *Watcher) WatchList() []string { + if w.isClosed() { + return nil + } + + w.mu.Lock() + defer w.mu.Unlock() + + entries := make([]string, 0, len(w.watches)+len(w.dirs)) + for pathname := range w.dirs { + entries = append(entries, pathname) + } + for pathname := range w.watches { + entries = append(entries, pathname) + } + + return entries +} diff --git a/vendor/github.com/fsnotify/fsnotify/backend_inotify.go b/vendor/github.com/fsnotify/fsnotify/backend_inotify.go index 54c77fbb0..921c1c1e4 100644 --- a/vendor/github.com/fsnotify/fsnotify/backend_inotify.go +++ b/vendor/github.com/fsnotify/fsnotify/backend_inotify.go @@ -1,5 +1,8 @@ -//go:build linux -// +build linux +//go:build linux && !appengine +// +build linux,!appengine + +// Note: the documentation on the Watcher type and methods is generated from +// mkdoc.zsh package fsnotify @@ -26,9 +29,9 @@ import ( // When a file is removed a Remove event won't be emitted until all file // descriptors are closed, and deletes will always emit a Chmod. For example: // -// fp := os.Open("file") -// os.Remove("file") // Triggers Chmod -// fp.Close() // Triggers Remove +// fp := os.Open("file") +// os.Remove("file") // Triggers Chmod +// fp.Close() // Triggers Remove // // This is the event that inotify sends, so not much can be changed about this. // @@ -42,16 +45,16 @@ import ( // // To increase them you can use sysctl or write the value to the /proc file: // -// # Default values on Linux 5.18 -// sysctl fs.inotify.max_user_watches=124983 -// sysctl fs.inotify.max_user_instances=128 +// # Default values on Linux 5.18 +// sysctl fs.inotify.max_user_watches=124983 +// sysctl fs.inotify.max_user_instances=128 // // To make the changes persist on reboot edit /etc/sysctl.conf or // /usr/lib/sysctl.d/50-default.conf (details differ per Linux distro; check // your distro's documentation): // -// fs.inotify.max_user_watches=124983 -// fs.inotify.max_user_instances=128 +// fs.inotify.max_user_watches=124983 +// fs.inotify.max_user_instances=128 // // Reaching the limit will result in a "no space left on device" or "too many open // files" error. @@ -67,14 +70,20 @@ import ( // control the maximum number of open files, as well as /etc/login.conf on BSD // systems. // -// # macOS notes +// # Windows notes +// +// Paths can be added as "C:\path\to\dir", but forward slashes +// ("C:/path/to/dir") will also work. // -// Spotlight indexing on macOS can result in multiple events (see [#15]). A -// temporary workaround is to add your folder(s) to the "Spotlight Privacy -// Settings" until we have a native FSEvents implementation (see [#11]). +// When a watched directory is removed it will always send an event for the +// directory itself, but may not send events for all files in that directory. +// Sometimes it will send events for all times, sometimes it will send no +// events, and often only for some files. // -// [#11]: https://github.com/fsnotify/fsnotify/issues/11 -// [#15]: https://github.com/fsnotify/fsnotify/issues/15 +// The default ReadDirectoryChangesW() buffer size is 64K, which is the largest +// value that is guaranteed to work with SMB filesystems. If you have many +// events in quick succession this may not be enough, and you will have to use +// [WithBufferSize] to increase the value. type Watcher struct { // Events sends the filesystem change events. // @@ -101,36 +110,148 @@ type Watcher struct { // initiated by the user may show up as one or multiple // writes, depending on when the system syncs things to // disk. For example when compiling a large Go program - // you may get hundreds of Write events, so you - // probably want to wait until you've stopped receiving - // them (see the dedup example in cmd/fsnotify). + // you may get hundreds of Write events, and you may + // want to wait until you've stopped receiving them + // (see the dedup example in cmd/fsnotify). + // + // Some systems may send Write event for directories + // when the directory content changes. // // fsnotify.Chmod Attributes were changed. On Linux this is also sent // when a file is removed (or more accurately, when a // link to an inode is removed). On kqueue it's sent - // and on kqueue when a file is truncated. On Windows - // it's never sent. + // when a file is truncated. On Windows it's never + // sent. Events chan Event // Errors sends any errors. + // + // ErrEventOverflow is used to indicate there are too many events: + // + // - inotify: There are too many queued events (fs.inotify.max_queued_events sysctl) + // - windows: The buffer size is too small; WithBufferSize() can be used to increase it. + // - kqueue, fen: Not used. Errors chan error // Store fd here as os.File.Read() will no longer return on close after // calling Fd(). See: https://github.com/golang/go/issues/26439 fd int - mu sync.Mutex // Map access inotifyFile *os.File - watches map[string]*watch // Map of inotify watches (key: path) - paths map[int]string // Map of watched paths (key: watch descriptor) - done chan struct{} // Channel for sending a "quit message" to the reader goroutine - doneResp chan struct{} // Channel to respond to Close + watches *watches + done chan struct{} // Channel for sending a "quit message" to the reader goroutine + closeMu sync.Mutex + doneResp chan struct{} // Channel to respond to Close +} + +type ( + watches struct { + mu sync.RWMutex + wd map[uint32]*watch // wd → watch + path map[string]uint32 // pathname → wd + } + watch struct { + wd uint32 // Watch descriptor (as returned by the inotify_add_watch() syscall) + flags uint32 // inotify flags of this watch (see inotify(7) for the list of valid flags) + path string // Watch path. + } +) + +func newWatches() *watches { + return &watches{ + wd: make(map[uint32]*watch), + path: make(map[string]uint32), + } +} + +func (w *watches) len() int { + w.mu.RLock() + defer w.mu.RUnlock() + return len(w.wd) +} + +func (w *watches) add(ww *watch) { + w.mu.Lock() + defer w.mu.Unlock() + w.wd[ww.wd] = ww + w.path[ww.path] = ww.wd +} + +func (w *watches) remove(wd uint32) { + w.mu.Lock() + defer w.mu.Unlock() + delete(w.path, w.wd[wd].path) + delete(w.wd, wd) +} + +func (w *watches) removePath(path string) (uint32, bool) { + w.mu.Lock() + defer w.mu.Unlock() + + wd, ok := w.path[path] + if !ok { + return 0, false + } + + delete(w.path, path) + delete(w.wd, wd) + + return wd, true +} + +func (w *watches) byPath(path string) *watch { + w.mu.RLock() + defer w.mu.RUnlock() + return w.wd[w.path[path]] +} + +func (w *watches) byWd(wd uint32) *watch { + w.mu.RLock() + defer w.mu.RUnlock() + return w.wd[wd] +} + +func (w *watches) updatePath(path string, f func(*watch) (*watch, error)) error { + w.mu.Lock() + defer w.mu.Unlock() + + var existing *watch + wd, ok := w.path[path] + if ok { + existing = w.wd[wd] + } + + upd, err := f(existing) + if err != nil { + return err + } + if upd != nil { + w.wd[upd.wd] = upd + w.path[upd.path] = upd.wd + + if upd.wd != wd { + delete(w.wd, wd) + } + } + + return nil } // NewWatcher creates a new Watcher. func NewWatcher() (*Watcher, error) { - // Create inotify fd - // Need to set the FD to nonblocking mode in order for SetDeadline methods to work - // Otherwise, blocking i/o operations won't terminate on close + return NewBufferedWatcher(0) +} + +// NewBufferedWatcher creates a new Watcher with a buffered Watcher.Events +// channel. +// +// The main use case for this is situations with a very large number of events +// where the kernel buffer size can't be increased (e.g. due to lack of +// permissions). An unbuffered Watcher will perform better for almost all use +// cases, and whenever possible you will be better off increasing the kernel +// buffers instead of adding a large userspace buffer. +func NewBufferedWatcher(sz uint) (*Watcher, error) { + // Need to set nonblocking mode for SetDeadline to work, otherwise blocking + // I/O operations won't terminate on close. fd, errno := unix.InotifyInit1(unix.IN_CLOEXEC | unix.IN_NONBLOCK) if fd == -1 { return nil, errno @@ -139,9 +260,8 @@ func NewWatcher() (*Watcher, error) { w := &Watcher{ fd: fd, inotifyFile: os.NewFile(uintptr(fd), ""), - watches: make(map[string]*watch), - paths: make(map[int]string), - Events: make(chan Event), + watches: newWatches(), + Events: make(chan Event, sz), Errors: make(chan error), done: make(chan struct{}), doneResp: make(chan struct{}), @@ -157,8 +277,8 @@ func (w *Watcher) sendEvent(e Event) bool { case w.Events <- e: return true case <-w.done: + return false } - return false } // Returns true if the error was sent, or false if watcher is closed. @@ -180,17 +300,15 @@ func (w *Watcher) isClosed() bool { } } -// Close removes all watches and closes the events channel. +// Close removes all watches and closes the Events channel. func (w *Watcher) Close() error { - w.mu.Lock() + w.closeMu.Lock() if w.isClosed() { - w.mu.Unlock() + w.closeMu.Unlock() return nil } - - // Send 'close' signal to goroutine, and set the Watcher to closed. close(w.done) - w.mu.Unlock() + w.closeMu.Unlock() // Causes any blocking reads to return with an error, provided the file // still supports deadline operations. @@ -207,17 +325,21 @@ func (w *Watcher) Close() error { // Add starts monitoring the path for changes. // -// A path can only be watched once; attempting to watch it more than once will -// return an error. Paths that do not yet exist on the filesystem cannot be -// added. A watch will be automatically removed if the path is deleted. +// A path can only be watched once; watching it more than once is a no-op and will +// not return an error. Paths that do not yet exist on the filesystem cannot be +// watched. // -// A path will remain watched if it gets renamed to somewhere else on the same -// filesystem, but the monitor will get removed if the path gets deleted and -// re-created, or if it's moved to a different filesystem. +// A watch will be automatically removed if the watched path is deleted or +// renamed. The exception is the Windows backend, which doesn't remove the +// watcher on renames. // // Notifications on network filesystems (NFS, SMB, FUSE, etc.) or special // filesystems (/proc, /sys, etc.) generally don't work. // +// Returns [ErrClosed] if [Watcher.Close] was called. +// +// See [Watcher.AddWith] for a version that allows adding options. +// // # Watching directories // // All files in a directory are monitored, including new files that are created @@ -227,44 +349,59 @@ func (w *Watcher) Close() error { // # Watching files // // Watching individual files (rather than directories) is generally not -// recommended as many tools update files atomically. Instead of "just" writing -// to the file a temporary file will be written to first, and if successful the -// temporary file is moved to to destination removing the original, or some -// variant thereof. The watcher on the original file is now lost, as it no -// longer exists. -// -// Instead, watch the parent directory and use Event.Name to filter out files -// you're not interested in. There is an example of this in [cmd/fsnotify/file.go]. -func (w *Watcher) Add(name string) error { - name = filepath.Clean(name) +// recommended as many programs (especially editors) update files atomically: it +// will write to a temporary file which is then moved to to destination, +// overwriting the original (or some variant thereof). The watcher on the +// original file is now lost, as that no longer exists. +// +// The upshot of this is that a power failure or crash won't leave a +// half-written file. +// +// Watch the parent directory and use Event.Name to filter out files you're not +// interested in. There is an example of this in cmd/fsnotify/file.go. +func (w *Watcher) Add(name string) error { return w.AddWith(name) } + +// AddWith is like [Watcher.Add], but allows adding options. When using Add() +// the defaults described below are used. +// +// Possible options are: +// +// - [WithBufferSize] sets the buffer size for the Windows backend; no-op on +// other platforms. The default is 64K (65536 bytes). +func (w *Watcher) AddWith(name string, opts ...addOpt) error { if w.isClosed() { - return errors.New("inotify instance already closed") + return ErrClosed } + name = filepath.Clean(name) + _ = getOptions(opts...) + var flags uint32 = unix.IN_MOVED_TO | unix.IN_MOVED_FROM | unix.IN_CREATE | unix.IN_ATTRIB | unix.IN_MODIFY | unix.IN_MOVE_SELF | unix.IN_DELETE | unix.IN_DELETE_SELF - w.mu.Lock() - defer w.mu.Unlock() - watchEntry := w.watches[name] - if watchEntry != nil { - flags |= watchEntry.flags | unix.IN_MASK_ADD - } - wd, errno := unix.InotifyAddWatch(w.fd, name, flags) - if wd == -1 { - return errno - } + return w.watches.updatePath(name, func(existing *watch) (*watch, error) { + if existing != nil { + flags |= existing.flags | unix.IN_MASK_ADD + } - if watchEntry == nil { - w.watches[name] = &watch{wd: uint32(wd), flags: flags} - w.paths[wd] = name - } else { - watchEntry.wd = uint32(wd) - watchEntry.flags = flags - } + wd, err := unix.InotifyAddWatch(w.fd, name, flags) + if wd == -1 { + return nil, err + } - return nil + if existing == nil { + return &watch{ + wd: uint32(wd), + path: name, + flags: flags, + }, nil + } + + existing.wd = uint32(wd) + existing.flags = flags + return existing, nil + }) } // Remove stops monitoring the path for changes. @@ -273,32 +410,22 @@ func (w *Watcher) Add(name string) error { // /tmp/dir and /tmp/dir/subdir then you will need to remove both. // // Removing a path that has not yet been added returns [ErrNonExistentWatch]. +// +// Returns nil if [Watcher.Close] was called. func (w *Watcher) Remove(name string) error { - name = filepath.Clean(name) - - // Fetch the watch. - w.mu.Lock() - defer w.mu.Unlock() - watch, ok := w.watches[name] + if w.isClosed() { + return nil + } + return w.remove(filepath.Clean(name)) +} - // Remove it from inotify. +func (w *Watcher) remove(name string) error { + wd, ok := w.watches.removePath(name) if !ok { return fmt.Errorf("%w: %s", ErrNonExistentWatch, name) } - // We successfully removed the watch if InotifyRmWatch doesn't return an - // error, we need to clean up our internal state to ensure it matches - // inotify's kernel state. - delete(w.paths, int(watch.wd)) - delete(w.watches, name) - - // inotify_rm_watch will return EINVAL if the file has been deleted; - // the inotify will already have been removed. - // watches and pathes are deleted in ignoreLinux() implicitly and asynchronously - // by calling inotify_rm_watch() below. e.g. readEvents() goroutine receives IN_IGNORE - // so that EINVAL means that the wd is being rm_watch()ed or its file removed - // by another thread and we have not received IN_IGNORE event. - success, errno := unix.InotifyRmWatch(w.fd, watch.wd) + success, errno := unix.InotifyRmWatch(w.fd, wd) if success == -1 { // TODO: Perhaps it's not helpful to return an error here in every case; // The only two possible errors are: @@ -312,28 +439,28 @@ func (w *Watcher) Remove(name string) error { // are watching is deleted. return errno } - return nil } -// WatchList returns all paths added with [Add] (and are not yet removed). +// WatchList returns all paths explicitly added with [Watcher.Add] (and are not +// yet removed). +// +// Returns nil if [Watcher.Close] was called. func (w *Watcher) WatchList() []string { - w.mu.Lock() - defer w.mu.Unlock() + if w.isClosed() { + return nil + } - entries := make([]string, 0, len(w.watches)) - for pathname := range w.watches { + entries := make([]string, 0, w.watches.len()) + w.watches.mu.RLock() + for pathname := range w.watches.path { entries = append(entries, pathname) } + w.watches.mu.RUnlock() return entries } -type watch struct { - wd uint32 // Watch descriptor (as returned by the inotify_add_watch() syscall) - flags uint32 // inotify flags of this watch (see inotify(7) for the list of valid flags) -} - // readEvents reads from the inotify file descriptor, converts the // received events into Event objects and sends them via the Events channel func (w *Watcher) readEvents() { @@ -367,14 +494,11 @@ func (w *Watcher) readEvents() { if n < unix.SizeofInotifyEvent { var err error if n == 0 { - // If EOF is received. This should really never happen. - err = io.EOF + err = io.EOF // If EOF is received. This should really never happen. } else if n < 0 { - // If an error occurred while reading. - err = errno + err = errno // If an error occurred while reading. } else { - // Read was too short. - err = errors.New("notify: short read in readEvents()") + err = errors.New("notify: short read in readEvents()") // Read was too short. } if !w.sendError(err) { return @@ -403,18 +527,29 @@ func (w *Watcher) readEvents() { // doesn't append the filename to the event, but we would like to always fill the // the "Name" field with a valid filename. We retrieve the path of the watch from // the "paths" map. - w.mu.Lock() - name, ok := w.paths[int(raw.Wd)] - // IN_DELETE_SELF occurs when the file/directory being watched is removed. - // This is a sign to clean up the maps, otherwise we are no longer in sync - // with the inotify kernel state which has already deleted the watch - // automatically. - if ok && mask&unix.IN_DELETE_SELF == unix.IN_DELETE_SELF { - delete(w.paths, int(raw.Wd)) - delete(w.watches, name) + watch := w.watches.byWd(uint32(raw.Wd)) + + // inotify will automatically remove the watch on deletes; just need + // to clean our state here. + if watch != nil && mask&unix.IN_DELETE_SELF == unix.IN_DELETE_SELF { + w.watches.remove(watch.wd) + } + // We can't really update the state when a watched path is moved; + // only IN_MOVE_SELF is sent and not IN_MOVED_{FROM,TO}. So remove + // the watch. + if watch != nil && mask&unix.IN_MOVE_SELF == unix.IN_MOVE_SELF { + err := w.remove(watch.path) + if err != nil && !errors.Is(err, ErrNonExistentWatch) { + if !w.sendError(err) { + return + } + } } - w.mu.Unlock() + var name string + if watch != nil { + name = watch.path + } if nameLen > 0 { // Point "bytes" at the first byte of the filename bytes := (*[unix.PathMax]byte)(unsafe.Pointer(&buf[offset+unix.SizeofInotifyEvent]))[:nameLen:nameLen] diff --git a/vendor/github.com/fsnotify/fsnotify/backend_kqueue.go b/vendor/github.com/fsnotify/fsnotify/backend_kqueue.go index 29087469b..063a0915a 100644 --- a/vendor/github.com/fsnotify/fsnotify/backend_kqueue.go +++ b/vendor/github.com/fsnotify/fsnotify/backend_kqueue.go @@ -1,12 +1,14 @@ //go:build freebsd || openbsd || netbsd || dragonfly || darwin // +build freebsd openbsd netbsd dragonfly darwin +// Note: the documentation on the Watcher type and methods is generated from +// mkdoc.zsh + package fsnotify import ( "errors" "fmt" - "io/ioutil" "os" "path/filepath" "sync" @@ -24,9 +26,9 @@ import ( // When a file is removed a Remove event won't be emitted until all file // descriptors are closed, and deletes will always emit a Chmod. For example: // -// fp := os.Open("file") -// os.Remove("file") // Triggers Chmod -// fp.Close() // Triggers Remove +// fp := os.Open("file") +// os.Remove("file") // Triggers Chmod +// fp.Close() // Triggers Remove // // This is the event that inotify sends, so not much can be changed about this. // @@ -40,16 +42,16 @@ import ( // // To increase them you can use sysctl or write the value to the /proc file: // -// # Default values on Linux 5.18 -// sysctl fs.inotify.max_user_watches=124983 -// sysctl fs.inotify.max_user_instances=128 +// # Default values on Linux 5.18 +// sysctl fs.inotify.max_user_watches=124983 +// sysctl fs.inotify.max_user_instances=128 // // To make the changes persist on reboot edit /etc/sysctl.conf or // /usr/lib/sysctl.d/50-default.conf (details differ per Linux distro; check // your distro's documentation): // -// fs.inotify.max_user_watches=124983 -// fs.inotify.max_user_instances=128 +// fs.inotify.max_user_watches=124983 +// fs.inotify.max_user_instances=128 // // Reaching the limit will result in a "no space left on device" or "too many open // files" error. @@ -65,14 +67,20 @@ import ( // control the maximum number of open files, as well as /etc/login.conf on BSD // systems. // -// # macOS notes +// # Windows notes +// +// Paths can be added as "C:\path\to\dir", but forward slashes +// ("C:/path/to/dir") will also work. // -// Spotlight indexing on macOS can result in multiple events (see [#15]). A -// temporary workaround is to add your folder(s) to the "Spotlight Privacy -// Settings" until we have a native FSEvents implementation (see [#11]). +// When a watched directory is removed it will always send an event for the +// directory itself, but may not send events for all files in that directory. +// Sometimes it will send events for all times, sometimes it will send no +// events, and often only for some files. // -// [#11]: https://github.com/fsnotify/fsnotify/issues/11 -// [#15]: https://github.com/fsnotify/fsnotify/issues/15 +// The default ReadDirectoryChangesW() buffer size is 64K, which is the largest +// value that is guaranteed to work with SMB filesystems. If you have many +// events in quick succession this may not be enough, and you will have to use +// [WithBufferSize] to increase the value. type Watcher struct { // Events sends the filesystem change events. // @@ -99,18 +107,27 @@ type Watcher struct { // initiated by the user may show up as one or multiple // writes, depending on when the system syncs things to // disk. For example when compiling a large Go program - // you may get hundreds of Write events, so you - // probably want to wait until you've stopped receiving - // them (see the dedup example in cmd/fsnotify). + // you may get hundreds of Write events, and you may + // want to wait until you've stopped receiving them + // (see the dedup example in cmd/fsnotify). + // + // Some systems may send Write event for directories + // when the directory content changes. // // fsnotify.Chmod Attributes were changed. On Linux this is also sent // when a file is removed (or more accurately, when a // link to an inode is removed). On kqueue it's sent - // and on kqueue when a file is truncated. On Windows - // it's never sent. + // when a file is truncated. On Windows it's never + // sent. Events chan Event // Errors sends any errors. + // + // ErrEventOverflow is used to indicate there are too many events: + // + // - inotify: There are too many queued events (fs.inotify.max_queued_events sysctl) + // - windows: The buffer size is too small; WithBufferSize() can be used to increase it. + // - kqueue, fen: Not used. Errors chan error done chan struct{} @@ -133,6 +150,18 @@ type pathInfo struct { // NewWatcher creates a new Watcher. func NewWatcher() (*Watcher, error) { + return NewBufferedWatcher(0) +} + +// NewBufferedWatcher creates a new Watcher with a buffered Watcher.Events +// channel. +// +// The main use case for this is situations with a very large number of events +// where the kernel buffer size can't be increased (e.g. due to lack of +// permissions). An unbuffered Watcher will perform better for almost all use +// cases, and whenever possible you will be better off increasing the kernel +// buffers instead of adding a large userspace buffer. +func NewBufferedWatcher(sz uint) (*Watcher, error) { kq, closepipe, err := newKqueue() if err != nil { return nil, err @@ -147,7 +176,7 @@ func NewWatcher() (*Watcher, error) { paths: make(map[int]pathInfo), fileExists: make(map[string]struct{}), userWatches: make(map[string]struct{}), - Events: make(chan Event), + Events: make(chan Event, sz), Errors: make(chan error), done: make(chan struct{}), } @@ -197,8 +226,8 @@ func (w *Watcher) sendEvent(e Event) bool { case w.Events <- e: return true case <-w.done: + return false } - return false } // Returns true if the error was sent, or false if watcher is closed. @@ -207,11 +236,11 @@ func (w *Watcher) sendError(err error) bool { case w.Errors <- err: return true case <-w.done: + return false } - return false } -// Close removes all watches and closes the events channel. +// Close removes all watches and closes the Events channel. func (w *Watcher) Close() error { w.mu.Lock() if w.isClosed { @@ -239,17 +268,21 @@ func (w *Watcher) Close() error { // Add starts monitoring the path for changes. // -// A path can only be watched once; attempting to watch it more than once will -// return an error. Paths that do not yet exist on the filesystem cannot be -// added. A watch will be automatically removed if the path is deleted. +// A path can only be watched once; watching it more than once is a no-op and will +// not return an error. Paths that do not yet exist on the filesystem cannot be +// watched. // -// A path will remain watched if it gets renamed to somewhere else on the same -// filesystem, but the monitor will get removed if the path gets deleted and -// re-created, or if it's moved to a different filesystem. +// A watch will be automatically removed if the watched path is deleted or +// renamed. The exception is the Windows backend, which doesn't remove the +// watcher on renames. // // Notifications on network filesystems (NFS, SMB, FUSE, etc.) or special // filesystems (/proc, /sys, etc.) generally don't work. // +// Returns [ErrClosed] if [Watcher.Close] was called. +// +// See [Watcher.AddWith] for a version that allows adding options. +// // # Watching directories // // All files in a directory are monitored, including new files that are created @@ -259,15 +292,28 @@ func (w *Watcher) Close() error { // # Watching files // // Watching individual files (rather than directories) is generally not -// recommended as many tools update files atomically. Instead of "just" writing -// to the file a temporary file will be written to first, and if successful the -// temporary file is moved to to destination removing the original, or some -// variant thereof. The watcher on the original file is now lost, as it no -// longer exists. -// -// Instead, watch the parent directory and use Event.Name to filter out files -// you're not interested in. There is an example of this in [cmd/fsnotify/file.go]. -func (w *Watcher) Add(name string) error { +// recommended as many programs (especially editors) update files atomically: it +// will write to a temporary file which is then moved to to destination, +// overwriting the original (or some variant thereof). The watcher on the +// original file is now lost, as that no longer exists. +// +// The upshot of this is that a power failure or crash won't leave a +// half-written file. +// +// Watch the parent directory and use Event.Name to filter out files you're not +// interested in. There is an example of this in cmd/fsnotify/file.go. +func (w *Watcher) Add(name string) error { return w.AddWith(name) } + +// AddWith is like [Watcher.Add], but allows adding options. When using Add() +// the defaults described below are used. +// +// Possible options are: +// +// - [WithBufferSize] sets the buffer size for the Windows backend; no-op on +// other platforms. The default is 64K (65536 bytes). +func (w *Watcher) AddWith(name string, opts ...addOpt) error { + _ = getOptions(opts...) + w.mu.Lock() w.userWatches[name] = struct{}{} w.mu.Unlock() @@ -281,9 +327,19 @@ func (w *Watcher) Add(name string) error { // /tmp/dir and /tmp/dir/subdir then you will need to remove both. // // Removing a path that has not yet been added returns [ErrNonExistentWatch]. +// +// Returns nil if [Watcher.Close] was called. func (w *Watcher) Remove(name string) error { + return w.remove(name, true) +} + +func (w *Watcher) remove(name string, unwatchFiles bool) error { name = filepath.Clean(name) w.mu.Lock() + if w.isClosed { + w.mu.Unlock() + return nil + } watchfd, ok := w.watches[name] w.mu.Unlock() if !ok { @@ -315,7 +371,7 @@ func (w *Watcher) Remove(name string) error { w.mu.Unlock() // Find all watched paths that are in this directory that are not external. - if isDir { + if unwatchFiles && isDir { var pathsToRemove []string w.mu.Lock() for fd := range w.watchesByDir[name] { @@ -326,20 +382,25 @@ func (w *Watcher) Remove(name string) error { } w.mu.Unlock() for _, name := range pathsToRemove { - // Since these are internal, not much sense in propagating error - // to the user, as that will just confuse them with an error about - // a path they did not explicitly watch themselves. + // Since these are internal, not much sense in propagating error to + // the user, as that will just confuse them with an error about a + // path they did not explicitly watch themselves. w.Remove(name) } } - return nil } -// WatchList returns all paths added with [Add] (and are not yet removed). +// WatchList returns all paths explicitly added with [Watcher.Add] (and are not +// yet removed). +// +// Returns nil if [Watcher.Close] was called. func (w *Watcher) WatchList() []string { w.mu.Lock() defer w.mu.Unlock() + if w.isClosed { + return nil + } entries := make([]string, 0, len(w.userWatches)) for pathname := range w.userWatches { @@ -352,18 +413,18 @@ func (w *Watcher) WatchList() []string { // Watch all events (except NOTE_EXTEND, NOTE_LINK, NOTE_REVOKE) const noteAllEvents = unix.NOTE_DELETE | unix.NOTE_WRITE | unix.NOTE_ATTRIB | unix.NOTE_RENAME -// addWatch adds name to the watched file set. -// The flags are interpreted as described in kevent(2). -// Returns the real path to the file which was added, if any, which may be different from the one passed in the case of symlinks. +// addWatch adds name to the watched file set; the flags are interpreted as +// described in kevent(2). +// +// Returns the real path to the file which was added, with symlinks resolved. func (w *Watcher) addWatch(name string, flags uint32) (string, error) { var isDir bool - // Make ./name and name equivalent name = filepath.Clean(name) w.mu.Lock() if w.isClosed { w.mu.Unlock() - return "", errors.New("kevent instance already closed") + return "", ErrClosed } watchfd, alreadyWatching := w.watches[name] // We already have a watch, but we can still override flags. @@ -383,27 +444,30 @@ func (w *Watcher) addWatch(name string, flags uint32) (string, error) { return "", nil } - // Follow Symlinks - // - // Linux can add unresolvable symlinks to the watch list without issue, - // and Windows can't do symlinks period. To maintain consistency, we - // will act like everything is fine if the link can't be resolved. - // There will simply be no file events for broken symlinks. Hence the - // returns of nil on errors. + // Follow Symlinks. if fi.Mode()&os.ModeSymlink == os.ModeSymlink { - name, err = filepath.EvalSymlinks(name) + link, err := os.Readlink(name) if err != nil { + // Return nil because Linux can add unresolvable symlinks to the + // watch list without problems, so maintain consistency with + // that. There will be no file events for broken symlinks. + // TODO: more specific check; returns os.PathError; ENOENT? return "", nil } w.mu.Lock() - _, alreadyWatching = w.watches[name] + _, alreadyWatching = w.watches[link] w.mu.Unlock() if alreadyWatching { - return name, nil + // Add to watches so we don't get spurious Create events later + // on when we diff the directories. + w.watches[name] = 0 + w.fileExists[name] = struct{}{} + return link, nil } + name = link fi, err = os.Lstat(name) if err != nil { return "", nil @@ -411,7 +475,7 @@ func (w *Watcher) addWatch(name string, flags uint32) (string, error) { } // Retry on EINTR; open() can return EINTR in practice on macOS. - // See #354, and go issues 11180 and 39237. + // See #354, and Go issues 11180 and 39237. for { watchfd, err = unix.Open(name, openMode, 0) if err == nil { @@ -444,14 +508,13 @@ func (w *Watcher) addWatch(name string, flags uint32) (string, error) { w.watchesByDir[parentName] = watchesByDir } watchesByDir[watchfd] = struct{}{} - w.paths[watchfd] = pathInfo{name: name, isDir: isDir} w.mu.Unlock() } if isDir { - // Watch the directory if it has not been watched before, - // or if it was watched before, but perhaps only a NOTE_DELETE (watchDirectoryFiles) + // Watch the directory if it has not been watched before, or if it was + // watched before, but perhaps only a NOTE_DELETE (watchDirectoryFiles) w.mu.Lock() watchDir := (flags&unix.NOTE_WRITE) == unix.NOTE_WRITE && @@ -473,13 +536,10 @@ func (w *Watcher) addWatch(name string, flags uint32) (string, error) { // Event values that it sends down the Events channel. func (w *Watcher) readEvents() { defer func() { - err := unix.Close(w.kq) - if err != nil { - w.Errors <- err - } - unix.Close(w.closepipe[0]) close(w.Events) close(w.Errors) + _ = unix.Close(w.kq) + unix.Close(w.closepipe[0]) }() eventBuffer := make([]unix.Kevent_t, 10) @@ -513,18 +573,8 @@ func (w *Watcher) readEvents() { event := w.newEvent(path.name, mask) - if path.isDir && !event.Has(Remove) { - // Double check to make sure the directory exists. This can - // happen when we do a rm -fr on a recursively watched folders - // and we receive a modification event first but the folder has - // been deleted and later receive the delete event. - if _, err := os.Lstat(event.Name); os.IsNotExist(err) { - event.Op |= Remove - } - } - if event.Has(Rename) || event.Has(Remove) { - w.Remove(event.Name) + w.remove(event.Name, false) w.mu.Lock() delete(w.fileExists, event.Name) w.mu.Unlock() @@ -540,26 +590,30 @@ func (w *Watcher) readEvents() { } if event.Has(Remove) { - // Look for a file that may have overwritten this. - // For example, mv f1 f2 will delete f2, then create f2. + // Look for a file that may have overwritten this; for example, + // mv f1 f2 will delete f2, then create f2. if path.isDir { fileDir := filepath.Clean(event.Name) w.mu.Lock() _, found := w.watches[fileDir] w.mu.Unlock() if found { - // make sure the directory exists before we watch for changes. When we - // do a recursive watch and perform rm -fr, the parent directory might - // have gone missing, ignore the missing directory and let the - // upcoming delete event remove the watch from the parent directory. - if _, err := os.Lstat(fileDir); err == nil { - w.sendDirectoryChangeEvents(fileDir) + err := w.sendDirectoryChangeEvents(fileDir) + if err != nil { + if !w.sendError(err) { + closed = true + } } } } else { filePath := filepath.Clean(event.Name) - if fileInfo, err := os.Lstat(filePath); err == nil { - w.sendFileCreatedEventIfNew(filePath, fileInfo) + if fi, err := os.Lstat(filePath); err == nil { + err := w.sendFileCreatedEventIfNew(filePath, fi) + if err != nil { + if !w.sendError(err) { + closed = true + } + } } } } @@ -582,21 +636,31 @@ func (w *Watcher) newEvent(name string, mask uint32) Event { if mask&unix.NOTE_ATTRIB == unix.NOTE_ATTRIB { e.Op |= Chmod } + // No point sending a write and delete event at the same time: if it's gone, + // then it's gone. + if e.Op.Has(Write) && e.Op.Has(Remove) { + e.Op &^= Write + } return e } // watchDirectoryFiles to mimic inotify when adding a watch on a directory func (w *Watcher) watchDirectoryFiles(dirPath string) error { // Get all files - files, err := ioutil.ReadDir(dirPath) + files, err := os.ReadDir(dirPath) if err != nil { return err } - for _, fileInfo := range files { - path := filepath.Join(dirPath, fileInfo.Name()) + for _, f := range files { + path := filepath.Join(dirPath, f.Name()) + + fi, err := f.Info() + if err != nil { + return fmt.Errorf("%q: %w", path, err) + } - cleanPath, err := w.internalWatch(path, fileInfo) + cleanPath, err := w.internalWatch(path, fi) if err != nil { // No permission to read the file; that's not a problem: just skip. // But do add it to w.fileExists to prevent it from being picked up @@ -606,7 +670,7 @@ func (w *Watcher) watchDirectoryFiles(dirPath string) error { case errors.Is(err, unix.EACCES) || errors.Is(err, unix.EPERM): cleanPath = filepath.Clean(path) default: - return fmt.Errorf("%q: %w", filepath.Join(dirPath, fileInfo.Name()), err) + return fmt.Errorf("%q: %w", path, err) } } @@ -622,26 +686,37 @@ func (w *Watcher) watchDirectoryFiles(dirPath string) error { // // This functionality is to have the BSD watcher match the inotify, which sends // a create event for files created in a watched directory. -func (w *Watcher) sendDirectoryChangeEvents(dir string) { - // Get all files - files, err := ioutil.ReadDir(dir) +func (w *Watcher) sendDirectoryChangeEvents(dir string) error { + files, err := os.ReadDir(dir) if err != nil { - if !w.sendError(fmt.Errorf("fsnotify.sendDirectoryChangeEvents: %w", err)) { - return + // Directory no longer exists: we can ignore this safely. kqueue will + // still give us the correct events. + if errors.Is(err, os.ErrNotExist) { + return nil } + return fmt.Errorf("fsnotify.sendDirectoryChangeEvents: %w", err) } - // Search for new files - for _, fi := range files { - err := w.sendFileCreatedEventIfNew(filepath.Join(dir, fi.Name()), fi) + for _, f := range files { + fi, err := f.Info() if err != nil { - return + return fmt.Errorf("fsnotify.sendDirectoryChangeEvents: %w", err) + } + + err = w.sendFileCreatedEventIfNew(filepath.Join(dir, fi.Name()), fi) + if err != nil { + // Don't need to send an error if this file isn't readable. + if errors.Is(err, unix.EACCES) || errors.Is(err, unix.EPERM) { + return nil + } + return fmt.Errorf("fsnotify.sendDirectoryChangeEvents: %w", err) } } + return nil } // sendFileCreatedEvent sends a create event if the file isn't already being tracked. -func (w *Watcher) sendFileCreatedEventIfNew(filePath string, fileInfo os.FileInfo) (err error) { +func (w *Watcher) sendFileCreatedEventIfNew(filePath string, fi os.FileInfo) (err error) { w.mu.Lock() _, doesExist := w.fileExists[filePath] w.mu.Unlock() @@ -652,7 +727,7 @@ func (w *Watcher) sendFileCreatedEventIfNew(filePath string, fileInfo os.FileInf } // like watchDirectoryFiles (but without doing another ReadDir) - filePath, err = w.internalWatch(filePath, fileInfo) + filePath, err = w.internalWatch(filePath, fi) if err != nil { return err } @@ -664,10 +739,10 @@ func (w *Watcher) sendFileCreatedEventIfNew(filePath string, fileInfo os.FileInf return nil } -func (w *Watcher) internalWatch(name string, fileInfo os.FileInfo) (string, error) { - if fileInfo.IsDir() { - // mimic Linux providing delete events for subdirectories - // but preserve the flags used if currently watching subdirectory +func (w *Watcher) internalWatch(name string, fi os.FileInfo) (string, error) { + if fi.IsDir() { + // mimic Linux providing delete events for subdirectories, but preserve + // the flags used if currently watching subdirectory w.mu.Lock() flags := w.dirFlags[name] w.mu.Unlock() diff --git a/vendor/github.com/fsnotify/fsnotify/backend_other.go b/vendor/github.com/fsnotify/fsnotify/backend_other.go index a9bb1c3c4..d34a23c01 100644 --- a/vendor/github.com/fsnotify/fsnotify/backend_other.go +++ b/vendor/github.com/fsnotify/fsnotify/backend_other.go @@ -1,39 +1,169 @@ -//go:build !darwin && !dragonfly && !freebsd && !openbsd && !linux && !netbsd && !solaris && !windows -// +build !darwin,!dragonfly,!freebsd,!openbsd,!linux,!netbsd,!solaris,!windows +//go:build appengine || (!darwin && !dragonfly && !freebsd && !openbsd && !linux && !netbsd && !solaris && !windows) +// +build appengine !darwin,!dragonfly,!freebsd,!openbsd,!linux,!netbsd,!solaris,!windows + +// Note: the documentation on the Watcher type and methods is generated from +// mkdoc.zsh package fsnotify -import ( - "fmt" - "runtime" -) +import "errors" -// Watcher watches a set of files, delivering events to a channel. -type Watcher struct{} +// Watcher watches a set of paths, delivering events on a channel. +// +// A watcher should not be copied (e.g. pass it by pointer, rather than by +// value). +// +// # Linux notes +// +// When a file is removed a Remove event won't be emitted until all file +// descriptors are closed, and deletes will always emit a Chmod. For example: +// +// fp := os.Open("file") +// os.Remove("file") // Triggers Chmod +// fp.Close() // Triggers Remove +// +// This is the event that inotify sends, so not much can be changed about this. +// +// The fs.inotify.max_user_watches sysctl variable specifies the upper limit +// for the number of watches per user, and fs.inotify.max_user_instances +// specifies the maximum number of inotify instances per user. Every Watcher you +// create is an "instance", and every path you add is a "watch". +// +// These are also exposed in /proc as /proc/sys/fs/inotify/max_user_watches and +// /proc/sys/fs/inotify/max_user_instances +// +// To increase them you can use sysctl or write the value to the /proc file: +// +// # Default values on Linux 5.18 +// sysctl fs.inotify.max_user_watches=124983 +// sysctl fs.inotify.max_user_instances=128 +// +// To make the changes persist on reboot edit /etc/sysctl.conf or +// /usr/lib/sysctl.d/50-default.conf (details differ per Linux distro; check +// your distro's documentation): +// +// fs.inotify.max_user_watches=124983 +// fs.inotify.max_user_instances=128 +// +// Reaching the limit will result in a "no space left on device" or "too many open +// files" error. +// +// # kqueue notes (macOS, BSD) +// +// kqueue requires opening a file descriptor for every file that's being watched; +// so if you're watching a directory with five files then that's six file +// descriptors. You will run in to your system's "max open files" limit faster on +// these platforms. +// +// The sysctl variables kern.maxfiles and kern.maxfilesperproc can be used to +// control the maximum number of open files, as well as /etc/login.conf on BSD +// systems. +// +// # Windows notes +// +// Paths can be added as "C:\path\to\dir", but forward slashes +// ("C:/path/to/dir") will also work. +// +// When a watched directory is removed it will always send an event for the +// directory itself, but may not send events for all files in that directory. +// Sometimes it will send events for all times, sometimes it will send no +// events, and often only for some files. +// +// The default ReadDirectoryChangesW() buffer size is 64K, which is the largest +// value that is guaranteed to work with SMB filesystems. If you have many +// events in quick succession this may not be enough, and you will have to use +// [WithBufferSize] to increase the value. +type Watcher struct { + // Events sends the filesystem change events. + // + // fsnotify can send the following events; a "path" here can refer to a + // file, directory, symbolic link, or special file like a FIFO. + // + // fsnotify.Create A new path was created; this may be followed by one + // or more Write events if data also gets written to a + // file. + // + // fsnotify.Remove A path was removed. + // + // fsnotify.Rename A path was renamed. A rename is always sent with the + // old path as Event.Name, and a Create event will be + // sent with the new name. Renames are only sent for + // paths that are currently watched; e.g. moving an + // unmonitored file into a monitored directory will + // show up as just a Create. Similarly, renaming a file + // to outside a monitored directory will show up as + // only a Rename. + // + // fsnotify.Write A file or named pipe was written to. A Truncate will + // also trigger a Write. A single "write action" + // initiated by the user may show up as one or multiple + // writes, depending on when the system syncs things to + // disk. For example when compiling a large Go program + // you may get hundreds of Write events, and you may + // want to wait until you've stopped receiving them + // (see the dedup example in cmd/fsnotify). + // + // Some systems may send Write event for directories + // when the directory content changes. + // + // fsnotify.Chmod Attributes were changed. On Linux this is also sent + // when a file is removed (or more accurately, when a + // link to an inode is removed). On kqueue it's sent + // when a file is truncated. On Windows it's never + // sent. + Events chan Event + + // Errors sends any errors. + // + // ErrEventOverflow is used to indicate there are too many events: + // + // - inotify: There are too many queued events (fs.inotify.max_queued_events sysctl) + // - windows: The buffer size is too small; WithBufferSize() can be used to increase it. + // - kqueue, fen: Not used. + Errors chan error +} // NewWatcher creates a new Watcher. func NewWatcher() (*Watcher, error) { - return nil, fmt.Errorf("fsnotify not supported on %s", runtime.GOOS) + return nil, errors.New("fsnotify not supported on the current platform") } -// Close removes all watches and closes the events channel. -func (w *Watcher) Close() error { - return nil -} +// NewBufferedWatcher creates a new Watcher with a buffered Watcher.Events +// channel. +// +// The main use case for this is situations with a very large number of events +// where the kernel buffer size can't be increased (e.g. due to lack of +// permissions). An unbuffered Watcher will perform better for almost all use +// cases, and whenever possible you will be better off increasing the kernel +// buffers instead of adding a large userspace buffer. +func NewBufferedWatcher(sz uint) (*Watcher, error) { return NewWatcher() } + +// Close removes all watches and closes the Events channel. +func (w *Watcher) Close() error { return nil } + +// WatchList returns all paths explicitly added with [Watcher.Add] (and are not +// yet removed). +// +// Returns nil if [Watcher.Close] was called. +func (w *Watcher) WatchList() []string { return nil } // Add starts monitoring the path for changes. // -// A path can only be watched once; attempting to watch it more than once will -// return an error. Paths that do not yet exist on the filesystem cannot be -// added. A watch will be automatically removed if the path is deleted. +// A path can only be watched once; watching it more than once is a no-op and will +// not return an error. Paths that do not yet exist on the filesystem cannot be +// watched. // -// A path will remain watched if it gets renamed to somewhere else on the same -// filesystem, but the monitor will get removed if the path gets deleted and -// re-created, or if it's moved to a different filesystem. +// A watch will be automatically removed if the watched path is deleted or +// renamed. The exception is the Windows backend, which doesn't remove the +// watcher on renames. // // Notifications on network filesystems (NFS, SMB, FUSE, etc.) or special // filesystems (/proc, /sys, etc.) generally don't work. // +// Returns [ErrClosed] if [Watcher.Close] was called. +// +// See [Watcher.AddWith] for a version that allows adding options. +// // # Watching directories // // All files in a directory are monitored, including new files that are created @@ -43,17 +173,26 @@ func (w *Watcher) Close() error { // # Watching files // // Watching individual files (rather than directories) is generally not -// recommended as many tools update files atomically. Instead of "just" writing -// to the file a temporary file will be written to first, and if successful the -// temporary file is moved to to destination removing the original, or some -// variant thereof. The watcher on the original file is now lost, as it no -// longer exists. -// -// Instead, watch the parent directory and use Event.Name to filter out files -// you're not interested in. There is an example of this in [cmd/fsnotify/file.go]. -func (w *Watcher) Add(name string) error { - return nil -} +// recommended as many programs (especially editors) update files atomically: it +// will write to a temporary file which is then moved to to destination, +// overwriting the original (or some variant thereof). The watcher on the +// original file is now lost, as that no longer exists. +// +// The upshot of this is that a power failure or crash won't leave a +// half-written file. +// +// Watch the parent directory and use Event.Name to filter out files you're not +// interested in. There is an example of this in cmd/fsnotify/file.go. +func (w *Watcher) Add(name string) error { return nil } + +// AddWith is like [Watcher.Add], but allows adding options. When using Add() +// the defaults described below are used. +// +// Possible options are: +// +// - [WithBufferSize] sets the buffer size for the Windows backend; no-op on +// other platforms. The default is 64K (65536 bytes). +func (w *Watcher) AddWith(name string, opts ...addOpt) error { return nil } // Remove stops monitoring the path for changes. // @@ -61,6 +200,6 @@ func (w *Watcher) Add(name string) error { // /tmp/dir and /tmp/dir/subdir then you will need to remove both. // // Removing a path that has not yet been added returns [ErrNonExistentWatch]. -func (w *Watcher) Remove(name string) error { - return nil -} +// +// Returns nil if [Watcher.Close] was called. +func (w *Watcher) Remove(name string) error { return nil } diff --git a/vendor/github.com/fsnotify/fsnotify/backend_windows.go b/vendor/github.com/fsnotify/fsnotify/backend_windows.go index ae392867c..9bc91e5d6 100644 --- a/vendor/github.com/fsnotify/fsnotify/backend_windows.go +++ b/vendor/github.com/fsnotify/fsnotify/backend_windows.go @@ -1,6 +1,13 @@ //go:build windows // +build windows +// Windows backend based on ReadDirectoryChangesW() +// +// https://learn.microsoft.com/en-us/windows/win32/api/winbase/nf-winbase-readdirectorychangesw +// +// Note: the documentation on the Watcher type and methods is generated from +// mkdoc.zsh + package fsnotify import ( @@ -27,9 +34,9 @@ import ( // When a file is removed a Remove event won't be emitted until all file // descriptors are closed, and deletes will always emit a Chmod. For example: // -// fp := os.Open("file") -// os.Remove("file") // Triggers Chmod -// fp.Close() // Triggers Remove +// fp := os.Open("file") +// os.Remove("file") // Triggers Chmod +// fp.Close() // Triggers Remove // // This is the event that inotify sends, so not much can be changed about this. // @@ -43,16 +50,16 @@ import ( // // To increase them you can use sysctl or write the value to the /proc file: // -// # Default values on Linux 5.18 -// sysctl fs.inotify.max_user_watches=124983 -// sysctl fs.inotify.max_user_instances=128 +// # Default values on Linux 5.18 +// sysctl fs.inotify.max_user_watches=124983 +// sysctl fs.inotify.max_user_instances=128 // // To make the changes persist on reboot edit /etc/sysctl.conf or // /usr/lib/sysctl.d/50-default.conf (details differ per Linux distro; check // your distro's documentation): // -// fs.inotify.max_user_watches=124983 -// fs.inotify.max_user_instances=128 +// fs.inotify.max_user_watches=124983 +// fs.inotify.max_user_instances=128 // // Reaching the limit will result in a "no space left on device" or "too many open // files" error. @@ -68,14 +75,20 @@ import ( // control the maximum number of open files, as well as /etc/login.conf on BSD // systems. // -// # macOS notes +// # Windows notes // -// Spotlight indexing on macOS can result in multiple events (see [#15]). A -// temporary workaround is to add your folder(s) to the "Spotlight Privacy -// Settings" until we have a native FSEvents implementation (see [#11]). +// Paths can be added as "C:\path\to\dir", but forward slashes +// ("C:/path/to/dir") will also work. // -// [#11]: https://github.com/fsnotify/fsnotify/issues/11 -// [#15]: https://github.com/fsnotify/fsnotify/issues/15 +// When a watched directory is removed it will always send an event for the +// directory itself, but may not send events for all files in that directory. +// Sometimes it will send events for all times, sometimes it will send no +// events, and often only for some files. +// +// The default ReadDirectoryChangesW() buffer size is 64K, which is the largest +// value that is guaranteed to work with SMB filesystems. If you have many +// events in quick succession this may not be enough, and you will have to use +// [WithBufferSize] to increase the value. type Watcher struct { // Events sends the filesystem change events. // @@ -102,31 +115,52 @@ type Watcher struct { // initiated by the user may show up as one or multiple // writes, depending on when the system syncs things to // disk. For example when compiling a large Go program - // you may get hundreds of Write events, so you - // probably want to wait until you've stopped receiving - // them (see the dedup example in cmd/fsnotify). + // you may get hundreds of Write events, and you may + // want to wait until you've stopped receiving them + // (see the dedup example in cmd/fsnotify). + // + // Some systems may send Write event for directories + // when the directory content changes. // // fsnotify.Chmod Attributes were changed. On Linux this is also sent // when a file is removed (or more accurately, when a // link to an inode is removed). On kqueue it's sent - // and on kqueue when a file is truncated. On Windows - // it's never sent. + // when a file is truncated. On Windows it's never + // sent. Events chan Event // Errors sends any errors. + // + // ErrEventOverflow is used to indicate there are too many events: + // + // - inotify: There are too many queued events (fs.inotify.max_queued_events sysctl) + // - windows: The buffer size is too small; WithBufferSize() can be used to increase it. + // - kqueue, fen: Not used. Errors chan error port windows.Handle // Handle to completion port input chan *input // Inputs to the reader are sent on this channel quit chan chan<- error - mu sync.Mutex // Protects access to watches, isClosed - watches watchMap // Map of watches (key: i-number) - isClosed bool // Set to true when Close() is first called + mu sync.Mutex // Protects access to watches, closed + watches watchMap // Map of watches (key: i-number) + closed bool // Set to true when Close() is first called } // NewWatcher creates a new Watcher. func NewWatcher() (*Watcher, error) { + return NewBufferedWatcher(50) +} + +// NewBufferedWatcher creates a new Watcher with a buffered Watcher.Events +// channel. +// +// The main use case for this is situations with a very large number of events +// where the kernel buffer size can't be increased (e.g. due to lack of +// permissions). An unbuffered Watcher will perform better for almost all use +// cases, and whenever possible you will be better off increasing the kernel +// buffers instead of adding a large userspace buffer. +func NewBufferedWatcher(sz uint) (*Watcher, error) { port, err := windows.CreateIoCompletionPort(windows.InvalidHandle, 0, 0, 0) if err != nil { return nil, os.NewSyscallError("CreateIoCompletionPort", err) @@ -135,7 +169,7 @@ func NewWatcher() (*Watcher, error) { port: port, watches: make(watchMap), input: make(chan *input, 1), - Events: make(chan Event, 50), + Events: make(chan Event, sz), Errors: make(chan error), quit: make(chan chan<- error, 1), } @@ -143,6 +177,12 @@ func NewWatcher() (*Watcher, error) { return w, nil } +func (w *Watcher) isClosed() bool { + w.mu.Lock() + defer w.mu.Unlock() + return w.closed +} + func (w *Watcher) sendEvent(name string, mask uint64) bool { if mask == 0 { return false @@ -167,14 +207,14 @@ func (w *Watcher) sendError(err error) bool { return false } -// Close removes all watches and closes the events channel. +// Close removes all watches and closes the Events channel. func (w *Watcher) Close() error { - w.mu.Lock() - if w.isClosed { - w.mu.Unlock() + if w.isClosed() { return nil } - w.isClosed = true + + w.mu.Lock() + w.closed = true w.mu.Unlock() // Send "quit" message to the reader goroutine @@ -188,17 +228,21 @@ func (w *Watcher) Close() error { // Add starts monitoring the path for changes. // -// A path can only be watched once; attempting to watch it more than once will -// return an error. Paths that do not yet exist on the filesystem cannot be -// added. A watch will be automatically removed if the path is deleted. +// A path can only be watched once; watching it more than once is a no-op and will +// not return an error. Paths that do not yet exist on the filesystem cannot be +// watched. // -// A path will remain watched if it gets renamed to somewhere else on the same -// filesystem, but the monitor will get removed if the path gets deleted and -// re-created, or if it's moved to a different filesystem. +// A watch will be automatically removed if the watched path is deleted or +// renamed. The exception is the Windows backend, which doesn't remove the +// watcher on renames. // // Notifications on network filesystems (NFS, SMB, FUSE, etc.) or special // filesystems (/proc, /sys, etc.) generally don't work. // +// Returns [ErrClosed] if [Watcher.Close] was called. +// +// See [Watcher.AddWith] for a version that allows adding options. +// // # Watching directories // // All files in a directory are monitored, including new files that are created @@ -208,27 +252,41 @@ func (w *Watcher) Close() error { // # Watching files // // Watching individual files (rather than directories) is generally not -// recommended as many tools update files atomically. Instead of "just" writing -// to the file a temporary file will be written to first, and if successful the -// temporary file is moved to to destination removing the original, or some -// variant thereof. The watcher on the original file is now lost, as it no -// longer exists. -// -// Instead, watch the parent directory and use Event.Name to filter out files -// you're not interested in. There is an example of this in [cmd/fsnotify/file.go]. -func (w *Watcher) Add(name string) error { - w.mu.Lock() - if w.isClosed { - w.mu.Unlock() - return errors.New("watcher already closed") +// recommended as many programs (especially editors) update files atomically: it +// will write to a temporary file which is then moved to to destination, +// overwriting the original (or some variant thereof). The watcher on the +// original file is now lost, as that no longer exists. +// +// The upshot of this is that a power failure or crash won't leave a +// half-written file. +// +// Watch the parent directory and use Event.Name to filter out files you're not +// interested in. There is an example of this in cmd/fsnotify/file.go. +func (w *Watcher) Add(name string) error { return w.AddWith(name) } + +// AddWith is like [Watcher.Add], but allows adding options. When using Add() +// the defaults described below are used. +// +// Possible options are: +// +// - [WithBufferSize] sets the buffer size for the Windows backend; no-op on +// other platforms. The default is 64K (65536 bytes). +func (w *Watcher) AddWith(name string, opts ...addOpt) error { + if w.isClosed() { + return ErrClosed + } + + with := getOptions(opts...) + if with.bufsize < 4096 { + return fmt.Errorf("fsnotify.WithBufferSize: buffer size cannot be smaller than 4096 bytes") } - w.mu.Unlock() in := &input{ - op: opAddWatch, - path: filepath.Clean(name), - flags: sysFSALLEVENTS, - reply: make(chan error), + op: opAddWatch, + path: filepath.Clean(name), + flags: sysFSALLEVENTS, + reply: make(chan error), + bufsize: with.bufsize, } w.input <- in if err := w.wakeupReader(); err != nil { @@ -243,7 +301,13 @@ func (w *Watcher) Add(name string) error { // /tmp/dir and /tmp/dir/subdir then you will need to remove both. // // Removing a path that has not yet been added returns [ErrNonExistentWatch]. +// +// Returns nil if [Watcher.Close] was called. func (w *Watcher) Remove(name string) error { + if w.isClosed() { + return nil + } + in := &input{ op: opRemoveWatch, path: filepath.Clean(name), @@ -256,8 +320,15 @@ func (w *Watcher) Remove(name string) error { return <-in.reply } -// WatchList returns all paths added with [Add] (and are not yet removed). +// WatchList returns all paths explicitly added with [Watcher.Add] (and are not +// yet removed). +// +// Returns nil if [Watcher.Close] was called. func (w *Watcher) WatchList() []string { + if w.isClosed() { + return nil + } + w.mu.Lock() defer w.mu.Unlock() @@ -279,7 +350,6 @@ func (w *Watcher) WatchList() []string { // This should all be removed at some point, and just use windows.FILE_NOTIFY_* const ( sysFSALLEVENTS = 0xfff - sysFSATTRIB = 0x4 sysFSCREATE = 0x100 sysFSDELETE = 0x200 sysFSDELETESELF = 0x400 @@ -305,9 +375,6 @@ func (w *Watcher) newEvent(name string, mask uint32) Event { if mask&sysFSMOVE == sysFSMOVE || mask&sysFSMOVESELF == sysFSMOVESELF || mask&sysFSMOVEDFROM == sysFSMOVEDFROM { e.Op |= Rename } - if mask&sysFSATTRIB == sysFSATTRIB { - e.Op |= Chmod - } return e } @@ -321,10 +388,11 @@ const ( ) type input struct { - op int - path string - flags uint32 - reply chan error + op int + path string + flags uint32 + bufsize int + reply chan error } type inode struct { @@ -334,13 +402,14 @@ type inode struct { } type watch struct { - ov windows.Overlapped - ino *inode // i-number - path string // Directory path - mask uint64 // Directory itself is being watched with these notify flags - names map[string]uint64 // Map of names being watched and their notify flags - rename string // Remembers the old name while renaming a file - buf [65536]byte // 64K buffer + ov windows.Overlapped + ino *inode // i-number + recurse bool // Recursive watch? + path string // Directory path + mask uint64 // Directory itself is being watched with these notify flags + names map[string]uint64 // Map of names being watched and their notify flags + rename string // Remembers the old name while renaming a file + buf []byte // buffer, allocated later } type ( @@ -413,7 +482,10 @@ func (m watchMap) set(ino *inode, watch *watch) { } // Must run within the I/O thread. -func (w *Watcher) addWatch(pathname string, flags uint64) error { +func (w *Watcher) addWatch(pathname string, flags uint64, bufsize int) error { + //pathname, recurse := recursivePath(pathname) + recurse := false + dir, err := w.getDir(pathname) if err != nil { return err @@ -433,9 +505,11 @@ func (w *Watcher) addWatch(pathname string, flags uint64) error { return os.NewSyscallError("CreateIoCompletionPort", err) } watchEntry = &watch{ - ino: ino, - path: dir, - names: make(map[string]uint64), + ino: ino, + path: dir, + names: make(map[string]uint64), + recurse: recurse, + buf: make([]byte, bufsize), } w.mu.Lock() w.watches.set(ino, watchEntry) @@ -465,6 +539,8 @@ func (w *Watcher) addWatch(pathname string, flags uint64) error { // Must run within the I/O thread. func (w *Watcher) remWatch(pathname string) error { + pathname, recurse := recursivePath(pathname) + dir, err := w.getDir(pathname) if err != nil { return err @@ -478,6 +554,10 @@ func (w *Watcher) remWatch(pathname string) error { watch := w.watches.get(ino) w.mu.Unlock() + if recurse && !watch.recurse { + return fmt.Errorf("can't use \\... with non-recursive watch %q", pathname) + } + err = windows.CloseHandle(ino.handle) if err != nil { w.sendError(os.NewSyscallError("CloseHandle", err)) @@ -535,8 +615,11 @@ func (w *Watcher) startRead(watch *watch) error { return nil } - rdErr := windows.ReadDirectoryChanges(watch.ino.handle, &watch.buf[0], - uint32(unsafe.Sizeof(watch.buf)), false, mask, nil, &watch.ov, 0) + // We need to pass the array, rather than the slice. + hdr := (*reflect.SliceHeader)(unsafe.Pointer(&watch.buf)) + rdErr := windows.ReadDirectoryChanges(watch.ino.handle, + (*byte)(unsafe.Pointer(hdr.Data)), uint32(hdr.Len), + watch.recurse, mask, nil, &watch.ov, 0) if rdErr != nil { err := os.NewSyscallError("ReadDirectoryChanges", rdErr) if rdErr == windows.ERROR_ACCESS_DENIED && watch.mask&provisional == 0 { @@ -563,9 +646,8 @@ func (w *Watcher) readEvents() { runtime.LockOSThread() for { + // This error is handled after the watch == nil check below. qErr := windows.GetQueuedCompletionStatus(w.port, &n, &key, &ov, windows.INFINITE) - // This error is handled after the watch == nil check below. NOTE: this - // seems odd, note sure if it's correct. watch := (*watch)(unsafe.Pointer(ov)) if watch == nil { @@ -595,7 +677,7 @@ func (w *Watcher) readEvents() { case in := <-w.input: switch in.op { case opAddWatch: - in.reply <- w.addWatch(in.path, uint64(in.flags)) + in.reply <- w.addWatch(in.path, uint64(in.flags), in.bufsize) case opRemoveWatch: in.reply <- w.remWatch(in.path) } @@ -605,6 +687,8 @@ func (w *Watcher) readEvents() { } switch qErr { + case nil: + // No error case windows.ERROR_MORE_DATA: if watch == nil { w.sendError(errors.New("ERROR_MORE_DATA has unexpectedly null lpOverlapped buffer")) @@ -626,13 +710,12 @@ func (w *Watcher) readEvents() { default: w.sendError(os.NewSyscallError("GetQueuedCompletionPort", qErr)) continue - case nil: } var offset uint32 for { if n == 0 { - w.sendError(errors.New("short read in readEvents()")) + w.sendError(ErrEventOverflow) break } @@ -703,8 +786,9 @@ func (w *Watcher) readEvents() { // Error! if offset >= n { + //lint:ignore ST1005 Windows should be capitalized w.sendError(errors.New( - "Windows system assumed buffer larger than it is, events have likely been missed.")) + "Windows system assumed buffer larger than it is, events have likely been missed")) break } } @@ -720,9 +804,6 @@ func (w *Watcher) toWindowsFlags(mask uint64) uint32 { if mask&sysFSMODIFY != 0 { m |= windows.FILE_NOTIFY_CHANGE_LAST_WRITE } - if mask&sysFSATTRIB != 0 { - m |= windows.FILE_NOTIFY_CHANGE_ATTRIBUTES - } if mask&(sysFSMOVE|sysFSCREATE|sysFSDELETE) != 0 { m |= windows.FILE_NOTIFY_CHANGE_FILE_NAME | windows.FILE_NOTIFY_CHANGE_DIR_NAME } diff --git a/vendor/github.com/fsnotify/fsnotify/fsnotify.go b/vendor/github.com/fsnotify/fsnotify/fsnotify.go index 30a5bf0f0..24c99cc49 100644 --- a/vendor/github.com/fsnotify/fsnotify/fsnotify.go +++ b/vendor/github.com/fsnotify/fsnotify/fsnotify.go @@ -1,13 +1,18 @@ -//go:build !plan9 -// +build !plan9 - // Package fsnotify provides a cross-platform interface for file system // notifications. +// +// Currently supported systems: +// +// Linux 2.6.32+ via inotify +// BSD, macOS via kqueue +// Windows via ReadDirectoryChangesW +// illumos via FEN package fsnotify import ( "errors" "fmt" + "path/filepath" "strings" ) @@ -33,34 +38,52 @@ type Op uint32 // The operations fsnotify can trigger; see the documentation on [Watcher] for a // full description, and check them with [Event.Has]. const ( + // A new pathname was created. Create Op = 1 << iota + + // The pathname was written to; this does *not* mean the write has finished, + // and a write can be followed by more writes. Write + + // The path was removed; any watches on it will be removed. Some "remove" + // operations may trigger a Rename if the file is actually moved (for + // example "remove to trash" is often a rename). Remove + + // The path was renamed to something else; any watched on it will be + // removed. Rename + + // File attributes were changed. + // + // It's generally not recommended to take action on this event, as it may + // get triggered very frequently by some software. For example, Spotlight + // indexing on macOS, anti-virus software, backup software, etc. Chmod ) -// Common errors that can be reported by a watcher +// Common errors that can be reported. var ( - ErrNonExistentWatch = errors.New("can't remove non-existent watcher") - ErrEventOverflow = errors.New("fsnotify queue overflow") + ErrNonExistentWatch = errors.New("fsnotify: can't remove non-existent watch") + ErrEventOverflow = errors.New("fsnotify: queue or buffer overflow") + ErrClosed = errors.New("fsnotify: watcher already closed") ) -func (op Op) String() string { +func (o Op) String() string { var b strings.Builder - if op.Has(Create) { + if o.Has(Create) { b.WriteString("|CREATE") } - if op.Has(Remove) { + if o.Has(Remove) { b.WriteString("|REMOVE") } - if op.Has(Write) { + if o.Has(Write) { b.WriteString("|WRITE") } - if op.Has(Rename) { + if o.Has(Rename) { b.WriteString("|RENAME") } - if op.Has(Chmod) { + if o.Has(Chmod) { b.WriteString("|CHMOD") } if b.Len() == 0 { @@ -70,7 +93,7 @@ func (op Op) String() string { } // Has reports if this operation has the given operation. -func (o Op) Has(h Op) bool { return o&h == h } +func (o Op) Has(h Op) bool { return o&h != 0 } // Has reports if this event has the given operation. func (e Event) Has(op Op) bool { return e.Op.Has(op) } @@ -79,3 +102,45 @@ func (e Event) Has(op Op) bool { return e.Op.Has(op) } func (e Event) String() string { return fmt.Sprintf("%-13s %q", e.Op.String(), e.Name) } + +type ( + addOpt func(opt *withOpts) + withOpts struct { + bufsize int + } +) + +var defaultOpts = withOpts{ + bufsize: 65536, // 64K +} + +func getOptions(opts ...addOpt) withOpts { + with := defaultOpts + for _, o := range opts { + o(&with) + } + return with +} + +// WithBufferSize sets the [ReadDirectoryChangesW] buffer size. +// +// This only has effect on Windows systems, and is a no-op for other backends. +// +// The default value is 64K (65536 bytes) which is the highest value that works +// on all filesystems and should be enough for most applications, but if you +// have a large burst of events it may not be enough. You can increase it if +// you're hitting "queue or buffer overflow" errors ([ErrEventOverflow]). +// +// [ReadDirectoryChangesW]: https://learn.microsoft.com/en-gb/windows/win32/api/winbase/nf-winbase-readdirectorychangesw +func WithBufferSize(bytes int) addOpt { + return func(opt *withOpts) { opt.bufsize = bytes } +} + +// Check if this path is recursive (ends with "/..." or "\..."), and return the +// path with the /... stripped. +func recursivePath(path string) (string, bool) { + if filepath.Base(path) == "..." { + return filepath.Dir(path), true + } + return path, false +} diff --git a/vendor/github.com/fsnotify/fsnotify/mkdoc.zsh b/vendor/github.com/fsnotify/fsnotify/mkdoc.zsh index b09ef7683..99012ae65 100644 --- a/vendor/github.com/fsnotify/fsnotify/mkdoc.zsh +++ b/vendor/github.com/fsnotify/fsnotify/mkdoc.zsh @@ -2,8 +2,8 @@ [ "${ZSH_VERSION:-}" = "" ] && echo >&2 "Only works with zsh" && exit 1 setopt err_exit no_unset pipefail extended_glob -# Simple script to update the godoc comments on all watchers. Probably took me -# more time to write this than doing it manually, but ah well 🙃 +# Simple script to update the godoc comments on all watchers so you don't need +# to update the same comment 5 times. watcher=$(<: %s%s", indent, formatType(value), commonRepresentation, formatValue(value, indentation)) @@ -302,7 +302,7 @@ func formatType(v reflect.Value) string { case reflect.Map: return fmt.Sprintf("%s | len:%d", v.Type(), v.Len()) default: - return fmt.Sprintf("%s", v.Type()) + return v.Type().String() } } diff --git a/vendor/github.com/onsi/gomega/gomega_dsl.go b/vendor/github.com/onsi/gomega/gomega_dsl.go index 872592bfb..c271a366a 100644 --- a/vendor/github.com/onsi/gomega/gomega_dsl.go +++ b/vendor/github.com/onsi/gomega/gomega_dsl.go @@ -22,7 +22,7 @@ import ( "github.com/onsi/gomega/types" ) -const GOMEGA_VERSION = "1.27.6" +const GOMEGA_VERSION = "1.30.0" const nilGomegaPanic = `You are trying to make an assertion, but haven't registered Gomega's fail handler. If you're using Ginkgo then you probably forgot to put your assertion in an It(). @@ -242,7 +242,7 @@ func ExpectWithOffset(offset int, actual interface{}, extra ...interface{}) Asse Eventually enables making assertions on asynchronous behavior. Eventually checks that an assertion *eventually* passes. Eventually blocks when called and attempts an assertion periodically until it passes or a timeout occurs. Both the timeout and polling interval are configurable as optional arguments. -The first optional argument is the timeout (which defaults to 1s), the second is the polling interval (which defaults to 10ms). Both intervals can be specified as time.Duration, parsable duration strings or floats/integers (in which case they are interpreted as seconds). In addition an optional context.Context can be passed in - Eventually will keep trying until either the timeout epxires or the context is cancelled, whichever comes first. +The first optional argument is the timeout (which defaults to 1s), the second is the polling interval (which defaults to 10ms). Both intervals can be specified as time.Duration, parsable duration strings or floats/integers (in which case they are interpreted as seconds). In addition an optional context.Context can be passed in - Eventually will keep trying until either the timeout expires or the context is cancelled, whichever comes first. Eventually works with any Gomega compatible matcher and supports making assertions against three categories of actual value: @@ -313,13 +313,13 @@ It is important to note that the function passed into Eventually is invoked *syn }).Should(BeNumerically(">=", 17)) }, SpecTimeout(time.Second)) -you an also use Eventually().WithContext(ctx) to pass in the context. Passed-in contexts play nicely with paseed-in arguments as long as the context appears first. You can rewrite the above example as: +you an also use Eventually().WithContext(ctx) to pass in the context. Passed-in contexts play nicely with passed-in arguments as long as the context appears first. You can rewrite the above example as: It("fetches the correct count", func(ctx SpecContext) { Eventually(client.FetchCount).WithContext(ctx).WithArguments("/users").Should(BeNumerically(">=", 17)) }, SpecTimeout(time.Second)) -Either way the context passd to Eventually is also passed to the underlying funciton. Now, when Ginkgo cancels the context both the FetchCount client and Gomega will be informed and can exit. +Either way the context passd to Eventually is also passed to the underlying function. Now, when Ginkgo cancels the context both the FetchCount client and Gomega will be informed and can exit. **Category 3: Making assertions _in_ the function passed into Eventually** @@ -349,7 +349,7 @@ For example: will rerun the function until all assertions pass. -You can also pass additional arugments to functions that take a Gomega. The only rule is that the Gomega argument must be first. If you also want to pass the context attached to Eventually you must ensure that is the second argument. For example: +You can also pass additional arguments to functions that take a Gomega. The only rule is that the Gomega argument must be first. If you also want to pass the context attached to Eventually you must ensure that is the second argument. For example: Eventually(func(g Gomega, ctx context.Context, path string, expected ...string){ tok, err := client.GetToken(ctx) diff --git a/vendor/github.com/onsi/gomega/matchers.go b/vendor/github.com/onsi/gomega/matchers.go index b832f3dba..43f994374 100644 --- a/vendor/github.com/onsi/gomega/matchers.go +++ b/vendor/github.com/onsi/gomega/matchers.go @@ -1,6 +1,7 @@ package gomega import ( + "fmt" "time" "github.com/google/go-cmp/cmp" @@ -52,15 +53,31 @@ func BeNil() types.GomegaMatcher { } // BeTrue succeeds if actual is true +// +// In general, it's better to use `BeTrueBecause(reason)` to provide a more useful error message if a true check fails. func BeTrue() types.GomegaMatcher { return &matchers.BeTrueMatcher{} } // BeFalse succeeds if actual is false +// +// In general, it's better to use `BeFalseBecause(reason)` to provide a more useful error message if a false check fails. func BeFalse() types.GomegaMatcher { return &matchers.BeFalseMatcher{} } +// BeTrueBecause succeeds if actual is true and displays the provided reason if it is false +// fmt.Sprintf is used to render the reason +func BeTrueBecause(format string, args ...any) types.GomegaMatcher { + return &matchers.BeTrueMatcher{Reason: fmt.Sprintf(format, args...)} +} + +// BeFalseBecause succeeds if actual is false and displays the provided reason if it is true. +// fmt.Sprintf is used to render the reason +func BeFalseBecause(format string, args ...any) types.GomegaMatcher { + return &matchers.BeFalseMatcher{Reason: fmt.Sprintf(format, args...)} +} + // HaveOccurred succeeds if actual is a non-nil error // The typical Go error checking pattern looks like: // @@ -88,19 +105,44 @@ func Succeed() types.GomegaMatcher { } // MatchError succeeds if actual is a non-nil error that matches the passed in -// string, error, or matcher. +// string, error, function, or matcher. // // These are valid use-cases: // -// Expect(err).Should(MatchError("an error")) //asserts that err.Error() == "an error" -// Expect(err).Should(MatchError(SomeError)) //asserts that err == SomeError (via reflect.DeepEqual) -// Expect(err).Should(MatchError(ContainsSubstring("sprocket not found"))) // asserts that edrr.Error() contains substring "sprocket not found" +// When passed a string: +// +// Expect(err).To(MatchError("an error")) +// +// asserts that err.Error() == "an error" +// +// When passed an error: +// +// Expect(err).To(MatchError(SomeError)) +// +// First checks if errors.Is(err, SomeError). +// If that fails then it checks if reflect.DeepEqual(err, SomeError) repeatedly for err and any errors wrapped by err +// +// When passed a matcher: +// +// Expect(err).To(MatchError(ContainSubstring("sprocket not found"))) +// +// the matcher is passed err.Error(). In this case it asserts that err.Error() contains substring "sprocket not found" +// +// When passed a func(err) bool and a description: +// +// Expect(err).To(MatchError(os.IsNotExist, "IsNotExist")) +// +// the function is passed err and matches if the return value is true. The description is required to allow Gomega +// to print a useful error message. // // It is an error for err to be nil or an object that does not implement the // Error interface -func MatchError(expected interface{}) types.GomegaMatcher { +// +// The optional second argument is a description of the error function, if used. This is required when passing a function but is ignored in all other cases. +func MatchError(expected interface{}, functionErrorDescription ...any) types.GomegaMatcher { return &matchers.MatchErrorMatcher{ - Expected: expected, + Expected: expected, + FuncErrDescription: functionErrorDescription, } } @@ -381,7 +423,7 @@ func ContainElements(elements ...interface{}) types.GomegaMatcher { } // HaveEach succeeds if actual solely contains elements that match the passed in element. -// Please note that if actual is empty, HaveEach always will succeed. +// Please note that if actual is empty, HaveEach always will fail. // By default HaveEach() uses Equal() to perform the match, however a // matcher can be passed in instead: // diff --git a/vendor/github.com/onsi/gomega/matchers/be_a_directory.go b/vendor/github.com/onsi/gomega/matchers/be_a_directory.go index acffc8570..93d4497c7 100644 --- a/vendor/github.com/onsi/gomega/matchers/be_a_directory.go +++ b/vendor/github.com/onsi/gomega/matchers/be_a_directory.go @@ -52,5 +52,5 @@ func (matcher *BeADirectoryMatcher) FailureMessage(actual interface{}) (message } func (matcher *BeADirectoryMatcher) NegatedFailureMessage(actual interface{}) (message string) { - return format.Message(actual, fmt.Sprintf("not be a directory")) + return format.Message(actual, "not be a directory") } diff --git a/vendor/github.com/onsi/gomega/matchers/be_a_regular_file.go b/vendor/github.com/onsi/gomega/matchers/be_a_regular_file.go index 89441c800..8fefc4deb 100644 --- a/vendor/github.com/onsi/gomega/matchers/be_a_regular_file.go +++ b/vendor/github.com/onsi/gomega/matchers/be_a_regular_file.go @@ -52,5 +52,5 @@ func (matcher *BeARegularFileMatcher) FailureMessage(actual interface{}) (messag } func (matcher *BeARegularFileMatcher) NegatedFailureMessage(actual interface{}) (message string) { - return format.Message(actual, fmt.Sprintf("not be a regular file")) + return format.Message(actual, "not be a regular file") } diff --git a/vendor/github.com/onsi/gomega/matchers/be_an_existing_file.go b/vendor/github.com/onsi/gomega/matchers/be_an_existing_file.go index ec6506b00..e2bdd2811 100644 --- a/vendor/github.com/onsi/gomega/matchers/be_an_existing_file.go +++ b/vendor/github.com/onsi/gomega/matchers/be_an_existing_file.go @@ -32,9 +32,9 @@ func (matcher *BeAnExistingFileMatcher) Match(actual interface{}) (success bool, } func (matcher *BeAnExistingFileMatcher) FailureMessage(actual interface{}) (message string) { - return format.Message(actual, fmt.Sprintf("to exist")) + return format.Message(actual, "to exist") } func (matcher *BeAnExistingFileMatcher) NegatedFailureMessage(actual interface{}) (message string) { - return format.Message(actual, fmt.Sprintf("not to exist")) + return format.Message(actual, "not to exist") } diff --git a/vendor/github.com/onsi/gomega/matchers/be_false_matcher.go b/vendor/github.com/onsi/gomega/matchers/be_false_matcher.go index e326c0157..8ee2b1c51 100644 --- a/vendor/github.com/onsi/gomega/matchers/be_false_matcher.go +++ b/vendor/github.com/onsi/gomega/matchers/be_false_matcher.go @@ -9,6 +9,7 @@ import ( ) type BeFalseMatcher struct { + Reason string } func (matcher *BeFalseMatcher) Match(actual interface{}) (success bool, err error) { @@ -20,9 +21,17 @@ func (matcher *BeFalseMatcher) Match(actual interface{}) (success bool, err erro } func (matcher *BeFalseMatcher) FailureMessage(actual interface{}) (message string) { - return format.Message(actual, "to be false") + if matcher.Reason == "" { + return format.Message(actual, "to be false") + } else { + return matcher.Reason + } } func (matcher *BeFalseMatcher) NegatedFailureMessage(actual interface{}) (message string) { - return format.Message(actual, "not to be false") + if matcher.Reason == "" { + return format.Message(actual, "not to be false") + } else { + return fmt.Sprintf(`Expected not false but got false\nNegation of "%s" failed`, matcher.Reason) + } } diff --git a/vendor/github.com/onsi/gomega/matchers/be_true_matcher.go b/vendor/github.com/onsi/gomega/matchers/be_true_matcher.go index 60bc1e3fa..3576aac88 100644 --- a/vendor/github.com/onsi/gomega/matchers/be_true_matcher.go +++ b/vendor/github.com/onsi/gomega/matchers/be_true_matcher.go @@ -9,6 +9,7 @@ import ( ) type BeTrueMatcher struct { + Reason string } func (matcher *BeTrueMatcher) Match(actual interface{}) (success bool, err error) { @@ -20,9 +21,17 @@ func (matcher *BeTrueMatcher) Match(actual interface{}) (success bool, err error } func (matcher *BeTrueMatcher) FailureMessage(actual interface{}) (message string) { - return format.Message(actual, "to be true") + if matcher.Reason == "" { + return format.Message(actual, "to be true") + } else { + return matcher.Reason + } } func (matcher *BeTrueMatcher) NegatedFailureMessage(actual interface{}) (message string) { - return format.Message(actual, "not to be true") + if matcher.Reason == "" { + return format.Message(actual, "not to be true") + } else { + return fmt.Sprintf(`Expected not true but got true\nNegation of "%s" failed`, matcher.Reason) + } } diff --git a/vendor/github.com/onsi/gomega/matchers/have_exact_elements.go b/vendor/github.com/onsi/gomega/matchers/have_exact_elements.go index 7cce776c1..dca5b9446 100644 --- a/vendor/github.com/onsi/gomega/matchers/have_exact_elements.go +++ b/vendor/github.com/onsi/gomega/matchers/have_exact_elements.go @@ -44,7 +44,12 @@ func (matcher *HaveExactElementsMatcher) Match(actual interface{}) (success bool elemMatcher := matchers[i].(omegaMatcher) match, err := elemMatcher.Match(values[i]) - if err != nil || !match { + if err != nil { + matcher.mismatchFailures = append(matcher.mismatchFailures, mismatchFailure{ + index: i, + failure: err.Error(), + }) + } else if !match { matcher.mismatchFailures = append(matcher.mismatchFailures, mismatchFailure{ index: i, failure: elemMatcher.FailureMessage(values[i]), diff --git a/vendor/github.com/onsi/gomega/matchers/have_http_body_matcher.go b/vendor/github.com/onsi/gomega/matchers/have_http_body_matcher.go index 6a3dcdc35..d14d9e5fc 100644 --- a/vendor/github.com/onsi/gomega/matchers/have_http_body_matcher.go +++ b/vendor/github.com/onsi/gomega/matchers/have_http_body_matcher.go @@ -11,8 +11,9 @@ import ( ) type HaveHTTPBodyMatcher struct { - Expected interface{} - cachedBody []byte + Expected interface{} + cachedResponse interface{} + cachedBody []byte } func (matcher *HaveHTTPBodyMatcher) Match(actual interface{}) (bool, error) { @@ -73,7 +74,7 @@ func (matcher *HaveHTTPBodyMatcher) NegatedFailureMessage(actual interface{}) (m // the Reader is closed and it is not readable again in FailureMessage() // or NegatedFailureMessage() func (matcher *HaveHTTPBodyMatcher) body(actual interface{}) ([]byte, error) { - if matcher.cachedBody != nil { + if matcher.cachedResponse == actual && matcher.cachedBody != nil { return matcher.cachedBody, nil } @@ -91,8 +92,10 @@ func (matcher *HaveHTTPBodyMatcher) body(actual interface{}) ([]byte, error) { switch a := actual.(type) { case *http.Response: + matcher.cachedResponse = a return body(a) case *httptest.ResponseRecorder: + matcher.cachedResponse = a return body(a.Result()) default: return nil, fmt.Errorf("HaveHTTPBody matcher expects *http.Response or *httptest.ResponseRecorder. Got:\n%s", format.Object(actual, 1)) diff --git a/vendor/github.com/onsi/gomega/matchers/match_error_matcher.go b/vendor/github.com/onsi/gomega/matchers/match_error_matcher.go index 827475ea5..c539dd389 100644 --- a/vendor/github.com/onsi/gomega/matchers/match_error_matcher.go +++ b/vendor/github.com/onsi/gomega/matchers/match_error_matcher.go @@ -9,10 +9,14 @@ import ( ) type MatchErrorMatcher struct { - Expected interface{} + Expected any + FuncErrDescription []any + isFunc bool } -func (matcher *MatchErrorMatcher) Match(actual interface{}) (success bool, err error) { +func (matcher *MatchErrorMatcher) Match(actual any) (success bool, err error) { + matcher.isFunc = false + if isNil(actual) { return false, fmt.Errorf("Expected an error, got nil") } @@ -42,6 +46,17 @@ func (matcher *MatchErrorMatcher) Match(actual interface{}) (success bool, err e return actualErr.Error() == expected, nil } + v := reflect.ValueOf(expected) + t := v.Type() + errorInterface := reflect.TypeOf((*error)(nil)).Elem() + if t.Kind() == reflect.Func && t.NumIn() == 1 && t.In(0).Implements(errorInterface) && t.NumOut() == 1 && t.Out(0).Kind() == reflect.Bool { + if len(matcher.FuncErrDescription) == 0 { + return false, fmt.Errorf("MatchError requires an additional description when passed a function") + } + matcher.isFunc = true + return v.Call([]reflect.Value{reflect.ValueOf(actualErr)})[0].Bool(), nil + } + var subMatcher omegaMatcher var hasSubMatcher bool if expected != nil { @@ -57,9 +72,15 @@ func (matcher *MatchErrorMatcher) Match(actual interface{}) (success bool, err e } func (matcher *MatchErrorMatcher) FailureMessage(actual interface{}) (message string) { + if matcher.isFunc { + return format.Message(actual, fmt.Sprintf("to match error function %s", matcher.FuncErrDescription[0])) + } return format.Message(actual, "to match error", matcher.Expected) } func (matcher *MatchErrorMatcher) NegatedFailureMessage(actual interface{}) (message string) { + if matcher.isFunc { + return format.Message(actual, fmt.Sprintf("not to match error function %s", matcher.FuncErrDescription[0])) + } return format.Message(actual, "not to match error", matcher.Expected) } diff --git a/vendor/github.com/tidwall/gjson/README.md b/vendor/github.com/tidwall/gjson/README.md index c8db11f14..96b2e4dc3 100644 --- a/vendor/github.com/tidwall/gjson/README.md +++ b/vendor/github.com/tidwall/gjson/README.md @@ -211,6 +211,7 @@ There are currently the following built-in modifiers: - `@tostr`: Converts json to a string. Wraps a json string. - `@fromstr`: Converts a string from json. Unwraps a json string. - `@group`: Groups arrays of objects. See [e4fc67c](https://github.com/tidwall/gjson/commit/e4fc67c92aeebf2089fabc7872f010e340d105db). +- `@dig`: Search for a value without providing its entire path. See [e8e87f2](https://github.com/tidwall/gjson/commit/e8e87f2a00dc41f3aba5631094e21f59a8cf8cbf). ### Modifier arguments @@ -426,16 +427,6 @@ if result.Index > 0 { This is a best-effort no allocation sub slice of the original json. This method utilizes the `result.Index` field, which is the position of the raw data in the original json. It's possible that the value of `result.Index` equals zero, in which case the `result.Raw` is converted to a `[]byte`. -## Get multiple values at once - -The `GetMany` function can be used to get multiple values at the same time. - -```go -results := gjson.GetMany(json, "name.first", "name.last", "age") -``` - -The return value is a `[]Result`, which will always contain exactly the same number of items as the input paths. - ## Performance Benchmarks of GJSON alongside [encoding/json](https://golang.org/pkg/encoding/json/), diff --git a/vendor/github.com/tidwall/gjson/SYNTAX.md b/vendor/github.com/tidwall/gjson/SYNTAX.md index 7a9b6a2d7..6721d7f51 100644 --- a/vendor/github.com/tidwall/gjson/SYNTAX.md +++ b/vendor/github.com/tidwall/gjson/SYNTAX.md @@ -137,12 +137,21 @@ next major release.* The `~` (tilde) operator will convert a value to a boolean before comparison. +Supported tilde comparison type are: + +``` +~true Converts true-ish values to true +~false Converts false-ish and non-existent values to true +~null Converts null and non-existent values to true +~* Converts any existing value to true +``` + For example, using the following JSON: ```json { "vals": [ - { "a": 1, "b": true }, + { "a": 1, "b": "data" }, { "a": 2, "b": true }, { "a": 3, "b": false }, { "a": 4, "b": "0" }, @@ -157,15 +166,23 @@ For example, using the following JSON: } ``` -You can now query for all true(ish) or false(ish) values: +To query for all true-ish or false-ish values: ``` -vals.#(b==~true)#.a >> [1,2,6,7,8] +vals.#(b==~true)#.a >> [2,6,7,8] vals.#(b==~false)#.a >> [3,4,5,9,10,11] ``` The last value which was non-existent is treated as `false` +To query for null and explicit value existence: + +``` +vals.#(b==~null)#.a >> [10,11] +vals.#(b==~*)#.a >> [1,2,3,4,5,6,7,8,9,10] +vals.#(b!=~*)#.a >> [11] +``` + ### Dot vs Pipe The `.` is standard separator, but it's also possible to use a `|`. @@ -241,6 +258,7 @@ There are currently the following built-in modifiers: - `@tostr`: Converts json to a string. Wraps a json string. - `@fromstr`: Converts a string from json. Unwraps a json string. - `@group`: Groups arrays of objects. See [e4fc67c](https://github.com/tidwall/gjson/commit/e4fc67c92aeebf2089fabc7872f010e340d105db). +- `@dig`: Search for a value without providing its entire path. See [e8e87f2](https://github.com/tidwall/gjson/commit/e8e87f2a00dc41f3aba5631094e21f59a8cf8cbf). #### Modifier arguments diff --git a/vendor/github.com/tidwall/gjson/gjson.go b/vendor/github.com/tidwall/gjson/gjson.go index 53cbd2363..79498250a 100644 --- a/vendor/github.com/tidwall/gjson/gjson.go +++ b/vendor/github.com/tidwall/gjson/gjson.go @@ -645,9 +645,9 @@ func tostr(json string) (raw string, str string) { // Exists returns true if value exists. // -// if gjson.Get(json, "name.last").Exists(){ -// println("value exists") -// } +// if gjson.Get(json, "name.last").Exists(){ +// println("value exists") +// } func (t Result) Exists() bool { return t.Type != Null || len(t.Raw) != 0 } @@ -661,7 +661,6 @@ func (t Result) Exists() bool { // nil, for JSON null // map[string]interface{}, for JSON objects // []interface{}, for JSON arrays -// func (t Result) Value() interface{} { if t.Type == String { return t.Str @@ -826,19 +825,28 @@ func parseArrayPath(path string) (r arrayPathResult) { } // splitQuery takes a query and splits it into three parts: -// path, op, middle, and right. +// +// path, op, middle, and right. +// // So for this query: -// #(first_name=="Murphy").last +// +// #(first_name=="Murphy").last +// // Becomes -// first_name # path -// =="Murphy" # middle -// .last # right +// +// first_name # path +// =="Murphy" # middle +// .last # right +// // Or, -// #(service_roles.#(=="one")).cap +// +// #(service_roles.#(=="one")).cap +// // Becomes -// service_roles.#(=="one") # path -// # middle -// .cap # right +// +// service_roles.#(=="one") # path +// # middle +// .cap # right func parseQuery(query string) ( path, op, value, remain string, i int, vesc, ok bool, ) { @@ -1251,15 +1259,74 @@ func matchLimit(str, pattern string) bool { return matched } +func falseish(t Result) bool { + switch t.Type { + case Null: + return true + case False: + return true + case String: + b, err := strconv.ParseBool(strings.ToLower(t.Str)) + if err != nil { + return false + } + return !b + case Number: + return t.Num == 0 + default: + return false + } +} + +func trueish(t Result) bool { + switch t.Type { + case True: + return true + case String: + b, err := strconv.ParseBool(strings.ToLower(t.Str)) + if err != nil { + return false + } + return b + case Number: + return t.Num != 0 + default: + return false + } +} + +func nullish(t Result) bool { + return t.Type == Null +} + func queryMatches(rp *arrayPathResult, value Result) bool { rpv := rp.query.value - if len(rpv) > 0 && rpv[0] == '~' { - // convert to bool - rpv = rpv[1:] - if value.Bool() { - value = Result{Type: True} - } else { - value = Result{Type: False} + if len(rpv) > 0 { + if rpv[0] == '~' { + // convert to bool + rpv = rpv[1:] + var ish, ok bool + switch rpv { + case "*": + ish, ok = value.Exists(), true + case "null": + ish, ok = nullish(value), true + case "true": + ish, ok = trueish(value), true + case "false": + ish, ok = falseish(value), true + } + if ok { + rpv = "true" + if ish { + value = Result{Type: True} + } else { + value = Result{Type: False} + } + } else { + rpv = "" + value = Result{} + } } } if !value.Exists() { @@ -1918,23 +1985,23 @@ type parseContext struct { // the '#' character. // The dot and wildcard character can be escaped with '\'. // -// { -// "name": {"first": "Tom", "last": "Anderson"}, -// "age":37, -// "children": ["Sara","Alex","Jack"], -// "friends": [ -// {"first": "James", "last": "Murphy"}, -// {"first": "Roger", "last": "Craig"} -// ] -// } -// "name.last" >> "Anderson" -// "age" >> 37 -// "children" >> ["Sara","Alex","Jack"] -// "children.#" >> 3 -// "children.1" >> "Alex" -// "child*.2" >> "Jack" -// "c?ildren.0" >> "Sara" -// "friends.#.first" >> ["James","Roger"] +// { +// "name": {"first": "Tom", "last": "Anderson"}, +// "age":37, +// "children": ["Sara","Alex","Jack"], +// "friends": [ +// {"first": "James", "last": "Murphy"}, +// {"first": "Roger", "last": "Craig"} +// ] +// } +// "name.last" >> "Anderson" +// "age" >> 37 +// "children" >> ["Sara","Alex","Jack"] +// "children.#" >> 3 +// "children.1" >> "Alex" +// "child*.2" >> "Jack" +// "c?ildren.0" >> "Sara" +// "friends.#.first" >> ["James","Roger"] // // This function expects that the json is well-formed, and does not validate. // Invalid json will not panic, but it may return back unexpected results. @@ -2126,8 +2193,7 @@ func unescape(json string) string { // The caseSensitive paramater is used when the tokens are Strings. // The order when comparing two different type is: // -// Null < False < Number < String < True < JSON -// +// Null < False < Number < String < True < JSON func (t Result) Less(token Result, caseSensitive bool) bool { if t.Type < token.Type { return true @@ -2556,11 +2622,10 @@ func validnull(data []byte, i int) (outi int, ok bool) { // Valid returns true if the input is valid json. // -// if !gjson.Valid(json) { -// return errors.New("invalid json") -// } -// value := gjson.Get(json, "name.last") -// +// if !gjson.Valid(json) { +// return errors.New("invalid json") +// } +// value := gjson.Get(json, "name.last") func Valid(json string) bool { _, ok := validpayload(stringBytes(json), 0) return ok @@ -2568,13 +2633,12 @@ func Valid(json string) bool { // ValidBytes returns true if the input is valid json. // -// if !gjson.Valid(json) { -// return errors.New("invalid json") -// } -// value := gjson.Get(json, "name.last") +// if !gjson.Valid(json) { +// return errors.New("invalid json") +// } +// value := gjson.Get(json, "name.last") // // If working with bytes, this method preferred over ValidBytes(string(data)) -// func ValidBytes(json []byte) bool { _, ok := validpayload(json, 0) return ok @@ -2690,6 +2754,7 @@ func execModifier(json, path string) (pathOut, res string, ok bool) { var parsedArgs bool switch pathOut[0] { case '{', '[', '"': + // json arg res := Parse(pathOut) if res.Exists() { args = squash(pathOut) @@ -2698,14 +2763,20 @@ func execModifier(json, path string) (pathOut, res string, ok bool) { } } if !parsedArgs { - idx := strings.IndexByte(pathOut, '|') - if idx == -1 { - args = pathOut - pathOut = "" - } else { - args = pathOut[:idx] - pathOut = pathOut[idx:] + // simple arg + i := 0 + for ; i < len(pathOut); i++ { + if pathOut[i] == '|' { + break + } + switch pathOut[i] { + case '{', '[', '"', '(': + s := squash(pathOut[i:]) + i += len(s) - 1 + } } + args = pathOut[:i] + pathOut = pathOut[i:] } } return pathOut, fn(json, args), true @@ -2725,19 +2796,24 @@ func unwrap(json string) string { // DisableModifiers will disable the modifier syntax var DisableModifiers = false -var modifiers = map[string]func(json, arg string) string{ - "pretty": modPretty, - "ugly": modUgly, - "reverse": modReverse, - "this": modThis, - "flatten": modFlatten, - "join": modJoin, - "valid": modValid, - "keys": modKeys, - "values": modValues, - "tostr": modToStr, - "fromstr": modFromStr, - "group": modGroup, +var modifiers map[string]func(json, arg string) string + +func init() { + modifiers = map[string]func(json, arg string) string{ + "pretty": modPretty, + "ugly": modUgly, + "reverse": modReverse, + "this": modThis, + "flatten": modFlatten, + "join": modJoin, + "valid": modValid, + "keys": modKeys, + "values": modValues, + "tostr": modToStr, + "fromstr": modFromStr, + "group": modGroup, + "dig": modDig, + } } // AddModifier binds a custom modifier command to the GJSON syntax. @@ -2848,9 +2924,13 @@ func modReverse(json, arg string) string { } // @flatten an array with child arrays. -// [1,[2],[3,4],[5,[6,7]]] -> [1,2,3,4,5,[6,7]] +// +// [1,[2],[3,4],[5,[6,7]]] -> [1,2,3,4,5,[6,7]] +// // The {"deep":true} arg can be provide for deep flattening. -// [1,[2],[3,4],[5,[6,7]]] -> [1,2,3,4,5,6,7] +// +// [1,[2],[3,4],[5,[6,7]]] -> [1,2,3,4,5,6,7] +// // The original json is returned when the json is not an array. func modFlatten(json, arg string) string { res := Parse(json) @@ -2895,7 +2975,8 @@ func modFlatten(json, arg string) string { } // @keys extracts the keys from an object. -// {"first":"Tom","last":"Smith"} -> ["first","last"] +// +// {"first":"Tom","last":"Smith"} -> ["first","last"] func modKeys(json, arg string) string { v := Parse(json) if !v.Exists() { @@ -2922,7 +3003,8 @@ func modKeys(json, arg string) string { } // @values extracts the values from an object. -// {"first":"Tom","last":"Smith"} -> ["Tom","Smith"] +// +// {"first":"Tom","last":"Smith"} -> ["Tom","Smith"] func modValues(json, arg string) string { v := Parse(json) if !v.Exists() { @@ -2947,11 +3029,17 @@ func modValues(json, arg string) string { } // @join multiple objects into a single object. -// [{"first":"Tom"},{"last":"Smith"}] -> {"first","Tom","last":"Smith"} +// +// [{"first":"Tom"},{"last":"Smith"}] -> {"first","Tom","last":"Smith"} +// // The arg can be "true" to specify that duplicate keys should be preserved. -// [{"first":"Tom","age":37},{"age":41}] -> {"first","Tom","age":37,"age":41} +// +// [{"first":"Tom","age":37},{"age":41}] -> {"first","Tom","age":37,"age":41} +// // Without preserved keys: -// [{"first":"Tom","age":37},{"age":41}] -> {"first","Tom","age":41} +// +// [{"first":"Tom","age":37},{"age":41}] -> {"first","Tom","age":41} +// // The original json is returned when the json is not an object. func modJoin(json, arg string) string { res := Parse(json) @@ -3024,7 +3112,8 @@ func modValid(json, arg string) string { } // @fromstr converts a string to json -// "{\"id\":1023,\"name\":\"alert\"}" -> {"id":1023,"name":"alert"} +// +// "{\"id\":1023,\"name\":\"alert\"}" -> {"id":1023,"name":"alert"} func modFromStr(json, arg string) string { if !Valid(json) { return "" @@ -3033,7 +3122,8 @@ func modFromStr(json, arg string) string { } // @tostr converts a string to json -// {"id":1023,"name":"alert"} -> "{\"id\":1023,\"name\":\"alert\"}" +// +// {"id":1023,"name":"alert"} -> "{\"id\":1023,\"name\":\"alert\"}" func modToStr(str, arg string) string { return string(AppendJSONString(nil, str)) } @@ -3210,11 +3300,11 @@ func revSquash(json string) string { // Paths returns the original GJSON paths for a Result where the Result came // from a simple query path that returns an array, like: // -// gjson.Get(json, "friends.#.first") +// gjson.Get(json, "friends.#.first") // // The returned value will be in the form of a JSON array: // -// ["friends.0.first","friends.1.first","friends.2.first"] +// ["friends.0.first","friends.1.first","friends.2.first"] // // The param 'json' must be the original JSON used when calling Get. // @@ -3239,11 +3329,11 @@ func (t Result) Paths(json string) []string { // Path returns the original GJSON path for a Result where the Result came // from a simple path that returns a single value, like: // -// gjson.Get(json, "friends.#(last=Murphy)") +// gjson.Get(json, "friends.#(last=Murphy)") // // The returned value will be in the form of a JSON string: // -// "friends.0" +// "friends.0" // // The param 'json' must be the original JSON used when calling Get. // @@ -3320,7 +3410,7 @@ func (t Result) Path(json string) string { if !rcomp.Exists() { goto fail } - comp := escapeComp(rcomp.String()) + comp := Escape(rcomp.String()) path = append(path, '.') path = append(path, comp...) } @@ -3335,17 +3425,31 @@ fail: // isSafePathKeyChar returns true if the input character is safe for not // needing escaping. func isSafePathKeyChar(c byte) bool { - return c <= ' ' || c > '~' || c == '_' || c == '-' || c == ':' || - (c >= 'a' && c <= 'z') || (c >= 'A' && c <= 'Z') || - (c >= '0' && c <= '9') + return (c >= 'a' && c <= 'z') || (c >= 'A' && c <= 'Z') || + (c >= '0' && c <= '9') || c <= ' ' || c > '~' || c == '_' || + c == '-' || c == ':' } -// escapeComp escaped a path compontent, making it safe for generating a -// path for later use. -func escapeComp(comp string) string { +// Escape returns an escaped path component. +// +// json := `{ +// "user":{ +// "first.name": "Janet", +// "last.name": "Prichard" +// } +// }` +// user := gjson.Get(json, "user") +// println(user.Get(gjson.Escape("first.name")) +// println(user.Get(gjson.Escape("last.name")) +// // Output: +// // Janet +// // Prichard +func Escape(comp string) string { for i := 0; i < len(comp); i++ { if !isSafePathKeyChar(comp[i]) { - ncomp := []byte(comp[:i]) + ncomp := make([]byte, len(comp)+1) + copy(ncomp, comp[:i]) + ncomp = ncomp[:i] for ; i < len(comp); i++ { if !isSafePathKeyChar(comp[i]) { ncomp = append(ncomp, '\\') @@ -3357,3 +3461,30 @@ func escapeComp(comp string) string { } return comp } + +func parseRecursiveDescent(all []Result, parent Result, path string) []Result { + if res := parent.Get(path); res.Exists() { + all = append(all, res) + } + if parent.IsArray() || parent.IsObject() { + parent.ForEach(func(_, val Result) bool { + all = parseRecursiveDescent(all, val, path) + return true + }) + } + return all +} + +func modDig(json, arg string) string { + all := parseRecursiveDescent(nil, Parse(json), arg) + var out []byte + out = append(out, '[') + for i, res := range all { + if i > 0 { + out = append(out, ',') + } + out = append(out, res.Raw...) + } + out = append(out, ']') + return string(out) +} diff --git a/vendor/golang.org/x/net/html/doc.go b/vendor/golang.org/x/net/html/doc.go index 7a96eae33..2466ae3d9 100644 --- a/vendor/golang.org/x/net/html/doc.go +++ b/vendor/golang.org/x/net/html/doc.go @@ -99,14 +99,20 @@ Care should be taken when parsing and interpreting HTML, whether full documents or fragments, within the framework of the HTML specification, especially with regard to untrusted inputs. -This package provides both a tokenizer and a parser. Only the parser constructs -a DOM according to the HTML specification, resolving malformed and misplaced -tags where appropriate. The tokenizer simply tokenizes the HTML presented to it, -and as such does not resolve issues that may exist in the processed HTML, -producing a literal interpretation of the input. - -If your use case requires semantically well-formed HTML, as defined by the -WHATWG specifiction, the parser should be used rather than the tokenizer. +This package provides both a tokenizer and a parser, which implement the +tokenization, and tokenization and tree construction stages of the WHATWG HTML +parsing specification respectively. While the tokenizer parses and normalizes +individual HTML tokens, only the parser constructs the DOM tree from the +tokenized HTML, as described in the tree construction stage of the +specification, dynamically modifying or extending the docuemnt's DOM tree. + +If your use case requires semantically well-formed HTML documents, as defined by +the WHATWG specification, the parser should be used rather than the tokenizer. + +In security contexts, if trust decisions are being made using the tokenized or +parsed content, the input must be re-serialized (for instance by using Render or +Token.String) in order for those trust decisions to hold, as the process of +tokenization or parsing may alter the content. */ package html // import "golang.org/x/net/html" diff --git a/vendor/golang.org/x/net/html/render.go b/vendor/golang.org/x/net/html/render.go index 8b2803190..e8c123345 100644 --- a/vendor/golang.org/x/net/html/render.go +++ b/vendor/golang.org/x/net/html/render.go @@ -194,9 +194,8 @@ func render1(w writer, n *Node) error { } } - // Render any child nodes. - switch n.Data { - case "iframe", "noembed", "noframes", "noscript", "plaintext", "script", "style", "xmp": + // Render any child nodes + if childTextNodesAreLiteral(n) { for c := n.FirstChild; c != nil; c = c.NextSibling { if c.Type == TextNode { if _, err := w.WriteString(c.Data); err != nil { @@ -213,7 +212,7 @@ func render1(w writer, n *Node) error { // last element in the file, with no closing tag. return plaintextAbort } - default: + } else { for c := n.FirstChild; c != nil; c = c.NextSibling { if err := render1(w, c); err != nil { return err @@ -231,6 +230,27 @@ func render1(w writer, n *Node) error { return w.WriteByte('>') } +func childTextNodesAreLiteral(n *Node) bool { + // Per WHATWG HTML 13.3, if the parent of the current node is a style, + // script, xmp, iframe, noembed, noframes, or plaintext element, and the + // current node is a text node, append the value of the node's data + // literally. The specification is not explicit about it, but we only + // enforce this if we are in the HTML namespace (i.e. when the namespace is + // ""). + // NOTE: we also always include noscript elements, although the + // specification states that they should only be rendered as such if + // scripting is enabled for the node (which is not something we track). + if n.Namespace != "" { + return false + } + switch n.Data { + case "iframe", "noembed", "noframes", "noscript", "plaintext", "script", "style", "xmp": + return true + default: + return false + } +} + // writeQuoted writes s to w surrounded by quotes. Normally it will use double // quotes, but if s contains a double quote, it will use single quotes. // It is used for writing the identifiers in a doctype declaration. diff --git a/vendor/golang.org/x/net/html/token.go b/vendor/golang.org/x/net/html/token.go index 5c2a1f4ef..de67f938a 100644 --- a/vendor/golang.org/x/net/html/token.go +++ b/vendor/golang.org/x/net/html/token.go @@ -913,7 +913,14 @@ func (z *Tokenizer) readTagAttrKey() { case ' ', '\n', '\r', '\t', '\f', '/': z.pendingAttr[0].end = z.raw.end - 1 return - case '=', '>': + case '=': + if z.pendingAttr[0].start+1 == z.raw.end { + // WHATWG 13.2.5.32, if we see an equals sign before the attribute name + // begins, we treat it as a character in the attribute name and continue. + continue + } + fallthrough + case '>': z.raw.end-- z.pendingAttr[0].end = z.raw.end return diff --git a/vendor/golang.org/x/sys/internal/unsafeheader/unsafeheader.go b/vendor/golang.org/x/sys/internal/unsafeheader/unsafeheader.go deleted file mode 100644 index e07899b90..000000000 --- a/vendor/golang.org/x/sys/internal/unsafeheader/unsafeheader.go +++ /dev/null @@ -1,30 +0,0 @@ -// Copyright 2020 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package unsafeheader contains header declarations for the Go runtime's -// slice and string implementations. -// -// This package allows x/sys to use types equivalent to -// reflect.SliceHeader and reflect.StringHeader without introducing -// a dependency on the (relatively heavy) "reflect" package. -package unsafeheader - -import ( - "unsafe" -) - -// Slice is the runtime representation of a slice. -// It cannot be used safely or portably and its representation may change in a later release. -type Slice struct { - Data unsafe.Pointer - Len int - Cap int -} - -// String is the runtime representation of a string. -// It cannot be used safely or portably and its representation may change in a later release. -type String struct { - Data unsafe.Pointer - Len int -} diff --git a/vendor/golang.org/x/sys/unix/aliases.go b/vendor/golang.org/x/sys/unix/aliases.go index abc89c104..e7d3df4bd 100644 --- a/vendor/golang.org/x/sys/unix/aliases.go +++ b/vendor/golang.org/x/sys/unix/aliases.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos) && go1.9 -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos -// +build go1.9 package unix diff --git a/vendor/golang.org/x/sys/unix/asm_aix_ppc64.s b/vendor/golang.org/x/sys/unix/asm_aix_ppc64.s index db9171c2e..269e173ca 100644 --- a/vendor/golang.org/x/sys/unix/asm_aix_ppc64.s +++ b/vendor/golang.org/x/sys/unix/asm_aix_ppc64.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_386.s b/vendor/golang.org/x/sys/unix/asm_bsd_386.s index e0fcd9b3d..a4fcef0e0 100644 --- a/vendor/golang.org/x/sys/unix/asm_bsd_386.s +++ b/vendor/golang.org/x/sys/unix/asm_bsd_386.s @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (freebsd || netbsd || openbsd) && gc -// +build freebsd netbsd openbsd -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_amd64.s b/vendor/golang.org/x/sys/unix/asm_bsd_amd64.s index 2b99c349a..1e63615c5 100644 --- a/vendor/golang.org/x/sys/unix/asm_bsd_amd64.s +++ b/vendor/golang.org/x/sys/unix/asm_bsd_amd64.s @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (darwin || dragonfly || freebsd || netbsd || openbsd) && gc -// +build darwin dragonfly freebsd netbsd openbsd -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_arm.s b/vendor/golang.org/x/sys/unix/asm_bsd_arm.s index d702d4adc..6496c3100 100644 --- a/vendor/golang.org/x/sys/unix/asm_bsd_arm.s +++ b/vendor/golang.org/x/sys/unix/asm_bsd_arm.s @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (freebsd || netbsd || openbsd) && gc -// +build freebsd netbsd openbsd -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_arm64.s b/vendor/golang.org/x/sys/unix/asm_bsd_arm64.s index fe36a7391..4fd1f54da 100644 --- a/vendor/golang.org/x/sys/unix/asm_bsd_arm64.s +++ b/vendor/golang.org/x/sys/unix/asm_bsd_arm64.s @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (darwin || freebsd || netbsd || openbsd) && gc -// +build darwin freebsd netbsd openbsd -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s b/vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s index e5b9a8489..42f7eb9e4 100644 --- a/vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s +++ b/vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (darwin || freebsd || netbsd || openbsd) && gc -// +build darwin freebsd netbsd openbsd -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_riscv64.s b/vendor/golang.org/x/sys/unix/asm_bsd_riscv64.s index d560019ea..f8902667e 100644 --- a/vendor/golang.org/x/sys/unix/asm_bsd_riscv64.s +++ b/vendor/golang.org/x/sys/unix/asm_bsd_riscv64.s @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (darwin || freebsd || netbsd || openbsd) && gc -// +build darwin freebsd netbsd openbsd -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_386.s b/vendor/golang.org/x/sys/unix/asm_linux_386.s index 8fd101d07..3b4734870 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_386.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_386.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_amd64.s b/vendor/golang.org/x/sys/unix/asm_linux_amd64.s index 7ed38e43c..67e29f317 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_amd64.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_amd64.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_arm.s b/vendor/golang.org/x/sys/unix/asm_linux_arm.s index 8ef1d5140..d6ae269ce 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_arm.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_arm.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_arm64.s b/vendor/golang.org/x/sys/unix/asm_linux_arm64.s index 98ae02760..01e5e253c 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_arm64.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_arm64.s @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && arm64 && gc -// +build linux -// +build arm64 -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_loong64.s b/vendor/golang.org/x/sys/unix/asm_linux_loong64.s index 565357288..2abf12f6e 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_loong64.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_loong64.s @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && loong64 && gc -// +build linux -// +build loong64 -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_mips64x.s b/vendor/golang.org/x/sys/unix/asm_linux_mips64x.s index 21231d2ce..f84bae712 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_mips64x.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_mips64x.s @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (mips64 || mips64le) && gc -// +build linux -// +build mips64 mips64le -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_mipsx.s b/vendor/golang.org/x/sys/unix/asm_linux_mipsx.s index 6783b26c6..f08f62807 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_mipsx.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_mipsx.s @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (mips || mipsle) && gc -// +build linux -// +build mips mipsle -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_ppc64x.s b/vendor/golang.org/x/sys/unix/asm_linux_ppc64x.s index 19d498934..bdfc024d2 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_ppc64x.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_ppc64x.s @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (ppc64 || ppc64le) && gc -// +build linux -// +build ppc64 ppc64le -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_riscv64.s b/vendor/golang.org/x/sys/unix/asm_linux_riscv64.s index e42eb81d5..2e8c99612 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_riscv64.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_riscv64.s @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build riscv64 && gc -// +build riscv64 -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_s390x.s b/vendor/golang.org/x/sys/unix/asm_linux_s390x.s index c46aab339..2c394b11e 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_s390x.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_s390x.s @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && s390x && gc -// +build linux -// +build s390x -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_openbsd_mips64.s b/vendor/golang.org/x/sys/unix/asm_openbsd_mips64.s index 5e7a1169c..fab586a2c 100644 --- a/vendor/golang.org/x/sys/unix/asm_openbsd_mips64.s +++ b/vendor/golang.org/x/sys/unix/asm_openbsd_mips64.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_solaris_amd64.s b/vendor/golang.org/x/sys/unix/asm_solaris_amd64.s index f8c5394c1..f949ec547 100644 --- a/vendor/golang.org/x/sys/unix/asm_solaris_amd64.s +++ b/vendor/golang.org/x/sys/unix/asm_solaris_amd64.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_zos_s390x.s b/vendor/golang.org/x/sys/unix/asm_zos_s390x.s index 3b54e1858..2f67ba86d 100644 --- a/vendor/golang.org/x/sys/unix/asm_zos_s390x.s +++ b/vendor/golang.org/x/sys/unix/asm_zos_s390x.s @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x && gc -// +build zos -// +build s390x -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/cap_freebsd.go b/vendor/golang.org/x/sys/unix/cap_freebsd.go index 0b7c6adb8..a08657890 100644 --- a/vendor/golang.org/x/sys/unix/cap_freebsd.go +++ b/vendor/golang.org/x/sys/unix/cap_freebsd.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build freebsd -// +build freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/constants.go b/vendor/golang.org/x/sys/unix/constants.go index 394a3965b..6fb7cb77d 100644 --- a/vendor/golang.org/x/sys/unix/constants.go +++ b/vendor/golang.org/x/sys/unix/constants.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos package unix diff --git a/vendor/golang.org/x/sys/unix/dev_aix_ppc.go b/vendor/golang.org/x/sys/unix/dev_aix_ppc.go index 65a998508..d78513461 100644 --- a/vendor/golang.org/x/sys/unix/dev_aix_ppc.go +++ b/vendor/golang.org/x/sys/unix/dev_aix_ppc.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix && ppc -// +build aix,ppc // Functions to access/create device major and minor numbers matching the // encoding used by AIX. diff --git a/vendor/golang.org/x/sys/unix/dev_aix_ppc64.go b/vendor/golang.org/x/sys/unix/dev_aix_ppc64.go index 8fc08ad0a..623a5e697 100644 --- a/vendor/golang.org/x/sys/unix/dev_aix_ppc64.go +++ b/vendor/golang.org/x/sys/unix/dev_aix_ppc64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix && ppc64 -// +build aix,ppc64 // Functions to access/create device major and minor numbers matching the // encoding used AIX. diff --git a/vendor/golang.org/x/sys/unix/dev_zos.go b/vendor/golang.org/x/sys/unix/dev_zos.go index a388e59a0..bb6a64fe9 100644 --- a/vendor/golang.org/x/sys/unix/dev_zos.go +++ b/vendor/golang.org/x/sys/unix/dev_zos.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x // Functions to access/create device major and minor numbers matching the // encoding used by z/OS. diff --git a/vendor/golang.org/x/sys/unix/dirent.go b/vendor/golang.org/x/sys/unix/dirent.go index 2499f977b..1ebf11782 100644 --- a/vendor/golang.org/x/sys/unix/dirent.go +++ b/vendor/golang.org/x/sys/unix/dirent.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos package unix diff --git a/vendor/golang.org/x/sys/unix/endian_big.go b/vendor/golang.org/x/sys/unix/endian_big.go index a52026557..1095fd31d 100644 --- a/vendor/golang.org/x/sys/unix/endian_big.go +++ b/vendor/golang.org/x/sys/unix/endian_big.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. // //go:build armbe || arm64be || m68k || mips || mips64 || mips64p32 || ppc || ppc64 || s390 || s390x || shbe || sparc || sparc64 -// +build armbe arm64be m68k mips mips64 mips64p32 ppc ppc64 s390 s390x shbe sparc sparc64 package unix diff --git a/vendor/golang.org/x/sys/unix/endian_little.go b/vendor/golang.org/x/sys/unix/endian_little.go index b0f2bc4ae..b9f0e277b 100644 --- a/vendor/golang.org/x/sys/unix/endian_little.go +++ b/vendor/golang.org/x/sys/unix/endian_little.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. // //go:build 386 || amd64 || amd64p32 || alpha || arm || arm64 || loong64 || mipsle || mips64le || mips64p32le || nios2 || ppc64le || riscv || riscv64 || sh -// +build 386 amd64 amd64p32 alpha arm arm64 loong64 mipsle mips64le mips64p32le nios2 ppc64le riscv riscv64 sh package unix diff --git a/vendor/golang.org/x/sys/unix/env_unix.go b/vendor/golang.org/x/sys/unix/env_unix.go index 29ccc4d13..a96da71f4 100644 --- a/vendor/golang.org/x/sys/unix/env_unix.go +++ b/vendor/golang.org/x/sys/unix/env_unix.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos // Unix environment variables. diff --git a/vendor/golang.org/x/sys/unix/epoll_zos.go b/vendor/golang.org/x/sys/unix/epoll_zos.go index cedaf7e02..7753fddea 100644 --- a/vendor/golang.org/x/sys/unix/epoll_zos.go +++ b/vendor/golang.org/x/sys/unix/epoll_zos.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x package unix diff --git a/vendor/golang.org/x/sys/unix/fcntl.go b/vendor/golang.org/x/sys/unix/fcntl.go index e9b991258..6200876fb 100644 --- a/vendor/golang.org/x/sys/unix/fcntl.go +++ b/vendor/golang.org/x/sys/unix/fcntl.go @@ -2,8 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build dragonfly || freebsd || linux || netbsd || openbsd -// +build dragonfly freebsd linux netbsd openbsd +//go:build dragonfly || freebsd || linux || netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/fcntl_linux_32bit.go b/vendor/golang.org/x/sys/unix/fcntl_linux_32bit.go index 29d44808b..13b4acd5c 100644 --- a/vendor/golang.org/x/sys/unix/fcntl_linux_32bit.go +++ b/vendor/golang.org/x/sys/unix/fcntl_linux_32bit.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build (linux && 386) || (linux && arm) || (linux && mips) || (linux && mipsle) || (linux && ppc) -// +build linux,386 linux,arm linux,mips linux,mipsle linux,ppc package unix diff --git a/vendor/golang.org/x/sys/unix/fdset.go b/vendor/golang.org/x/sys/unix/fdset.go index a8068f94f..9e83d18cd 100644 --- a/vendor/golang.org/x/sys/unix/fdset.go +++ b/vendor/golang.org/x/sys/unix/fdset.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos package unix diff --git a/vendor/golang.org/x/sys/unix/fstatfs_zos.go b/vendor/golang.org/x/sys/unix/fstatfs_zos.go index e377cc9f4..c8bde601e 100644 --- a/vendor/golang.org/x/sys/unix/fstatfs_zos.go +++ b/vendor/golang.org/x/sys/unix/fstatfs_zos.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x package unix diff --git a/vendor/golang.org/x/sys/unix/gccgo.go b/vendor/golang.org/x/sys/unix/gccgo.go index b06f52d74..aca5721dd 100644 --- a/vendor/golang.org/x/sys/unix/gccgo.go +++ b/vendor/golang.org/x/sys/unix/gccgo.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gccgo && !aix && !hurd -// +build gccgo,!aix,!hurd package unix diff --git a/vendor/golang.org/x/sys/unix/gccgo_c.c b/vendor/golang.org/x/sys/unix/gccgo_c.c index f98a1c542..d468b7b47 100644 --- a/vendor/golang.org/x/sys/unix/gccgo_c.c +++ b/vendor/golang.org/x/sys/unix/gccgo_c.c @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gccgo && !aix && !hurd -// +build gccgo,!aix,!hurd #include #include diff --git a/vendor/golang.org/x/sys/unix/gccgo_linux_amd64.go b/vendor/golang.org/x/sys/unix/gccgo_linux_amd64.go index e60e49a3d..972d61bd7 100644 --- a/vendor/golang.org/x/sys/unix/gccgo_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/gccgo_linux_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gccgo && linux && amd64 -// +build gccgo,linux,amd64 package unix diff --git a/vendor/golang.org/x/sys/unix/ifreq_linux.go b/vendor/golang.org/x/sys/unix/ifreq_linux.go index 15721a510..848840ae4 100644 --- a/vendor/golang.org/x/sys/unix/ifreq_linux.go +++ b/vendor/golang.org/x/sys/unix/ifreq_linux.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux -// +build linux package unix diff --git a/vendor/golang.org/x/sys/unix/ioctl_linux.go b/vendor/golang.org/x/sys/unix/ioctl_linux.go index 0d12c0851..dbe680eab 100644 --- a/vendor/golang.org/x/sys/unix/ioctl_linux.go +++ b/vendor/golang.org/x/sys/unix/ioctl_linux.go @@ -231,3 +231,8 @@ func IoctlLoopGetStatus64(fd int) (*LoopInfo64, error) { func IoctlLoopSetStatus64(fd int, value *LoopInfo64) error { return ioctlPtr(fd, LOOP_SET_STATUS64, unsafe.Pointer(value)) } + +// IoctlLoopConfigure configures all loop device parameters in a single step +func IoctlLoopConfigure(fd int, value *LoopConfig) error { + return ioctlPtr(fd, LOOP_CONFIGURE, unsafe.Pointer(value)) +} diff --git a/vendor/golang.org/x/sys/unix/ioctl_signed.go b/vendor/golang.org/x/sys/unix/ioctl_signed.go new file mode 100644 index 000000000..5b0759bd8 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/ioctl_signed.go @@ -0,0 +1,69 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build aix || solaris + +package unix + +import ( + "unsafe" +) + +// ioctl itself should not be exposed directly, but additional get/set +// functions for specific types are permissible. + +// IoctlSetInt performs an ioctl operation which sets an integer value +// on fd, using the specified request number. +func IoctlSetInt(fd int, req int, value int) error { + return ioctl(fd, req, uintptr(value)) +} + +// IoctlSetPointerInt performs an ioctl operation which sets an +// integer value on fd, using the specified request number. The ioctl +// argument is called with a pointer to the integer value, rather than +// passing the integer value directly. +func IoctlSetPointerInt(fd int, req int, value int) error { + v := int32(value) + return ioctlPtr(fd, req, unsafe.Pointer(&v)) +} + +// IoctlSetWinsize performs an ioctl on fd with a *Winsize argument. +// +// To change fd's window size, the req argument should be TIOCSWINSZ. +func IoctlSetWinsize(fd int, req int, value *Winsize) error { + // TODO: if we get the chance, remove the req parameter and + // hardcode TIOCSWINSZ. + return ioctlPtr(fd, req, unsafe.Pointer(value)) +} + +// IoctlSetTermios performs an ioctl on fd with a *Termios. +// +// The req value will usually be TCSETA or TIOCSETA. +func IoctlSetTermios(fd int, req int, value *Termios) error { + // TODO: if we get the chance, remove the req parameter. + return ioctlPtr(fd, req, unsafe.Pointer(value)) +} + +// IoctlGetInt performs an ioctl operation which gets an integer value +// from fd, using the specified request number. +// +// A few ioctl requests use the return value as an output parameter; +// for those, IoctlRetInt should be used instead of this function. +func IoctlGetInt(fd int, req int) (int, error) { + var value int + err := ioctlPtr(fd, req, unsafe.Pointer(&value)) + return value, err +} + +func IoctlGetWinsize(fd int, req int) (*Winsize, error) { + var value Winsize + err := ioctlPtr(fd, req, unsafe.Pointer(&value)) + return &value, err +} + +func IoctlGetTermios(fd int, req int) (*Termios, error) { + var value Termios + err := ioctlPtr(fd, req, unsafe.Pointer(&value)) + return &value, err +} diff --git a/vendor/golang.org/x/sys/unix/ioctl.go b/vendor/golang.org/x/sys/unix/ioctl_unsigned.go similarity index 92% rename from vendor/golang.org/x/sys/unix/ioctl.go rename to vendor/golang.org/x/sys/unix/ioctl_unsigned.go index 7ce8dd406..20f470b9d 100644 --- a/vendor/golang.org/x/sys/unix/ioctl.go +++ b/vendor/golang.org/x/sys/unix/ioctl_unsigned.go @@ -2,8 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build aix || darwin || dragonfly || freebsd || hurd || linux || netbsd || openbsd || solaris -// +build aix darwin dragonfly freebsd hurd linux netbsd openbsd solaris +//go:build darwin || dragonfly || freebsd || hurd || linux || netbsd || openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ioctl_zos.go b/vendor/golang.org/x/sys/unix/ioctl_zos.go index 6532f09af..c8b2a750f 100644 --- a/vendor/golang.org/x/sys/unix/ioctl_zos.go +++ b/vendor/golang.org/x/sys/unix/ioctl_zos.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x package unix @@ -17,14 +16,14 @@ import ( // IoctlSetInt performs an ioctl operation which sets an integer value // on fd, using the specified request number. -func IoctlSetInt(fd int, req uint, value int) error { +func IoctlSetInt(fd int, req int, value int) error { return ioctl(fd, req, uintptr(value)) } // IoctlSetWinsize performs an ioctl on fd with a *Winsize argument. // // To change fd's window size, the req argument should be TIOCSWINSZ. -func IoctlSetWinsize(fd int, req uint, value *Winsize) error { +func IoctlSetWinsize(fd int, req int, value *Winsize) error { // TODO: if we get the chance, remove the req parameter and // hardcode TIOCSWINSZ. return ioctlPtr(fd, req, unsafe.Pointer(value)) @@ -33,7 +32,7 @@ func IoctlSetWinsize(fd int, req uint, value *Winsize) error { // IoctlSetTermios performs an ioctl on fd with a *Termios. // // The req value is expected to be TCSETS, TCSETSW, or TCSETSF -func IoctlSetTermios(fd int, req uint, value *Termios) error { +func IoctlSetTermios(fd int, req int, value *Termios) error { if (req != TCSETS) && (req != TCSETSW) && (req != TCSETSF) { return ENOSYS } @@ -47,13 +46,13 @@ func IoctlSetTermios(fd int, req uint, value *Termios) error { // // A few ioctl requests use the return value as an output parameter; // for those, IoctlRetInt should be used instead of this function. -func IoctlGetInt(fd int, req uint) (int, error) { +func IoctlGetInt(fd int, req int) (int, error) { var value int err := ioctlPtr(fd, req, unsafe.Pointer(&value)) return value, err } -func IoctlGetWinsize(fd int, req uint) (*Winsize, error) { +func IoctlGetWinsize(fd int, req int) (*Winsize, error) { var value Winsize err := ioctlPtr(fd, req, unsafe.Pointer(&value)) return &value, err @@ -62,7 +61,7 @@ func IoctlGetWinsize(fd int, req uint) (*Winsize, error) { // IoctlGetTermios performs an ioctl on fd with a *Termios. // // The req value is expected to be TCGETS -func IoctlGetTermios(fd int, req uint) (*Termios, error) { +func IoctlGetTermios(fd int, req int) (*Termios, error) { var value Termios if req != TCGETS { return &value, ENOSYS diff --git a/vendor/golang.org/x/sys/unix/mkall.sh b/vendor/golang.org/x/sys/unix/mkall.sh index 8e3947c36..e6f31d374 100644 --- a/vendor/golang.org/x/sys/unix/mkall.sh +++ b/vendor/golang.org/x/sys/unix/mkall.sh @@ -50,7 +50,7 @@ if [[ "$GOOS" = "linux" ]]; then # Use the Docker-based build system # Files generated through docker (use $cmd so you can Ctl-C the build or run) $cmd docker build --tag generate:$GOOS $GOOS - $cmd docker run --interactive --tty --volume $(cd -- "$(dirname -- "$0")/.." && /bin/pwd):/build generate:$GOOS + $cmd docker run --interactive --tty --volume $(cd -- "$(dirname -- "$0")/.." && pwd):/build generate:$GOOS exit fi diff --git a/vendor/golang.org/x/sys/unix/mkerrors.sh b/vendor/golang.org/x/sys/unix/mkerrors.sh index 7456d9ddd..6202638ba 100644 --- a/vendor/golang.org/x/sys/unix/mkerrors.sh +++ b/vendor/golang.org/x/sys/unix/mkerrors.sh @@ -66,6 +66,7 @@ includes_Darwin=' #include #include #include +#include #include #include #include @@ -203,6 +204,7 @@ struct ltchars { #include #include #include +#include #include #include #include @@ -517,10 +519,12 @@ ccflags="$@" $2 ~ /^LOCK_(SH|EX|NB|UN)$/ || $2 ~ /^LO_(KEY|NAME)_SIZE$/ || $2 ~ /^LOOP_(CLR|CTL|GET|SET)_/ || - $2 ~ /^(AF|SOCK|SO|SOL|IPPROTO|IP|IPV6|TCP|MCAST|EVFILT|NOTE|SHUT|PROT|MAP|MFD|T?PACKET|MSG|SCM|MCL|DT|MADV|PR|LOCAL|TCPOPT)_/ || + $2 == "LOOP_CONFIGURE" || + $2 ~ /^(AF|SOCK|SO|SOL|IPPROTO|IP|IPV6|TCP|MCAST|EVFILT|NOTE|SHUT|PROT|MAP|MREMAP|MFD|T?PACKET|MSG|SCM|MCL|DT|MADV|PR|LOCAL|TCPOPT|UDP)_/ || $2 ~ /^NFC_(GENL|PROTO|COMM|RF|SE|DIRECTION|LLCP|SOCKPROTO)_/ || $2 ~ /^NFC_.*_(MAX)?SIZE$/ || $2 ~ /^RAW_PAYLOAD_/ || + $2 ~ /^[US]F_/ || $2 ~ /^TP_STATUS_/ || $2 ~ /^FALLOC_/ || $2 ~ /^ICMPV?6?_(FILTER|SEC)/ || @@ -557,7 +561,7 @@ ccflags="$@" $2 ~ /^RLIMIT_(AS|CORE|CPU|DATA|FSIZE|LOCKS|MEMLOCK|MSGQUEUE|NICE|NOFILE|NPROC|RSS|RTPRIO|RTTIME|SIGPENDING|STACK)|RLIM_INFINITY/ || $2 ~ /^PRIO_(PROCESS|PGRP|USER)/ || $2 ~ /^CLONE_[A-Z_]+/ || - $2 !~ /^(BPF_TIMEVAL|BPF_FIB_LOOKUP_[A-Z]+)$/ && + $2 !~ /^(BPF_TIMEVAL|BPF_FIB_LOOKUP_[A-Z]+|BPF_F_LINK)$/ && $2 ~ /^(BPF|DLT)_/ || $2 ~ /^AUDIT_/ || $2 ~ /^(CLOCK|TIMER)_/ || @@ -580,6 +584,7 @@ ccflags="$@" $2 ~ /^PERF_/ || $2 ~ /^SECCOMP_MODE_/ || $2 ~ /^SEEK_/ || + $2 ~ /^SCHED_/ || $2 ~ /^SPLICE_/ || $2 ~ /^SYNC_FILE_RANGE_/ || $2 !~ /IOC_MAGIC/ && @@ -621,7 +626,7 @@ ccflags="$@" $2 ~ /^MEM/ || $2 ~ /^WG/ || $2 ~ /^FIB_RULE_/ || - $2 ~ /^BLK[A-Z]*(GET$|SET$|BUF$|PART$|SIZE)/ {printf("\t%s = C.%s\n", $2, $2)} + $2 ~ /^BLK[A-Z]*(GET$|SET$|BUF$|PART$|SIZE|IOMIN$|IOOPT$|ALIGNOFF$|DISCARD|ROTATIONAL$|ZEROOUT$|GETDISKSEQ$)/ {printf("\t%s = C.%s\n", $2, $2)} $2 ~ /^__WCOREFLAG$/ {next} $2 ~ /^__W[A-Z0-9]+$/ {printf("\t%s = C.%s\n", substr($2,3), $2)} @@ -659,7 +664,6 @@ echo '// mkerrors.sh' "$@" echo '// Code generated by the command above; see README.md. DO NOT EDIT.' echo echo "//go:build ${GOARCH} && ${GOOS}" -echo "// +build ${GOARCH},${GOOS}" echo go tool cgo -godefs -- "$@" _const.go >_error.out cat _error.out | grep -vf _error.grep | grep -vf _signal.grep @@ -738,7 +742,8 @@ main(void) e = errors[i].num; if(i > 0 && errors[i-1].num == e) continue; - strcpy(buf, strerror(e)); + strncpy(buf, strerror(e), sizeof(buf) - 1); + buf[sizeof(buf) - 1] = '\0'; // lowercase first letter: Bad -> bad, but STREAM -> STREAM. if(A <= buf[0] && buf[0] <= Z && a <= buf[1] && buf[1] <= z) buf[0] += a - A; @@ -757,7 +762,8 @@ main(void) e = signals[i].num; if(i > 0 && signals[i-1].num == e) continue; - strcpy(buf, strsignal(e)); + strncpy(buf, strsignal(e), sizeof(buf) - 1); + buf[sizeof(buf) - 1] = '\0'; // lowercase first letter: Bad -> bad, but STREAM -> STREAM. if(A <= buf[0] && buf[0] <= Z && a <= buf[1] && buf[1] <= z) buf[0] += a - A; diff --git a/vendor/golang.org/x/sys/unix/mmap_nomremap.go b/vendor/golang.org/x/sys/unix/mmap_nomremap.go new file mode 100644 index 000000000..4b68e5978 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/mmap_nomremap.go @@ -0,0 +1,13 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build aix || darwin || dragonfly || freebsd || openbsd || solaris + +package unix + +var mapper = &mmapper{ + active: make(map[*byte][]byte), + mmap: mmap, + munmap: munmap, +} diff --git a/vendor/golang.org/x/sys/unix/mremap.go b/vendor/golang.org/x/sys/unix/mremap.go new file mode 100644 index 000000000..fd45fe529 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/mremap.go @@ -0,0 +1,52 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build linux || netbsd + +package unix + +import "unsafe" + +type mremapMmapper struct { + mmapper + mremap func(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) +} + +var mapper = &mremapMmapper{ + mmapper: mmapper{ + active: make(map[*byte][]byte), + mmap: mmap, + munmap: munmap, + }, + mremap: mremap, +} + +func (m *mremapMmapper) Mremap(oldData []byte, newLength int, flags int) (data []byte, err error) { + if newLength <= 0 || len(oldData) == 0 || len(oldData) != cap(oldData) || flags&mremapFixed != 0 { + return nil, EINVAL + } + + pOld := &oldData[cap(oldData)-1] + m.Lock() + defer m.Unlock() + bOld := m.active[pOld] + if bOld == nil || &bOld[0] != &oldData[0] { + return nil, EINVAL + } + newAddr, errno := m.mremap(uintptr(unsafe.Pointer(&bOld[0])), uintptr(len(bOld)), uintptr(newLength), flags, 0) + if errno != nil { + return nil, errno + } + bNew := unsafe.Slice((*byte)(unsafe.Pointer(newAddr)), newLength) + pNew := &bNew[cap(bNew)-1] + if flags&mremapDontunmap == 0 { + delete(m.active, pOld) + } + m.active[pNew] = bNew + return bNew, nil +} + +func Mremap(oldData []byte, newLength int, flags int) (data []byte, err error) { + return mapper.Mremap(oldData, newLength, flags) +} diff --git a/vendor/golang.org/x/sys/unix/pagesize_unix.go b/vendor/golang.org/x/sys/unix/pagesize_unix.go index 53f1b4c5b..4d0a3430e 100644 --- a/vendor/golang.org/x/sys/unix/pagesize_unix.go +++ b/vendor/golang.org/x/sys/unix/pagesize_unix.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris // For Unix, get the pagesize from the runtime. diff --git a/vendor/golang.org/x/sys/unix/pledge_openbsd.go b/vendor/golang.org/x/sys/unix/pledge_openbsd.go index eb48294b2..6a09af53e 100644 --- a/vendor/golang.org/x/sys/unix/pledge_openbsd.go +++ b/vendor/golang.org/x/sys/unix/pledge_openbsd.go @@ -8,54 +8,31 @@ import ( "errors" "fmt" "strconv" - "syscall" - "unsafe" ) // Pledge implements the pledge syscall. // -// The pledge syscall does not accept execpromises on OpenBSD releases -// before 6.3. -// -// execpromises must be empty when Pledge is called on OpenBSD -// releases predating 6.3, otherwise an error will be returned. +// This changes both the promises and execpromises; use PledgePromises or +// PledgeExecpromises to only change the promises or execpromises +// respectively. // // For more information see pledge(2). func Pledge(promises, execpromises string) error { - maj, min, err := majmin() - if err != nil { + if err := pledgeAvailable(); err != nil { return err } - err = pledgeAvailable(maj, min, execpromises) + pptr, err := BytePtrFromString(promises) if err != nil { return err } - pptr, err := syscall.BytePtrFromString(promises) + exptr, err := BytePtrFromString(execpromises) if err != nil { return err } - // This variable will hold either a nil unsafe.Pointer or - // an unsafe.Pointer to a string (execpromises). - var expr unsafe.Pointer - - // If we're running on OpenBSD > 6.2, pass execpromises to the syscall. - if maj > 6 || (maj == 6 && min > 2) { - exptr, err := syscall.BytePtrFromString(execpromises) - if err != nil { - return err - } - expr = unsafe.Pointer(exptr) - } - - _, _, e := syscall.Syscall(SYS_PLEDGE, uintptr(unsafe.Pointer(pptr)), uintptr(expr), 0) - if e != 0 { - return e - } - - return nil + return pledge(pptr, exptr) } // PledgePromises implements the pledge syscall. @@ -64,30 +41,16 @@ func Pledge(promises, execpromises string) error { // // For more information see pledge(2). func PledgePromises(promises string) error { - maj, min, err := majmin() - if err != nil { - return err - } - - err = pledgeAvailable(maj, min, "") - if err != nil { + if err := pledgeAvailable(); err != nil { return err } - // This variable holds the execpromises and is always nil. - var expr unsafe.Pointer - - pptr, err := syscall.BytePtrFromString(promises) + pptr, err := BytePtrFromString(promises) if err != nil { return err } - _, _, e := syscall.Syscall(SYS_PLEDGE, uintptr(unsafe.Pointer(pptr)), uintptr(expr), 0) - if e != 0 { - return e - } - - return nil + return pledge(pptr, nil) } // PledgeExecpromises implements the pledge syscall. @@ -96,30 +59,16 @@ func PledgePromises(promises string) error { // // For more information see pledge(2). func PledgeExecpromises(execpromises string) error { - maj, min, err := majmin() - if err != nil { + if err := pledgeAvailable(); err != nil { return err } - err = pledgeAvailable(maj, min, execpromises) + exptr, err := BytePtrFromString(execpromises) if err != nil { return err } - // This variable holds the promises and is always nil. - var pptr unsafe.Pointer - - exptr, err := syscall.BytePtrFromString(execpromises) - if err != nil { - return err - } - - _, _, e := syscall.Syscall(SYS_PLEDGE, uintptr(pptr), uintptr(unsafe.Pointer(exptr)), 0) - if e != 0 { - return e - } - - return nil + return pledge(nil, exptr) } // majmin returns major and minor version number for an OpenBSD system. @@ -147,16 +96,15 @@ func majmin() (major int, minor int, err error) { // pledgeAvailable checks for availability of the pledge(2) syscall // based on the running OpenBSD version. -func pledgeAvailable(maj, min int, execpromises string) error { - // If OpenBSD <= 5.9, pledge is not available. - if (maj == 5 && min != 9) || maj < 5 { - return fmt.Errorf("pledge syscall is not available on OpenBSD %d.%d", maj, min) +func pledgeAvailable() error { + maj, min, err := majmin() + if err != nil { + return err } - // If OpenBSD <= 6.2 and execpromises is not empty, - // return an error - execpromises is not available before 6.3 - if (maj < 6 || (maj == 6 && min <= 2)) && execpromises != "" { - return fmt.Errorf("cannot use execpromises on OpenBSD %d.%d", maj, min) + // Require OpenBSD 6.4 as a minimum. + if maj < 6 || (maj == 6 && min <= 3) { + return fmt.Errorf("cannot call Pledge on OpenBSD %d.%d", maj, min) } return nil diff --git a/vendor/golang.org/x/sys/unix/ptrace_darwin.go b/vendor/golang.org/x/sys/unix/ptrace_darwin.go index 39dba6ca6..3f0975f3d 100644 --- a/vendor/golang.org/x/sys/unix/ptrace_darwin.go +++ b/vendor/golang.org/x/sys/unix/ptrace_darwin.go @@ -3,16 +3,9 @@ // license that can be found in the LICENSE file. //go:build darwin && !ios -// +build darwin,!ios package unix -import "unsafe" - func ptrace(request int, pid int, addr uintptr, data uintptr) error { return ptrace1(request, pid, addr, data) } - -func ptracePtr(request int, pid int, addr uintptr, data unsafe.Pointer) error { - return ptrace1Ptr(request, pid, addr, data) -} diff --git a/vendor/golang.org/x/sys/unix/ptrace_ios.go b/vendor/golang.org/x/sys/unix/ptrace_ios.go index 9ea66330a..a4d35db5d 100644 --- a/vendor/golang.org/x/sys/unix/ptrace_ios.go +++ b/vendor/golang.org/x/sys/unix/ptrace_ios.go @@ -3,16 +3,9 @@ // license that can be found in the LICENSE file. //go:build ios -// +build ios package unix -import "unsafe" - func ptrace(request int, pid int, addr uintptr, data uintptr) (err error) { return ENOTSUP } - -func ptracePtr(request int, pid int, addr uintptr, data unsafe.Pointer) (err error) { - return ENOTSUP -} diff --git a/vendor/golang.org/x/sys/unix/race.go b/vendor/golang.org/x/sys/unix/race.go index 6f6c5fec5..714d2aae7 100644 --- a/vendor/golang.org/x/sys/unix/race.go +++ b/vendor/golang.org/x/sys/unix/race.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build (darwin && race) || (linux && race) || (freebsd && race) -// +build darwin,race linux,race freebsd,race package unix diff --git a/vendor/golang.org/x/sys/unix/race0.go b/vendor/golang.org/x/sys/unix/race0.go index 706e1322a..4a9f6634c 100644 --- a/vendor/golang.org/x/sys/unix/race0.go +++ b/vendor/golang.org/x/sys/unix/race0.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || (darwin && !race) || (linux && !race) || (freebsd && !race) || netbsd || openbsd || solaris || dragonfly || zos -// +build aix darwin,!race linux,!race freebsd,!race netbsd openbsd solaris dragonfly zos package unix diff --git a/vendor/golang.org/x/sys/unix/readdirent_getdents.go b/vendor/golang.org/x/sys/unix/readdirent_getdents.go index 4d6257569..dbd2b6ccb 100644 --- a/vendor/golang.org/x/sys/unix/readdirent_getdents.go +++ b/vendor/golang.org/x/sys/unix/readdirent_getdents.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || dragonfly || freebsd || linux || netbsd || openbsd -// +build aix dragonfly freebsd linux netbsd openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go b/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go index 2a4ba47c4..130398b6b 100644 --- a/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go +++ b/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build darwin -// +build darwin package unix diff --git a/vendor/golang.org/x/sys/unix/sockcmsg_unix.go b/vendor/golang.org/x/sys/unix/sockcmsg_unix.go index 3865943f6..c3a62dbb1 100644 --- a/vendor/golang.org/x/sys/unix/sockcmsg_unix.go +++ b/vendor/golang.org/x/sys/unix/sockcmsg_unix.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos // Socket control messages diff --git a/vendor/golang.org/x/sys/unix/sockcmsg_unix_other.go b/vendor/golang.org/x/sys/unix/sockcmsg_unix_other.go index 0840fe4a5..4a1eab37e 100644 --- a/vendor/golang.org/x/sys/unix/sockcmsg_unix_other.go +++ b/vendor/golang.org/x/sys/unix/sockcmsg_unix_other.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin freebsd linux netbsd openbsd solaris zos package unix diff --git a/vendor/golang.org/x/sys/unix/syscall.go b/vendor/golang.org/x/sys/unix/syscall.go index 63e8c8383..5ea74da98 100644 --- a/vendor/golang.org/x/sys/unix/syscall.go +++ b/vendor/golang.org/x/sys/unix/syscall.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos // Package unix contains an interface to the low-level operating system // primitives. OS details vary depending on the underlying system, and diff --git a/vendor/golang.org/x/sys/unix/syscall_aix.go b/vendor/golang.org/x/sys/unix/syscall_aix.go index d9f5544cc..67ce6cef2 100644 --- a/vendor/golang.org/x/sys/unix/syscall_aix.go +++ b/vendor/golang.org/x/sys/unix/syscall_aix.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix -// +build aix // Aix system calls. // This file is compiled as ordinary Go code, @@ -107,7 +106,8 @@ func (sa *SockaddrUnix) sockaddr() (unsafe.Pointer, _Socklen, error) { if n > 0 { sl += _Socklen(n) + 1 } - if sa.raw.Path[0] == '@' { + if sa.raw.Path[0] == '@' || (sa.raw.Path[0] == 0 && sl > 3) { + // Check sl > 3 so we don't change unnamed socket behavior. sa.raw.Path[0] = 0 // Don't count trailing NUL for abstract address. sl-- @@ -408,8 +408,8 @@ func (w WaitStatus) CoreDump() bool { return w&0x80 == 0x80 } func (w WaitStatus) TrapCause() int { return -1 } -//sys ioctl(fd int, req uint, arg uintptr) (err error) -//sys ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) = ioctl +//sys ioctl(fd int, req int, arg uintptr) (err error) +//sys ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) = ioctl // fcntl must never be called with cmd=F_DUP2FD because it doesn't work on AIX // There is no way to create a custom fcntl and to keep //sys fcntl easily, @@ -487,8 +487,6 @@ func Fsync(fd int) error { //sys Unlinkat(dirfd int, path string, flags int) (err error) //sys Ustat(dev int, ubuf *Ustat_t) (err error) //sys write(fd int, p []byte) (n int, err error) -//sys readlen(fd int, p *byte, np int) (n int, err error) = read -//sys writelen(fd int, p *byte, np int) (n int, err error) = write //sys Dup2(oldfd int, newfd int) (err error) //sys Fadvise(fd int, offset int64, length int64, advice int) (err error) = posix_fadvise64 @@ -535,21 +533,6 @@ func Fsync(fd int) error { //sys sendmsg(s int, msg *Msghdr, flags int) (n int, err error) = nsendmsg //sys munmap(addr uintptr, length uintptr) (err error) - -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - //sys Madvise(b []byte, advice int) (err error) //sys Mprotect(b []byte, prot int) (err error) //sys Mlock(b []byte) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go b/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go index e92a0be16..1fdaa4760 100644 --- a/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go +++ b/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go @@ -3,12 +3,10 @@ // license that can be found in the LICENSE file. //go:build aix && ppc -// +build aix,ppc package unix //sysnb Getrlimit(resource int, rlim *Rlimit) (err error) = getrlimit64 -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) = setrlimit64 //sys Seek(fd int, offset int64, whence int) (off int64, err error) = lseek64 //sys mmap(addr uintptr, length uintptr, prot int, flags int, fd int, offset int64) (xaddr uintptr, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go b/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go index 16eed1709..c87f9a9f4 100644 --- a/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go +++ b/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go @@ -3,12 +3,10 @@ // license that can be found in the LICENSE file. //go:build aix && ppc64 -// +build aix,ppc64 package unix //sysnb Getrlimit(resource int, rlim *Rlimit) (err error) -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) //sys Seek(fd int, offset int64, whence int) (off int64, err error) = lseek //sys mmap(addr uintptr, length uintptr, prot int, flags int, fd int, offset int64) (xaddr uintptr, err error) = mmap64 diff --git a/vendor/golang.org/x/sys/unix/syscall_bsd.go b/vendor/golang.org/x/sys/unix/syscall_bsd.go index 7705c3270..a00c3e545 100644 --- a/vendor/golang.org/x/sys/unix/syscall_bsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_bsd.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build darwin || dragonfly || freebsd || netbsd || openbsd -// +build darwin dragonfly freebsd netbsd openbsd // BSD system call wrappers shared by *BSD based systems // including OS X (Darwin) and FreeBSD. Like the other @@ -317,7 +316,7 @@ func GetsockoptString(fd, level, opt int) (string, error) { if err != nil { return "", err } - return string(buf[:vallen-1]), nil + return ByteSliceToString(buf[:vallen]), nil } //sys recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) @@ -601,20 +600,6 @@ func Poll(fds []PollFd, timeout int) (n int, err error) { // Gethostuuid(uuid *byte, timeout *Timespec) (err error) // Ptrace(req int, pid int, addr uintptr, data int) (ret uintptr, err error) -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - //sys Madvise(b []byte, behav int) (err error) //sys Mlock(b []byte) (err error) //sys Mlockall(flags int) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin.go b/vendor/golang.org/x/sys/unix/syscall_darwin.go index 7064d6eba..59542a897 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin.go @@ -510,30 +510,36 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { return nil, err } - // Find size. - n := uintptr(0) - if err := sysctl(mib, nil, &n, nil, 0); err != nil { - return nil, err - } - if n == 0 { - return nil, nil - } - if n%SizeofKinfoProc != 0 { - return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) - } + for { + // Find size. + n := uintptr(0) + if err := sysctl(mib, nil, &n, nil, 0); err != nil { + return nil, err + } + if n == 0 { + return nil, nil + } + if n%SizeofKinfoProc != 0 { + return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) + } - // Read into buffer of that size. - buf := make([]KinfoProc, n/SizeofKinfoProc) - if err := sysctl(mib, (*byte)(unsafe.Pointer(&buf[0])), &n, nil, 0); err != nil { - return nil, err - } - if n%SizeofKinfoProc != 0 { - return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) - } + // Read into buffer of that size. + buf := make([]KinfoProc, n/SizeofKinfoProc) + if err := sysctl(mib, (*byte)(unsafe.Pointer(&buf[0])), &n, nil, 0); err != nil { + if err == ENOMEM { + // Process table grew. Try again. + continue + } + return nil, err + } + if n%SizeofKinfoProc != 0 { + return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) + } - // The actual call may return less than the original reported required - // size so ensure we deal with that. - return buf[:n/SizeofKinfoProc], nil + // The actual call may return less than the original reported required + // size so ensure we deal with that. + return buf[:n/SizeofKinfoProc], nil + } } //sys sendfile(infd int, outfd int, offset int64, len *int64, hdtr unsafe.Pointer, flags int) (err error) @@ -613,6 +619,7 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { //sys Rmdir(path string) (err error) //sys Seek(fd int, offset int64, whence int) (newoffset int64, err error) = SYS_LSEEK //sys Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) +//sys Setattrlist(path string, attrlist *Attrlist, attrBuf []byte, options int) (err error) //sys Setegid(egid int) (err error) //sysnb Seteuid(euid int) (err error) //sysnb Setgid(gid int) (err error) @@ -622,7 +629,6 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { //sys Setprivexec(flag int) (err error) //sysnb Setregid(rgid int, egid int) (err error) //sysnb Setreuid(ruid int, euid int) (err error) -//sysnb Setrlimit(which int, lim *Rlimit) (err error) //sysnb Setsid() (pid int, err error) //sysnb Settimeofday(tp *Timeval) (err error) //sysnb Setuid(uid int) (err error) @@ -638,190 +644,3 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { //sys write(fd int, p []byte) (n int, err error) //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) //sys munmap(addr uintptr, length uintptr) (err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ -//sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE - -/* - * Unimplemented - */ -// Profil -// Sigaction -// Sigprocmask -// Getlogin -// Sigpending -// Sigaltstack -// Ioctl -// Reboot -// Execve -// Vfork -// Sbrk -// Sstk -// Ovadvise -// Mincore -// Setitimer -// Swapon -// Select -// Sigsuspend -// Readv -// Writev -// Nfssvc -// Getfh -// Quotactl -// Csops -// Waitid -// Add_profil -// Kdebug_trace -// Sigreturn -// Atsocket -// Kqueue_from_portset_np -// Kqueue_portset -// Getattrlist -// Setattrlist -// Getdirentriesattr -// Searchfs -// Delete -// Copyfile -// Watchevent -// Waitevent -// Modwatch -// Fsctl -// Initgroups -// Posix_spawn -// Nfsclnt -// Fhopen -// Minherit -// Semsys -// Msgsys -// Shmsys -// Semctl -// Semget -// Semop -// Msgctl -// Msgget -// Msgsnd -// Msgrcv -// Shm_open -// Shm_unlink -// Sem_open -// Sem_close -// Sem_unlink -// Sem_wait -// Sem_trywait -// Sem_post -// Sem_getvalue -// Sem_init -// Sem_destroy -// Open_extended -// Umask_extended -// Stat_extended -// Lstat_extended -// Fstat_extended -// Chmod_extended -// Fchmod_extended -// Access_extended -// Settid -// Gettid -// Setsgroups -// Getsgroups -// Setwgroups -// Getwgroups -// Mkfifo_extended -// Mkdir_extended -// Identitysvc -// Shared_region_check_np -// Shared_region_map_np -// __pthread_mutex_destroy -// __pthread_mutex_init -// __pthread_mutex_lock -// __pthread_mutex_trylock -// __pthread_mutex_unlock -// __pthread_cond_init -// __pthread_cond_destroy -// __pthread_cond_broadcast -// __pthread_cond_signal -// Setsid_with_pid -// __pthread_cond_timedwait -// Aio_fsync -// Aio_return -// Aio_suspend -// Aio_cancel -// Aio_error -// Aio_read -// Aio_write -// Lio_listio -// __pthread_cond_wait -// Iopolicysys -// __pthread_kill -// __pthread_sigmask -// __sigwait -// __disable_threadsignal -// __pthread_markcancel -// __pthread_canceled -// __semwait_signal -// Proc_info -// sendfile -// Stat64_extended -// Lstat64_extended -// Fstat64_extended -// __pthread_chdir -// __pthread_fchdir -// Audit -// Auditon -// Getauid -// Setauid -// Getaudit -// Setaudit -// Getaudit_addr -// Setaudit_addr -// Auditctl -// Bsdthread_create -// Bsdthread_terminate -// Stack_snapshot -// Bsdthread_register -// Workq_open -// Workq_ops -// __mac_execve -// __mac_syscall -// __mac_get_file -// __mac_set_file -// __mac_get_link -// __mac_set_link -// __mac_get_proc -// __mac_set_proc -// __mac_get_fd -// __mac_set_fd -// __mac_get_pid -// __mac_get_lcid -// __mac_get_lctx -// __mac_set_lctx -// Setlcid -// Read_nocancel -// Write_nocancel -// Open_nocancel -// Close_nocancel -// Wait4_nocancel -// Recvmsg_nocancel -// Sendmsg_nocancel -// Recvfrom_nocancel -// Accept_nocancel -// Fcntl_nocancel -// Select_nocancel -// Fsync_nocancel -// Connect_nocancel -// Sigsuspend_nocancel -// Readv_nocancel -// Writev_nocancel -// Sendto_nocancel -// Pread_nocancel -// Pwrite_nocancel -// Waitid_nocancel -// Poll_nocancel -// Msgsnd_nocancel -// Msgrcv_nocancel -// Sem_wait_nocancel -// Aio_suspend_nocancel -// __sigwait_nocancel -// __semwait_signal_nocancel -// __mac_mount -// __mac_get_mount -// __mac_getfsstat diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go b/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go index 9fa879806..0eaecf5fc 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && darwin -// +build amd64,darwin package unix @@ -47,6 +46,5 @@ func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, //sys getfsstat(buf unsafe.Pointer, size uintptr, flags int) (n int, err error) = SYS_GETFSSTAT64 //sys Lstat(path string, stat *Stat_t) (err error) = SYS_LSTAT64 //sys ptrace1(request int, pid int, addr uintptr, data uintptr) (err error) = SYS_ptrace -//sys ptrace1Ptr(request int, pid int, addr unsafe.Pointer, data uintptr) (err error) = SYS_ptrace //sys Stat(path string, stat *Stat_t) (err error) = SYS_STAT64 //sys Statfs(path string, stat *Statfs_t) (err error) = SYS_STATFS64 diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go b/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go index f17b8c526..f36c6707c 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm64 && darwin -// +build arm64,darwin package unix @@ -47,6 +46,5 @@ func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, //sys getfsstat(buf unsafe.Pointer, size uintptr, flags int) (n int, err error) = SYS_GETFSSTAT //sys Lstat(path string, stat *Stat_t) (err error) //sys ptrace1(request int, pid int, addr uintptr, data uintptr) (err error) = SYS_ptrace -//sys ptrace1Ptr(request int, pid int, addr unsafe.Pointer, data uintptr) (err error) = SYS_ptrace //sys Stat(path string, stat *Stat_t) (err error) //sys Statfs(path string, stat *Statfs_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin_libSystem.go b/vendor/golang.org/x/sys/unix/syscall_darwin_libSystem.go index 53c96641f..16dc69937 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin_libSystem.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin_libSystem.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build darwin && go1.12 -// +build darwin,go1.12 package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_dragonfly.go b/vendor/golang.org/x/sys/unix/syscall_dragonfly.go index 221efc26b..97cb916f2 100644 --- a/vendor/golang.org/x/sys/unix/syscall_dragonfly.go +++ b/vendor/golang.org/x/sys/unix/syscall_dragonfly.go @@ -326,7 +326,6 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e //sysnb Setreuid(ruid int, euid int) (err error) //sysnb Setresgid(rgid int, egid int, sgid int) (err error) //sysnb Setresuid(ruid int, euid int, suid int) (err error) -//sysnb Setrlimit(which int, lim *Rlimit) (err error) //sysnb Setsid() (pid int, err error) //sysnb Settimeofday(tp *Timeval) (err error) //sysnb Setuid(uid int) (err error) @@ -344,203 +343,5 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e //sys write(fd int, p []byte) (n int, err error) //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) //sys munmap(addr uintptr, length uintptr) (err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ -//sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE //sys accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) //sys utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) - -/* - * Unimplemented - * TODO(jsing): Update this list for DragonFly. - */ -// Profil -// Sigaction -// Sigprocmask -// Getlogin -// Sigpending -// Sigaltstack -// Reboot -// Execve -// Vfork -// Sbrk -// Sstk -// Ovadvise -// Mincore -// Setitimer -// Swapon -// Select -// Sigsuspend -// Readv -// Writev -// Nfssvc -// Getfh -// Quotactl -// Mount -// Csops -// Waitid -// Add_profil -// Kdebug_trace -// Sigreturn -// Atsocket -// Kqueue_from_portset_np -// Kqueue_portset -// Getattrlist -// Setattrlist -// Getdirentriesattr -// Searchfs -// Delete -// Copyfile -// Watchevent -// Waitevent -// Modwatch -// Getxattr -// Fgetxattr -// Setxattr -// Fsetxattr -// Removexattr -// Fremovexattr -// Listxattr -// Flistxattr -// Fsctl -// Initgroups -// Posix_spawn -// Nfsclnt -// Fhopen -// Minherit -// Semsys -// Msgsys -// Shmsys -// Semctl -// Semget -// Semop -// Msgctl -// Msgget -// Msgsnd -// Msgrcv -// Shmat -// Shmctl -// Shmdt -// Shmget -// Shm_open -// Shm_unlink -// Sem_open -// Sem_close -// Sem_unlink -// Sem_wait -// Sem_trywait -// Sem_post -// Sem_getvalue -// Sem_init -// Sem_destroy -// Open_extended -// Umask_extended -// Stat_extended -// Lstat_extended -// Fstat_extended -// Chmod_extended -// Fchmod_extended -// Access_extended -// Settid -// Gettid -// Setsgroups -// Getsgroups -// Setwgroups -// Getwgroups -// Mkfifo_extended -// Mkdir_extended -// Identitysvc -// Shared_region_check_np -// Shared_region_map_np -// __pthread_mutex_destroy -// __pthread_mutex_init -// __pthread_mutex_lock -// __pthread_mutex_trylock -// __pthread_mutex_unlock -// __pthread_cond_init -// __pthread_cond_destroy -// __pthread_cond_broadcast -// __pthread_cond_signal -// Setsid_with_pid -// __pthread_cond_timedwait -// Aio_fsync -// Aio_return -// Aio_suspend -// Aio_cancel -// Aio_error -// Aio_read -// Aio_write -// Lio_listio -// __pthread_cond_wait -// Iopolicysys -// __pthread_kill -// __pthread_sigmask -// __sigwait -// __disable_threadsignal -// __pthread_markcancel -// __pthread_canceled -// __semwait_signal -// Proc_info -// Stat64_extended -// Lstat64_extended -// Fstat64_extended -// __pthread_chdir -// __pthread_fchdir -// Audit -// Auditon -// Getauid -// Setauid -// Getaudit -// Setaudit -// Getaudit_addr -// Setaudit_addr -// Auditctl -// Bsdthread_create -// Bsdthread_terminate -// Stack_snapshot -// Bsdthread_register -// Workq_open -// Workq_ops -// __mac_execve -// __mac_syscall -// __mac_get_file -// __mac_set_file -// __mac_get_link -// __mac_set_link -// __mac_get_proc -// __mac_set_proc -// __mac_get_fd -// __mac_set_fd -// __mac_get_pid -// __mac_get_lcid -// __mac_get_lctx -// __mac_set_lctx -// Setlcid -// Read_nocancel -// Write_nocancel -// Open_nocancel -// Close_nocancel -// Wait4_nocancel -// Recvmsg_nocancel -// Sendmsg_nocancel -// Recvfrom_nocancel -// Accept_nocancel -// Fcntl_nocancel -// Select_nocancel -// Fsync_nocancel -// Connect_nocancel -// Sigsuspend_nocancel -// Readv_nocancel -// Writev_nocancel -// Sendto_nocancel -// Pread_nocancel -// Pwrite_nocancel -// Waitid_nocancel -// Msgsnd_nocancel -// Msgrcv_nocancel -// Sem_wait_nocancel -// Aio_suspend_nocancel -// __sigwait_nocancel -// __semwait_signal_nocancel -// __mac_mount -// __mac_get_mount -// __mac_getfsstat diff --git a/vendor/golang.org/x/sys/unix/syscall_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/syscall_dragonfly_amd64.go index 4e2d32120..14bab6b2d 100644 --- a/vendor/golang.org/x/sys/unix/syscall_dragonfly_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_dragonfly_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && dragonfly -// +build amd64,dragonfly package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd.go b/vendor/golang.org/x/sys/unix/syscall_freebsd.go index 5bdde03e4..64d1bb4db 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd.go @@ -433,7 +433,6 @@ func Dup3(oldfd, newfd, flags int) error { //sysnb Setreuid(ruid int, euid int) (err error) //sysnb Setresgid(rgid int, egid int, sgid int) (err error) //sysnb Setresuid(ruid int, euid int, suid int) (err error) -//sysnb Setrlimit(which int, lim *Rlimit) (err error) //sysnb Setsid() (pid int, err error) //sysnb Settimeofday(tp *Timeval) (err error) //sysnb Setuid(uid int) (err error) @@ -450,197 +449,5 @@ func Dup3(oldfd, newfd, flags int) error { //sys write(fd int, p []byte) (n int, err error) //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) //sys munmap(addr uintptr, length uintptr) (err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ -//sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE //sys accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) //sys utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) - -/* - * Unimplemented - */ -// Profil -// Sigaction -// Sigprocmask -// Getlogin -// Sigpending -// Sigaltstack -// Ioctl -// Reboot -// Execve -// Vfork -// Sbrk -// Sstk -// Ovadvise -// Mincore -// Setitimer -// Swapon -// Select -// Sigsuspend -// Readv -// Writev -// Nfssvc -// Getfh -// Quotactl -// Mount -// Csops -// Waitid -// Add_profil -// Kdebug_trace -// Sigreturn -// Atsocket -// Kqueue_from_portset_np -// Kqueue_portset -// Getattrlist -// Setattrlist -// Getdents -// Getdirentriesattr -// Searchfs -// Delete -// Copyfile -// Watchevent -// Waitevent -// Modwatch -// Fsctl -// Initgroups -// Posix_spawn -// Nfsclnt -// Fhopen -// Minherit -// Semsys -// Msgsys -// Shmsys -// Semctl -// Semget -// Semop -// Msgctl -// Msgget -// Msgsnd -// Msgrcv -// Shmat -// Shmctl -// Shmdt -// Shmget -// Shm_open -// Shm_unlink -// Sem_open -// Sem_close -// Sem_unlink -// Sem_wait -// Sem_trywait -// Sem_post -// Sem_getvalue -// Sem_init -// Sem_destroy -// Open_extended -// Umask_extended -// Stat_extended -// Lstat_extended -// Fstat_extended -// Chmod_extended -// Fchmod_extended -// Access_extended -// Settid -// Gettid -// Setsgroups -// Getsgroups -// Setwgroups -// Getwgroups -// Mkfifo_extended -// Mkdir_extended -// Identitysvc -// Shared_region_check_np -// Shared_region_map_np -// __pthread_mutex_destroy -// __pthread_mutex_init -// __pthread_mutex_lock -// __pthread_mutex_trylock -// __pthread_mutex_unlock -// __pthread_cond_init -// __pthread_cond_destroy -// __pthread_cond_broadcast -// __pthread_cond_signal -// Setsid_with_pid -// __pthread_cond_timedwait -// Aio_fsync -// Aio_return -// Aio_suspend -// Aio_cancel -// Aio_error -// Aio_read -// Aio_write -// Lio_listio -// __pthread_cond_wait -// Iopolicysys -// __pthread_kill -// __pthread_sigmask -// __sigwait -// __disable_threadsignal -// __pthread_markcancel -// __pthread_canceled -// __semwait_signal -// Proc_info -// Stat64_extended -// Lstat64_extended -// Fstat64_extended -// __pthread_chdir -// __pthread_fchdir -// Audit -// Auditon -// Getauid -// Setauid -// Getaudit -// Setaudit -// Getaudit_addr -// Setaudit_addr -// Auditctl -// Bsdthread_create -// Bsdthread_terminate -// Stack_snapshot -// Bsdthread_register -// Workq_open -// Workq_ops -// __mac_execve -// __mac_syscall -// __mac_get_file -// __mac_set_file -// __mac_get_link -// __mac_set_link -// __mac_get_proc -// __mac_set_proc -// __mac_get_fd -// __mac_set_fd -// __mac_get_pid -// __mac_get_lcid -// __mac_get_lctx -// __mac_set_lctx -// Setlcid -// Read_nocancel -// Write_nocancel -// Open_nocancel -// Close_nocancel -// Wait4_nocancel -// Recvmsg_nocancel -// Sendmsg_nocancel -// Recvfrom_nocancel -// Accept_nocancel -// Fcntl_nocancel -// Select_nocancel -// Fsync_nocancel -// Connect_nocancel -// Sigsuspend_nocancel -// Readv_nocancel -// Writev_nocancel -// Sendto_nocancel -// Pread_nocancel -// Pwrite_nocancel -// Waitid_nocancel -// Poll_nocancel -// Msgsnd_nocancel -// Msgrcv_nocancel -// Sem_wait_nocancel -// Aio_suspend_nocancel -// __sigwait_nocancel -// __semwait_signal_nocancel -// __mac_mount -// __mac_get_mount -// __mac_getfsstat diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go index b8da51004..3967bca77 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build 386 && freebsd -// +build 386,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go index 47155c483..eff19ada2 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && freebsd -// +build amd64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go index 08932093f..4f24b517a 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm && freebsd -// +build arm,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go index d151a0d0e..ac30759ec 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm64 && freebsd -// +build arm64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go index d5cd64b37..aab725ca7 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build riscv64 && freebsd -// +build riscv64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_hurd.go b/vendor/golang.org/x/sys/unix/syscall_hurd.go index 381fd4673..ba46651f8 100644 --- a/vendor/golang.org/x/sys/unix/syscall_hurd.go +++ b/vendor/golang.org/x/sys/unix/syscall_hurd.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build hurd -// +build hurd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_hurd_386.go b/vendor/golang.org/x/sys/unix/syscall_hurd_386.go index 7cf54a3e4..df89f9e6b 100644 --- a/vendor/golang.org/x/sys/unix/syscall_hurd_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_hurd_386.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build 386 && hurd -// +build 386,hurd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_illumos.go b/vendor/golang.org/x/sys/unix/syscall_illumos.go index 87db5a6a8..a863f7052 100644 --- a/vendor/golang.org/x/sys/unix/syscall_illumos.go +++ b/vendor/golang.org/x/sys/unix/syscall_illumos.go @@ -5,7 +5,6 @@ // illumos system calls not present on Solaris. //go:build amd64 && illumos -// +build amd64,illumos package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux.go b/vendor/golang.org/x/sys/unix/syscall_linux.go index 973533153..0f85e29e6 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux.go @@ -61,15 +61,23 @@ func FanotifyMark(fd int, flags uint, mask uint64, dirFd int, pathname string) ( } //sys fchmodat(dirfd int, path string, mode uint32) (err error) - -func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { - // Linux fchmodat doesn't support the flags parameter. Mimick glibc's behavior - // and check the flags. Otherwise the mode would be applied to the symlink - // destination which is not what the user expects. - if flags&^AT_SYMLINK_NOFOLLOW != 0 { - return EINVAL - } else if flags&AT_SYMLINK_NOFOLLOW != 0 { - return EOPNOTSUPP +//sys fchmodat2(dirfd int, path string, mode uint32, flags int) (err error) + +func Fchmodat(dirfd int, path string, mode uint32, flags int) error { + // Linux fchmodat doesn't support the flags parameter, but fchmodat2 does. + // Try fchmodat2 if flags are specified. + if flags != 0 { + err := fchmodat2(dirfd, path, mode, flags) + if err == ENOSYS { + // fchmodat2 isn't available. If the flags are known to be valid, + // return EOPNOTSUPP to indicate that fchmodat doesn't support them. + if flags&^(AT_SYMLINK_NOFOLLOW|AT_EMPTY_PATH) != 0 { + return EINVAL + } else if flags&(AT_SYMLINK_NOFOLLOW|AT_EMPTY_PATH) != 0 { + return EOPNOTSUPP + } + } + return err } return fchmodat(dirfd, path, mode) } @@ -417,7 +425,8 @@ func (sa *SockaddrUnix) sockaddr() (unsafe.Pointer, _Socklen, error) { if n > 0 { sl += _Socklen(n) + 1 } - if sa.raw.Path[0] == '@' { + if sa.raw.Path[0] == '@' || (sa.raw.Path[0] == 0 && sl > 3) { + // Check sl > 3 so we don't change unnamed socket behavior. sa.raw.Path[0] = 0 // Don't count trailing NUL for abstract address. sl-- @@ -693,10 +702,10 @@ type SockaddrALG struct { func (sa *SockaddrALG) sockaddr() (unsafe.Pointer, _Socklen, error) { // Leave room for NUL byte terminator. - if len(sa.Type) > 13 { + if len(sa.Type) > len(sa.raw.Type)-1 { return nil, 0, EINVAL } - if len(sa.Name) > 63 { + if len(sa.Name) > len(sa.raw.Name)-1 { return nil, 0, EINVAL } @@ -704,17 +713,8 @@ func (sa *SockaddrALG) sockaddr() (unsafe.Pointer, _Socklen, error) { sa.raw.Feat = sa.Feature sa.raw.Mask = sa.Mask - typ, err := ByteSliceFromString(sa.Type) - if err != nil { - return nil, 0, err - } - name, err := ByteSliceFromString(sa.Name) - if err != nil { - return nil, 0, err - } - - copy(sa.raw.Type[:], typ) - copy(sa.raw.Name[:], name) + copy(sa.raw.Type[:], sa.Type) + copy(sa.raw.Name[:], sa.Name) return unsafe.Pointer(&sa.raw), SizeofSockaddrALG, nil } @@ -1310,7 +1310,7 @@ func GetsockoptString(fd, level, opt int) (string, error) { return "", err } } - return string(buf[:vallen-1]), nil + return ByteSliceToString(buf[:vallen]), nil } func GetsockoptTpacketStats(fd, level, opt int) (*TpacketStats, error) { @@ -1699,12 +1699,23 @@ func PtracePokeUser(pid int, addr uintptr, data []byte) (count int, err error) { return ptracePoke(PTRACE_POKEUSR, PTRACE_PEEKUSR, pid, addr, data) } +// elfNT_PRSTATUS is a copy of the debug/elf.NT_PRSTATUS constant so +// x/sys/unix doesn't need to depend on debug/elf and thus +// compress/zlib, debug/dwarf, and other packages. +const elfNT_PRSTATUS = 1 + func PtraceGetRegs(pid int, regsout *PtraceRegs) (err error) { - return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout)) + var iov Iovec + iov.Base = (*byte)(unsafe.Pointer(regsout)) + iov.SetLen(int(unsafe.Sizeof(*regsout))) + return ptracePtr(PTRACE_GETREGSET, pid, uintptr(elfNT_PRSTATUS), unsafe.Pointer(&iov)) } func PtraceSetRegs(pid int, regs *PtraceRegs) (err error) { - return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs)) + var iov Iovec + iov.Base = (*byte)(unsafe.Pointer(regs)) + iov.SetLen(int(unsafe.Sizeof(*regs))) + return ptracePtr(PTRACE_SETREGSET, pid, uintptr(elfNT_PRSTATUS), unsafe.Pointer(&iov)) } func PtraceSetOptions(pid int, options int) (err error) { @@ -1873,9 +1884,8 @@ func Getpgrp() (pid int) { //sys OpenTree(dfd int, fileName string, flags uint) (r int, err error) //sys PerfEventOpen(attr *PerfEventAttr, pid int, cpu int, groupFd int, flags int) (fd int, err error) //sys PivotRoot(newroot string, putold string) (err error) = SYS_PIVOT_ROOT -//sysnb Prlimit(pid int, resource int, newlimit *Rlimit, old *Rlimit) (err error) = SYS_PRLIMIT64 //sys Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) (err error) -//sys Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) = SYS_PSELECT6 +//sys pselect6(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *sigset_argpack) (n int, err error) //sys read(fd int, p []byte) (n int, err error) //sys Removexattr(path string, attr string) (err error) //sys Renameat2(olddirfd int, oldpath string, newdirfd int, newpath string, flags uint) (err error) @@ -1887,6 +1897,15 @@ func Getpgrp() (pid int) { //sysnb Settimeofday(tv *Timeval) (err error) //sys Setns(fd int, nstype int) (err error) +//go:linkname syscall_prlimit syscall.prlimit +func syscall_prlimit(pid, resource int, newlimit, old *syscall.Rlimit) error + +func Prlimit(pid, resource int, newlimit, old *Rlimit) error { + // Just call the syscall version, because as of Go 1.21 + // it will affect starting a new process. + return syscall_prlimit(pid, resource, (*syscall.Rlimit)(newlimit), (*syscall.Rlimit)(old)) +} + // PrctlRetInt performs a prctl operation specified by option and further // optional arguments arg2 through arg5 depending on option. It returns a // non-negative integer that is returned by the prctl syscall. @@ -1969,8 +1988,6 @@ func Signalfd(fd int, sigmask *Sigset_t, flags int) (newfd int, err error) { //sys Unshare(flags int) (err error) //sys write(fd int, p []byte) (n int, err error) //sys exitThread(code int) (err error) = SYS_EXIT -//sys readlen(fd int, p *byte, np int) (n int, err error) = SYS_READ -//sys writelen(fd int, p *byte, np int) (n int, err error) = SYS_WRITE //sys readv(fd int, iovs []Iovec) (n int, err error) = SYS_READV //sys writev(fd int, iovs []Iovec) (n int, err error) = SYS_WRITEV //sys preadv(fd int, iovs []Iovec, offs_l uintptr, offs_h uintptr) (n int, err error) = SYS_PREADV @@ -2105,21 +2122,7 @@ func writevRacedetect(iovecs []Iovec, n int) { // mmap varies by architecture; see syscall_linux_*.go. //sys munmap(addr uintptr, length uintptr) (err error) - -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - +//sys mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) //sys Madvise(b []byte, advice int) (err error) //sys Mprotect(b []byte, prot int) (err error) //sys Mlock(b []byte) (err error) @@ -2128,6 +2131,12 @@ func Munmap(b []byte) (err error) { //sys Munlock(b []byte) (err error) //sys Munlockall() (err error) +const ( + mremapFixed = MREMAP_FIXED + mremapDontunmap = MREMAP_DONTUNMAP + mremapMaymove = MREMAP_MAYMOVE +) + // Vmsplice splices user pages from a slice of Iovecs into a pipe specified by fd, // using the specified flags. func Vmsplice(fd int, iovs []Iovec, flags int) (int, error) { @@ -2412,99 +2421,75 @@ func PthreadSigmask(how int, set, oldset *Sigset_t) error { return rtSigprocmask(how, set, oldset, _C__NSIG/8) } -/* - * Unimplemented - */ -// AfsSyscall -// ArchPrctl -// Brk -// ClockNanosleep -// ClockSettime -// Clone -// EpollCtlOld -// EpollPwait -// EpollWaitOld -// Execve -// Fork -// Futex -// GetKernelSyms -// GetMempolicy -// GetRobustList -// GetThreadArea -// Getpmsg -// IoCancel -// IoDestroy -// IoGetevents -// IoSetup -// IoSubmit -// IoprioGet -// IoprioSet -// KexecLoad -// LookupDcookie -// Mbind -// MigratePages -// Mincore -// ModifyLdt -// Mount -// MovePages -// MqGetsetattr -// MqNotify -// MqOpen -// MqTimedreceive -// MqTimedsend -// MqUnlink -// Mremap -// Msgctl -// Msgget -// Msgrcv -// Msgsnd -// Nfsservctl -// Personality -// Pselect6 -// Ptrace -// Putpmsg -// Quotactl -// Readahead -// Readv -// RemapFilePages -// RestartSyscall -// RtSigaction -// RtSigpending -// RtSigqueueinfo -// RtSigreturn -// RtSigsuspend -// RtSigtimedwait -// SchedGetPriorityMax -// SchedGetPriorityMin -// SchedGetparam -// SchedGetscheduler -// SchedRrGetInterval -// SchedSetparam -// SchedYield -// Security -// Semctl -// Semget -// Semop -// Semtimedop -// SetMempolicy -// SetRobustList -// SetThreadArea -// SetTidAddress -// Sigaltstack -// Swapoff -// Swapon -// Sysfs -// TimerCreate -// TimerDelete -// TimerGetoverrun -// TimerGettime -// TimerSettime -// Tkill (obsolete) -// Tuxcall -// Umount2 -// Uselib -// Utimensat -// Vfork -// Vhangup -// Vserver -// _Sysctl +//sysnb getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) +//sysnb getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) + +func Getresuid() (ruid, euid, suid int) { + var r, e, s _C_int + getresuid(&r, &e, &s) + return int(r), int(e), int(s) +} + +func Getresgid() (rgid, egid, sgid int) { + var r, e, s _C_int + getresgid(&r, &e, &s) + return int(r), int(e), int(s) +} + +// Pselect is a wrapper around the Linux pselect6 system call. +// This version does not modify the timeout argument. +func Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { + // Per https://man7.org/linux/man-pages/man2/select.2.html#NOTES, + // The Linux pselect6() system call modifies its timeout argument. + // [Not modifying the argument] is the behavior required by POSIX.1-2001. + var mutableTimeout *Timespec + if timeout != nil { + mutableTimeout = new(Timespec) + *mutableTimeout = *timeout + } + + // The final argument of the pselect6() system call is not a + // sigset_t * pointer, but is instead a structure + var kernelMask *sigset_argpack + if sigmask != nil { + wordBits := 32 << (^uintptr(0) >> 63) // see math.intSize + + // A sigset stores one bit per signal, + // offset by 1 (because signal 0 does not exist). + // So the number of words needed is ⌈__C_NSIG - 1 / wordBits⌉. + sigsetWords := (_C__NSIG - 1 + wordBits - 1) / (wordBits) + + sigsetBytes := uintptr(sigsetWords * (wordBits / 8)) + kernelMask = &sigset_argpack{ + ss: sigmask, + ssLen: sigsetBytes, + } + } + + return pselect6(nfd, r, w, e, mutableTimeout, kernelMask) +} + +//sys schedSetattr(pid int, attr *SchedAttr, flags uint) (err error) +//sys schedGetattr(pid int, attr *SchedAttr, size uint, flags uint) (err error) + +// SchedSetAttr is a wrapper for sched_setattr(2) syscall. +// https://man7.org/linux/man-pages/man2/sched_setattr.2.html +func SchedSetAttr(pid int, attr *SchedAttr, flags uint) error { + if attr == nil { + return EINVAL + } + attr.Size = SizeofSchedAttr + return schedSetattr(pid, attr, flags) +} + +// SchedGetAttr is a wrapper for sched_getattr(2) syscall. +// https://man7.org/linux/man-pages/man2/sched_getattr.2.html +func SchedGetAttr(pid int, flags uint) (*SchedAttr, error) { + attr := &SchedAttr{} + if err := schedGetattr(pid, attr, SizeofSchedAttr, flags); err != nil { + return nil, err + } + return attr, nil +} + +//sys Cachestat(fd uint, crange *CachestatRange, cstat *Cachestat_t, flags uint) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_386.go b/vendor/golang.org/x/sys/unix/syscall_linux_386.go index ff5b5899d..506dafa7b 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_386.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build 386 && linux -// +build 386,linux package unix @@ -97,33 +96,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { return } -//sysnb setrlimit(resource int, rlim *rlimit32) (err error) = SYS_SETRLIMIT - -func Setrlimit(resource int, rlim *Rlimit) (err error) { - err = Prlimit(0, resource, rlim, nil) - if err != ENOSYS { - return err - } - - rl := rlimit32{} - if rlim.Cur == rlimInf64 { - rl.Cur = rlimInf32 - } else if rlim.Cur < uint64(rlimInf32) { - rl.Cur = uint32(rlim.Cur) - } else { - return EINVAL - } - if rlim.Max == rlimInf64 { - rl.Max = rlimInf32 - } else if rlim.Max < uint64(rlimInf32) { - rl.Max = uint32(rlim.Max) - } else { - return EINVAL - } - - return setrlimit(resource, &rl) -} - func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { newoffset, errno := seek(fd, offset, whence) if errno != 0 { diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_alarm.go b/vendor/golang.org/x/sys/unix/syscall_linux_alarm.go index 08086ac6a..38d55641b 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_alarm.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_alarm.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (386 || amd64 || mips || mipsle || mips64 || mipsle || ppc64 || ppc64le || ppc || s390x || sparc64) -// +build linux -// +build 386 amd64 mips mipsle mips64 mipsle ppc64 ppc64le ppc s390x sparc64 package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go b/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go index 9b2703532..d557cf8de 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && linux -// +build amd64,linux package unix @@ -40,13 +39,12 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_amd64_gc.go b/vendor/golang.org/x/sys/unix/syscall_linux_amd64_gc.go index 8b0f0f3aa..facdb83b2 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_amd64_gc.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_amd64_gc.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && linux && gc -// +build amd64,linux,gc package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_arm.go b/vendor/golang.org/x/sys/unix/syscall_linux_arm.go index 856ad1d63..cd2dd797f 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_arm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm && linux -// +build arm,linux package unix @@ -171,33 +170,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { return } -//sysnb setrlimit(resource int, rlim *rlimit32) (err error) = SYS_SETRLIMIT - -func Setrlimit(resource int, rlim *Rlimit) (err error) { - err = Prlimit(0, resource, rlim, nil) - if err != ENOSYS { - return err - } - - rl := rlimit32{} - if rlim.Cur == rlimInf64 { - rl.Cur = rlimInf32 - } else if rlim.Cur < uint64(rlimInf32) { - rl.Cur = uint32(rlim.Cur) - } else { - return EINVAL - } - if rlim.Max == rlimInf64 { - rl.Max = rlimInf32 - } else if rlim.Max < uint64(rlimInf32) { - rl.Max = uint32(rlim.Max) - } else { - return EINVAL - } - - return setrlimit(resource, &rl) -} - func (r *PtraceRegs) PC() uint64 { return uint64(r.Uregs[15]) } func (r *PtraceRegs) SetPC(pc uint64) { r.Uregs[15] = uint32(pc) } diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go b/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go index 6422704bc..cf2ee6c75 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm64 && linux -// +build arm64,linux package unix @@ -33,13 +32,12 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb setrlimit(resource int, rlim *Rlimit) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) @@ -143,15 +141,6 @@ func Getrlimit(resource int, rlim *Rlimit) error { return getrlimit(resource, rlim) } -// Setrlimit prefers the prlimit64 system call. See issue 38604. -func Setrlimit(resource int, rlim *Rlimit) error { - err := Prlimit(0, resource, rlim, nil) - if err != ENOSYS { - return err - } - return setrlimit(resource, rlim) -} - func (r *PtraceRegs) PC() uint64 { return r.Pc } func (r *PtraceRegs) SetPC(pc uint64) { r.Pc = pc } diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_gc.go b/vendor/golang.org/x/sys/unix/syscall_linux_gc.go index 2b1168d7d..ffc4c2b63 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_gc.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_gc.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && gc -// +build linux,gc package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_gc_386.go b/vendor/golang.org/x/sys/unix/syscall_linux_gc_386.go index 9843fb489..9ebfdcf44 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_gc_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_gc_386.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && gc && 386 -// +build linux,gc,386 package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_gc_arm.go b/vendor/golang.org/x/sys/unix/syscall_linux_gc_arm.go index a6008fccd..5f2b57c4c 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_gc_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_gc_arm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm && gc && linux -// +build arm,gc,linux package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_386.go b/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_386.go index 7740af242..d1a3ad826 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_386.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && gccgo && 386 -// +build linux,gccgo,386 package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_arm.go b/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_arm.go index e16a12299..f2f67423e 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_arm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && gccgo && arm -// +build linux,gccgo,arm package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go b/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go index 59dab510e..3d0e98451 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build loong64 && linux -// +build loong64,linux package unix @@ -28,7 +27,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) @@ -126,11 +125,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { return } -func Setrlimit(resource int, rlim *Rlimit) (err error) { - err = Prlimit(0, resource, rlim, nil) - return -} - func futimesat(dirfd int, path string, tv *[2]Timeval) (err error) { if tv == nil { return utimensat(dirfd, path, nil, 0) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go b/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go index bfef09a39..70963a95a 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (mips64 || mips64le) -// +build linux -// +build mips64 mips64le package unix @@ -31,13 +29,12 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) //sys Statfs(path string, buf *Statfs_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go b/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go index ab3025096..c218ebd28 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (mips || mipsle) -// +build linux -// +build mips mipsle package unix @@ -151,33 +149,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { return } -//sysnb setrlimit(resource int, rlim *rlimit32) (err error) = SYS_SETRLIMIT - -func Setrlimit(resource int, rlim *Rlimit) (err error) { - err = Prlimit(0, resource, rlim, nil) - if err != ENOSYS { - return err - } - - rl := rlimit32{} - if rlim.Cur == rlimInf64 { - rl.Cur = rlimInf32 - } else if rlim.Cur < uint64(rlimInf32) { - rl.Cur = uint32(rlim.Cur) - } else { - return EINVAL - } - if rlim.Max == rlimInf64 { - rl.Max = rlimInf32 - } else if rlim.Max < uint64(rlimInf32) { - rl.Max = uint32(rlim.Max) - } else { - return EINVAL - } - - return setrlimit(resource, &rl) -} - func (r *PtraceRegs) PC() uint64 { return r.Epc } func (r *PtraceRegs) SetPC(pc uint64) { r.Epc = pc } diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go b/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go index eac1cf1ac..e6c48500c 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && ppc -// +build linux,ppc package unix @@ -159,33 +158,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { return } -//sysnb setrlimit(resource int, rlim *rlimit32) (err error) = SYS_SETRLIMIT - -func Setrlimit(resource int, rlim *Rlimit) (err error) { - err = Prlimit(0, resource, rlim, nil) - if err != ENOSYS { - return err - } - - rl := rlimit32{} - if rlim.Cur == rlimInf64 { - rl.Cur = rlimInf32 - } else if rlim.Cur < uint64(rlimInf32) { - rl.Cur = uint32(rlim.Cur) - } else { - return EINVAL - } - if rlim.Max == rlimInf64 { - rl.Max = rlimInf32 - } else if rlim.Max < uint64(rlimInf32) { - rl.Max = uint32(rlim.Max) - } else { - return EINVAL - } - - return setrlimit(resource, &rl) -} - func (r *PtraceRegs) PC() uint32 { return r.Nip } func (r *PtraceRegs) SetPC(pc uint32) { r.Nip = pc } diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go b/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go index 4df56616b..7286a9aa8 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (ppc64 || ppc64le) -// +build linux -// +build ppc64 ppc64le package unix @@ -34,7 +32,6 @@ package unix //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) //sys Stat(path string, stat *Stat_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go index 5f4243dea..6f5a28894 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build riscv64 && linux -// +build riscv64,linux package unix @@ -32,13 +31,12 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) @@ -178,3 +176,14 @@ func KexecFileLoad(kernelFd int, initrdFd int, cmdline string, flags int) error } return kexecFileLoad(kernelFd, initrdFd, cmdlineLen, cmdline, flags) } + +//sys riscvHWProbe(pairs []RISCVHWProbePairs, cpuCount uintptr, cpus *CPUSet, flags uint) (err error) + +func RISCVHWProbe(pairs []RISCVHWProbePairs, set *CPUSet, flags uint) (err error) { + var setSize uintptr + + if set != nil { + setSize = uintptr(unsafe.Sizeof(*set)) + } + return riscvHWProbe(pairs, setSize, set, flags) +} diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go b/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go index d0a7d4066..66f31210d 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build s390x && linux -// +build s390x,linux package unix @@ -34,7 +33,6 @@ import ( //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) //sys Stat(path string, stat *Stat_t) (err error) //sys Statfs(path string, buf *Statfs_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go b/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go index f5c793be2..11d1f1698 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build sparc64 && linux -// +build sparc64,linux package unix @@ -31,7 +30,6 @@ package unix //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) //sys Stat(path string, stat *Stat_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd.go b/vendor/golang.org/x/sys/unix/syscall_netbsd.go index e66865dcc..88162099a 100644 --- a/vendor/golang.org/x/sys/unix/syscall_netbsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_netbsd.go @@ -340,7 +340,6 @@ func Statvfs(path string, buf *Statvfs_t) (err error) { //sys Setpriority(which int, who int, prio int) (err error) //sysnb Setregid(rgid int, egid int) (err error) //sysnb Setreuid(ruid int, euid int) (err error) -//sysnb Setrlimit(which int, lim *Rlimit) (err error) //sysnb Setsid() (pid int, err error) //sysnb Settimeofday(tp *Timeval) (err error) //sysnb Setuid(uid int) (err error) @@ -357,267 +356,16 @@ func Statvfs(path string, buf *Statvfs_t) (err error) { //sys write(fd int, p []byte) (n int, err error) //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) //sys munmap(addr uintptr, length uintptr) (err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ -//sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE //sys utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) -/* - * Unimplemented - */ -// ____semctl13 -// __clone -// __fhopen40 -// __fhstat40 -// __fhstatvfs140 -// __fstat30 -// __getcwd -// __getfh30 -// __getlogin -// __lstat30 -// __mount50 -// __msgctl13 -// __msync13 -// __ntp_gettime30 -// __posix_chown -// __posix_fchown -// __posix_lchown -// __posix_rename -// __setlogin -// __shmctl13 -// __sigaction_sigtramp -// __sigaltstack14 -// __sigpending14 -// __sigprocmask14 -// __sigsuspend14 -// __sigtimedwait -// __stat30 -// __syscall -// __vfork14 -// _ksem_close -// _ksem_destroy -// _ksem_getvalue -// _ksem_init -// _ksem_open -// _ksem_post -// _ksem_trywait -// _ksem_unlink -// _ksem_wait -// _lwp_continue -// _lwp_create -// _lwp_ctl -// _lwp_detach -// _lwp_exit -// _lwp_getname -// _lwp_getprivate -// _lwp_kill -// _lwp_park -// _lwp_self -// _lwp_setname -// _lwp_setprivate -// _lwp_suspend -// _lwp_unpark -// _lwp_unpark_all -// _lwp_wait -// _lwp_wakeup -// _pset_bind -// _sched_getaffinity -// _sched_getparam -// _sched_setaffinity -// _sched_setparam -// acct -// aio_cancel -// aio_error -// aio_fsync -// aio_read -// aio_return -// aio_suspend -// aio_write -// break -// clock_getres -// clock_gettime -// clock_settime -// compat_09_ogetdomainname -// compat_09_osetdomainname -// compat_09_ouname -// compat_10_omsgsys -// compat_10_osemsys -// compat_10_oshmsys -// compat_12_fstat12 -// compat_12_getdirentries -// compat_12_lstat12 -// compat_12_msync -// compat_12_oreboot -// compat_12_oswapon -// compat_12_stat12 -// compat_13_sigaction13 -// compat_13_sigaltstack13 -// compat_13_sigpending13 -// compat_13_sigprocmask13 -// compat_13_sigreturn13 -// compat_13_sigsuspend13 -// compat_14___semctl -// compat_14_msgctl -// compat_14_shmctl -// compat_16___sigaction14 -// compat_16___sigreturn14 -// compat_20_fhstatfs -// compat_20_fstatfs -// compat_20_getfsstat -// compat_20_statfs -// compat_30___fhstat30 -// compat_30___fstat13 -// compat_30___lstat13 -// compat_30___stat13 -// compat_30_fhopen -// compat_30_fhstat -// compat_30_fhstatvfs1 -// compat_30_getdents -// compat_30_getfh -// compat_30_ntp_gettime -// compat_30_socket -// compat_40_mount -// compat_43_fstat43 -// compat_43_lstat43 -// compat_43_oaccept -// compat_43_ocreat -// compat_43_oftruncate -// compat_43_ogetdirentries -// compat_43_ogetdtablesize -// compat_43_ogethostid -// compat_43_ogethostname -// compat_43_ogetkerninfo -// compat_43_ogetpagesize -// compat_43_ogetpeername -// compat_43_ogetrlimit -// compat_43_ogetsockname -// compat_43_okillpg -// compat_43_olseek -// compat_43_ommap -// compat_43_oquota -// compat_43_orecv -// compat_43_orecvfrom -// compat_43_orecvmsg -// compat_43_osend -// compat_43_osendmsg -// compat_43_osethostid -// compat_43_osethostname -// compat_43_osetrlimit -// compat_43_osigblock -// compat_43_osigsetmask -// compat_43_osigstack -// compat_43_osigvec -// compat_43_otruncate -// compat_43_owait -// compat_43_stat43 -// execve -// extattr_delete_fd -// extattr_delete_file -// extattr_delete_link -// extattr_get_fd -// extattr_get_file -// extattr_get_link -// extattr_list_fd -// extattr_list_file -// extattr_list_link -// extattr_set_fd -// extattr_set_file -// extattr_set_link -// extattrctl -// fchroot -// fdatasync -// fgetxattr -// fktrace -// flistxattr -// fork -// fremovexattr -// fsetxattr -// fstatvfs1 -// fsync_range -// getcontext -// getitimer -// getvfsstat -// getxattr -// ktrace -// lchflags -// lchmod -// lfs_bmapv -// lfs_markv -// lfs_segclean -// lfs_segwait -// lgetxattr -// lio_listio -// listxattr -// llistxattr -// lremovexattr -// lseek -// lsetxattr -// lutimes -// madvise -// mincore -// minherit -// modctl -// mq_close -// mq_getattr -// mq_notify -// mq_open -// mq_receive -// mq_send -// mq_setattr -// mq_timedreceive -// mq_timedsend -// mq_unlink -// mremap -// msgget -// msgrcv -// msgsnd -// nfssvc -// ntp_adjtime -// pmc_control -// pmc_get_info -// pollts -// preadv -// profil -// pselect -// pset_assign -// pset_create -// pset_destroy -// ptrace -// pwritev -// quotactl -// rasctl -// readv -// reboot -// removexattr -// sa_enable -// sa_preempt -// sa_register -// sa_setconcurrency -// sa_stacks -// sa_yield -// sbrk -// sched_yield -// semconfig -// semget -// semop -// setcontext -// setitimer -// setxattr -// shmat -// shmdt -// shmget -// sstk -// statvfs1 -// swapctl -// sysarch -// syscall -// timer_create -// timer_delete -// timer_getoverrun -// timer_gettime -// timer_settime -// undelete -// utrace -// uuidgen -// vadvise -// vfork -// writev +const ( + mremapFixed = MAP_FIXED + mremapDontunmap = 0 + mremapMaymove = 0 +) + +//sys mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) = SYS_MREMAP + +func mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (uintptr, error) { + return mremapNetBSD(oldaddr, oldlength, newaddr, newlength, flags) +} diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd_386.go b/vendor/golang.org/x/sys/unix/syscall_netbsd_386.go index 5199d282f..7a5eb5743 100644 --- a/vendor/golang.org/x/sys/unix/syscall_netbsd_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_netbsd_386.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build 386 && netbsd -// +build 386,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/syscall_netbsd_amd64.go index 70a9c52e9..62d8957ae 100644 --- a/vendor/golang.org/x/sys/unix/syscall_netbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_netbsd_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && netbsd -// +build amd64,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd_arm.go b/vendor/golang.org/x/sys/unix/syscall_netbsd_arm.go index 3eb5942f9..ce6a06885 100644 --- a/vendor/golang.org/x/sys/unix/syscall_netbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_netbsd_arm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm && netbsd -// +build arm,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/syscall_netbsd_arm64.go index fc6ccfd81..d46d689d1 100644 --- a/vendor/golang.org/x/sys/unix/syscall_netbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_netbsd_arm64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm64 && netbsd -// +build arm64,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd.go b/vendor/golang.org/x/sys/unix/syscall_openbsd.go index 5e9de23ae..b25343c71 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd.go @@ -137,18 +137,28 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e } func Getfsstat(buf []Statfs_t, flags int) (n int, err error) { - var _p0 unsafe.Pointer + var bufptr *Statfs_t var bufsize uintptr if len(buf) > 0 { - _p0 = unsafe.Pointer(&buf[0]) + bufptr = &buf[0] bufsize = unsafe.Sizeof(Statfs_t{}) * uintptr(len(buf)) } - r0, _, e1 := Syscall(SYS_GETFSSTAT, uintptr(_p0), bufsize, uintptr(flags)) - n = int(r0) - if e1 != 0 { - err = e1 - } - return + return getfsstat(bufptr, bufsize, flags) +} + +//sysnb getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) +//sysnb getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) + +func Getresuid() (ruid, euid, suid int) { + var r, e, s _C_int + getresuid(&r, &e, &s) + return int(r), int(e), int(s) +} + +func Getresgid() (rgid, egid, sgid int) { + var r, e, s _C_int + getresgid(&r, &e, &s) + return int(r), int(e), int(s) } //sys ioctl(fd int, req uint, arg uintptr) (err error) @@ -156,6 +166,20 @@ func Getfsstat(buf []Statfs_t, flags int) (n int, err error) { //sys sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) = SYS___SYSCTL +//sys fcntl(fd int, cmd int, arg int) (n int, err error) +//sys fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) = SYS_FCNTL + +// FcntlInt performs a fcntl syscall on fd with the provided command and argument. +func FcntlInt(fd uintptr, cmd, arg int) (int, error) { + return fcntl(int(fd), cmd, arg) +} + +// FcntlFlock performs a fcntl syscall for the F_GETLK, F_SETLK or F_SETLKW command. +func FcntlFlock(fd uintptr, cmd int, lk *Flock_t) error { + _, err := fcntlPtr(int(fd), cmd, unsafe.Pointer(lk)) + return err +} + //sys ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) func Ppoll(fds []PollFd, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { @@ -294,7 +318,6 @@ func Uname(uname *Utsname) error { //sysnb Setreuid(ruid int, euid int) (err error) //sysnb Setresgid(rgid int, egid int, sgid int) (err error) //sysnb Setresuid(ruid int, euid int, suid int) (err error) -//sysnb Setrlimit(which int, lim *Rlimit) (err error) //sysnb Setrtable(rtable int) (err error) //sysnb Setsid() (pid int, err error) //sysnb Settimeofday(tp *Timeval) (err error) @@ -312,80 +335,7 @@ func Uname(uname *Utsname) error { //sys write(fd int, p []byte) (n int, err error) //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) //sys munmap(addr uintptr, length uintptr) (err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ -//sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE +//sys getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) //sys utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) - -/* - * Unimplemented - */ -// __getcwd -// __semctl -// __syscall -// __sysctl -// adjfreq -// break -// clock_getres -// clock_gettime -// clock_settime -// closefrom -// execve -// fhopen -// fhstat -// fhstatfs -// fork -// futimens -// getfh -// getgid -// getitimer -// getlogin -// getresgid -// getresuid -// getthrid -// ktrace -// lfs_bmapv -// lfs_markv -// lfs_segclean -// lfs_segwait -// mincore -// minherit -// mount -// mquery -// msgctl -// msgget -// msgrcv -// msgsnd -// nfssvc -// nnpfspioctl -// preadv -// profil -// pwritev -// quotactl -// readv -// reboot -// renameat -// rfork -// sched_yield -// semget -// semop -// setgroups -// setitimer -// setsockopt -// shmat -// shmctl -// shmdt -// shmget -// sigaction -// sigaltstack -// sigpending -// sigprocmask -// sigreturn -// sigsuspend -// sysarch -// syscall -// threxit -// thrsigdivert -// thrsleep -// thrwakeup -// vfork -// writev +//sys pledge(promises *byte, execpromises *byte) (err error) +//sys unveil(path *byte, flags *byte) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_386.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_386.go index 6baabcdcb..9ddc89f4f 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_386.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build 386 && openbsd -// +build 386,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_amd64.go index bab25360e..70a3c96ee 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && openbsd -// +build amd64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_arm.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_arm.go index 8eed3c4d4..265caa87f 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_arm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm && openbsd -// +build arm,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_arm64.go index 483dde99d..ac4fda171 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_arm64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm64 && openbsd -// +build arm64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_libc.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_libc.go index 04aa43f41..0a451e6dd 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_libc.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_libc.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build openbsd -// +build openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_ppc64.go index c2796139c..30a308cbb 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_ppc64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build ppc64 && openbsd -// +build ppc64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_riscv64.go index 23199a7ff..ea954330f 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_riscv64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build riscv64 && openbsd -// +build riscv64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_solaris.go b/vendor/golang.org/x/sys/unix/syscall_solaris.go index d3444b64d..21974af06 100644 --- a/vendor/golang.org/x/sys/unix/syscall_solaris.go +++ b/vendor/golang.org/x/sys/unix/syscall_solaris.go @@ -128,7 +128,8 @@ func (sa *SockaddrUnix) sockaddr() (unsafe.Pointer, _Socklen, error) { if n > 0 { sl += _Socklen(n) + 1 } - if sa.raw.Path[0] == '@' { + if sa.raw.Path[0] == '@' || (sa.raw.Path[0] == 0 && sl > 3) { + // Check sl > 3 so we don't change unnamed socket behavior. sa.raw.Path[0] = 0 // Don't count trailing NUL for abstract address. sl-- @@ -157,7 +158,7 @@ func GetsockoptString(fd, level, opt int) (string, error) { if err != nil { return "", err } - return string(buf[:vallen-1]), nil + return ByteSliceToString(buf[:vallen]), nil } const ImplementsGetwd = true @@ -545,24 +546,24 @@ func Minor(dev uint64) uint32 { * Expose the ioctl function */ -//sys ioctlRet(fd int, req uint, arg uintptr) (ret int, err error) = libc.ioctl -//sys ioctlPtrRet(fd int, req uint, arg unsafe.Pointer) (ret int, err error) = libc.ioctl +//sys ioctlRet(fd int, req int, arg uintptr) (ret int, err error) = libc.ioctl +//sys ioctlPtrRet(fd int, req int, arg unsafe.Pointer) (ret int, err error) = libc.ioctl -func ioctl(fd int, req uint, arg uintptr) (err error) { +func ioctl(fd int, req int, arg uintptr) (err error) { _, err = ioctlRet(fd, req, arg) return err } -func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { +func ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) { _, err = ioctlPtrRet(fd, req, arg) return err } -func IoctlSetTermio(fd int, req uint, value *Termio) error { +func IoctlSetTermio(fd int, req int, value *Termio) error { return ioctlPtr(fd, req, unsafe.Pointer(value)) } -func IoctlGetTermio(fd int, req uint) (*Termio, error) { +func IoctlGetTermio(fd int, req int) (*Termio, error) { var value Termio err := ioctlPtr(fd, req, unsafe.Pointer(&value)) return &value, err @@ -665,7 +666,6 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e //sys Setpriority(which int, who int, prio int) (err error) //sysnb Setregid(rgid int, egid int) (err error) //sysnb Setreuid(ruid int, euid int) (err error) -//sysnb Setrlimit(which int, lim *Rlimit) (err error) //sysnb Setsid() (pid int, err error) //sysnb Setuid(uid int) (err error) //sys Shutdown(s int, how int) (err error) = libsocket.shutdown @@ -699,38 +699,6 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e //sys setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) = libsocket.setsockopt //sys recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) = libsocket.recvfrom -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procread)), 3, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf), 0, 0, 0) - n = int(r0) - if e1 != 0 { - err = e1 - } - return -} - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procwrite)), 3, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf), 0, 0, 0) - n = int(r0) - if e1 != 0 { - err = e1 - } - return -} - -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - // Event Ports type fileObjCookie struct { @@ -1080,11 +1048,11 @@ func Getmsg(fd int, cl []byte, data []byte) (retCl []byte, retData []byte, flags return retCl, retData, flags, nil } -func IoctlSetIntRetInt(fd int, req uint, arg int) (int, error) { +func IoctlSetIntRetInt(fd int, req int, arg int) (int, error) { return ioctlRet(fd, req, uintptr(arg)) } -func IoctlSetString(fd int, req uint, val string) error { +func IoctlSetString(fd int, req int, val string) error { bs := make([]byte, len(val)+1) copy(bs[:len(bs)-1], val) err := ioctlPtr(fd, req, unsafe.Pointer(&bs[0])) @@ -1120,7 +1088,7 @@ func (l *Lifreq) GetLifruUint() uint { return *(*uint)(unsafe.Pointer(&l.Lifru[0])) } -func IoctlLifreq(fd int, req uint, l *Lifreq) error { +func IoctlLifreq(fd int, req int, l *Lifreq) error { return ioctlPtr(fd, req, unsafe.Pointer(l)) } @@ -1131,6 +1099,6 @@ func (s *Strioctl) SetInt(i int) { s.Dp = (*int8)(unsafe.Pointer(&i)) } -func IoctlSetStrioctlRetInt(fd int, req uint, s *Strioctl) (int, error) { +func IoctlSetStrioctlRetInt(fd int, req int, s *Strioctl) (int, error) { return ioctlPtrRet(fd, req, unsafe.Pointer(s)) } diff --git a/vendor/golang.org/x/sys/unix/syscall_solaris_amd64.go b/vendor/golang.org/x/sys/unix/syscall_solaris_amd64.go index 0bd25ef81..e02d8ceae 100644 --- a/vendor/golang.org/x/sys/unix/syscall_solaris_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_solaris_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && solaris -// +build amd64,solaris package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_unix.go b/vendor/golang.org/x/sys/unix/syscall_unix.go index 00f0aa375..77081de8c 100644 --- a/vendor/golang.org/x/sys/unix/syscall_unix.go +++ b/vendor/golang.org/x/sys/unix/syscall_unix.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris package unix @@ -147,6 +146,14 @@ func (m *mmapper) Munmap(data []byte) (err error) { return nil } +func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { + return mapper.Mmap(fd, offset, length, prot, flags) +} + +func Munmap(b []byte) (err error) { + return mapper.Munmap(b) +} + func Read(fd int, p []byte) (n int, err error) { n, err = read(fd, p) if raceenabled { @@ -541,6 +548,9 @@ func SetNonblock(fd int, nonblocking bool) (err error) { if err != nil { return err } + if (flag&O_NONBLOCK != 0) == nonblocking { + return nil + } if nonblocking { flag |= O_NONBLOCK } else { @@ -587,3 +597,10 @@ func emptyIovecs(iov []Iovec) bool { } return true } + +// Setrlimit sets a resource limit. +func Setrlimit(resource int, rlim *Rlimit) error { + // Just call the syscall version, because as of Go 1.21 + // it will affect starting a new process. + return syscall.Setrlimit(resource, (*syscall.Rlimit)(rlim)) +} diff --git a/vendor/golang.org/x/sys/unix/syscall_unix_gc.go b/vendor/golang.org/x/sys/unix/syscall_unix_gc.go index b6919ca58..05c95bccf 100644 --- a/vendor/golang.org/x/sys/unix/syscall_unix_gc.go +++ b/vendor/golang.org/x/sys/unix/syscall_unix_gc.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (darwin || dragonfly || freebsd || (linux && !ppc64 && !ppc64le) || netbsd || openbsd || solaris) && gc -// +build darwin dragonfly freebsd linux,!ppc64,!ppc64le netbsd openbsd solaris -// +build gc package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_unix_gc_ppc64x.go b/vendor/golang.org/x/sys/unix/syscall_unix_gc_ppc64x.go index f6f707acf..23f39b7af 100644 --- a/vendor/golang.org/x/sys/unix/syscall_unix_gc_ppc64x.go +++ b/vendor/golang.org/x/sys/unix/syscall_unix_gc_ppc64x.go @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (ppc64le || ppc64) && gc -// +build linux -// +build ppc64le ppc64 -// +build gc package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go index b295497ae..b473038c6 100644 --- a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x package unix @@ -192,7 +191,6 @@ func (cmsg *Cmsghdr) SetLen(length int) { //sys fcntl(fd int, cmd int, arg int) (val int, err error) //sys read(fd int, p []byte) (n int, err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ //sys write(fd int, p []byte) (n int, err error) //sys accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) = SYS___ACCEPT_A @@ -212,8 +210,8 @@ func (cmsg *Cmsghdr) SetLen(length int) { //sys sendmsg(s int, msg *Msghdr, flags int) (n int, err error) = SYS___SENDMSG_A //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) = SYS_MMAP //sys munmap(addr uintptr, length uintptr) (err error) = SYS_MUNMAP -//sys ioctl(fd int, req uint, arg uintptr) (err error) = SYS_IOCTL -//sys ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) = SYS_IOCTL +//sys ioctl(fd int, req int, arg uintptr) (err error) = SYS_IOCTL +//sys ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) = SYS_IOCTL //sys Access(path string, mode uint32) (err error) = SYS___ACCESS_A //sys Chdir(path string) (err error) = SYS___CHDIR_A @@ -285,25 +283,11 @@ func Close(fd int) (err error) { return } -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - // Dummy function: there are no semantics for Madvise on z/OS func Madvise(b []byte, advice int) (err error) { return } -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - //sys Gethostname(buf []byte) (err error) = SYS___GETHOSTNAME_A //sysnb Getegid() (egid int) //sysnb Geteuid() (uid int) @@ -1120,7 +1104,7 @@ func GetsockoptString(fd, level, opt int) (string, error) { return "", err } - return string(buf[:vallen-1]), nil + return ByteSliceToString(buf[:vallen]), nil } func Recvmsg(fd int, p, oob []byte, flags int) (n, oobn int, recvflags int, from Sockaddr, err error) { diff --git a/vendor/golang.org/x/sys/unix/sysvshm_linux.go b/vendor/golang.org/x/sys/unix/sysvshm_linux.go index 2c3a4437f..4fcd38de2 100644 --- a/vendor/golang.org/x/sys/unix/sysvshm_linux.go +++ b/vendor/golang.org/x/sys/unix/sysvshm_linux.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux -// +build linux package unix diff --git a/vendor/golang.org/x/sys/unix/sysvshm_unix.go b/vendor/golang.org/x/sys/unix/sysvshm_unix.go index 5bb41d17b..79a84f18b 100644 --- a/vendor/golang.org/x/sys/unix/sysvshm_unix.go +++ b/vendor/golang.org/x/sys/unix/sysvshm_unix.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build (darwin && !ios) || linux -// +build darwin,!ios linux package unix diff --git a/vendor/golang.org/x/sys/unix/sysvshm_unix_other.go b/vendor/golang.org/x/sys/unix/sysvshm_unix_other.go index 71bddefdb..9eb0db664 100644 --- a/vendor/golang.org/x/sys/unix/sysvshm_unix_other.go +++ b/vendor/golang.org/x/sys/unix/sysvshm_unix_other.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build darwin && !ios -// +build darwin,!ios package unix diff --git a/vendor/golang.org/x/sys/unix/timestruct.go b/vendor/golang.org/x/sys/unix/timestruct.go index 616b1b284..7997b1902 100644 --- a/vendor/golang.org/x/sys/unix/timestruct.go +++ b/vendor/golang.org/x/sys/unix/timestruct.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos package unix diff --git a/vendor/golang.org/x/sys/unix/unveil_openbsd.go b/vendor/golang.org/x/sys/unix/unveil_openbsd.go index 168d5ae77..cb7e598ce 100644 --- a/vendor/golang.org/x/sys/unix/unveil_openbsd.go +++ b/vendor/golang.org/x/sys/unix/unveil_openbsd.go @@ -4,39 +4,48 @@ package unix -import ( - "syscall" - "unsafe" -) +import "fmt" // Unveil implements the unveil syscall. // For more information see unveil(2). // Note that the special case of blocking further // unveil calls is handled by UnveilBlock. func Unveil(path string, flags string) error { - pathPtr, err := syscall.BytePtrFromString(path) - if err != nil { + if err := supportsUnveil(); err != nil { return err } - flagsPtr, err := syscall.BytePtrFromString(flags) + pathPtr, err := BytePtrFromString(path) if err != nil { return err } - _, _, e := syscall.Syscall(SYS_UNVEIL, uintptr(unsafe.Pointer(pathPtr)), uintptr(unsafe.Pointer(flagsPtr)), 0) - if e != 0 { - return e + flagsPtr, err := BytePtrFromString(flags) + if err != nil { + return err } - return nil + return unveil(pathPtr, flagsPtr) } // UnveilBlock blocks future unveil calls. // For more information see unveil(2). func UnveilBlock() error { - // Both pointers must be nil. - var pathUnsafe, flagsUnsafe unsafe.Pointer - _, _, e := syscall.Syscall(SYS_UNVEIL, uintptr(pathUnsafe), uintptr(flagsUnsafe), 0) - if e != 0 { - return e + if err := supportsUnveil(); err != nil { + return err } + return unveil(nil, nil) +} + +// supportsUnveil checks for availability of the unveil(2) system call based +// on the running OpenBSD version. +func supportsUnveil() error { + maj, min, err := majmin() + if err != nil { + return err + } + + // unveil is not available before 6.4 + if maj < 6 || (maj == 6 && min <= 3) { + return fmt.Errorf("cannot call Unveil on OpenBSD %d.%d", maj, min) + } + return nil } diff --git a/vendor/golang.org/x/sys/unix/xattr_bsd.go b/vendor/golang.org/x/sys/unix/xattr_bsd.go index f5f8e9f36..e16879396 100644 --- a/vendor/golang.org/x/sys/unix/xattr_bsd.go +++ b/vendor/golang.org/x/sys/unix/xattr_bsd.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build freebsd || netbsd -// +build freebsd netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zerrors_aix_ppc.go b/vendor/golang.org/x/sys/unix/zerrors_aix_ppc.go index ca9799b79..2fb219d78 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_aix_ppc.go +++ b/vendor/golang.org/x/sys/unix/zerrors_aix_ppc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc && aix -// +build ppc,aix // Created by cgo -godefs - DO NOT EDIT // cgo -godefs -- -maix32 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_aix_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_aix_ppc64.go index 200c8c26f..b0e6f5c85 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_aix_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_aix_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && aix -// +build ppc64,aix // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -maix64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go index 476a1c7e7..e40fa8524 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && darwin -// +build amd64,darwin // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go @@ -1270,6 +1269,16 @@ const ( SEEK_END = 0x2 SEEK_HOLE = 0x3 SEEK_SET = 0x0 + SF_APPEND = 0x40000 + SF_ARCHIVED = 0x10000 + SF_DATALESS = 0x40000000 + SF_FIRMLINK = 0x800000 + SF_IMMUTABLE = 0x20000 + SF_NOUNLINK = 0x100000 + SF_RESTRICTED = 0x80000 + SF_SETTABLE = 0x3fff0000 + SF_SUPPORTED = 0x9f0000 + SF_SYNTHETIC = 0xc0000000 SHUT_RD = 0x0 SHUT_RDWR = 0x2 SHUT_WR = 0x1 @@ -1543,6 +1552,15 @@ const ( TIOCTIMESTAMP = 0x40107459 TIOCUCNTL = 0x80047466 TOSTOP = 0x400000 + UF_APPEND = 0x4 + UF_COMPRESSED = 0x20 + UF_DATAVAULT = 0x80 + UF_HIDDEN = 0x8000 + UF_IMMUTABLE = 0x2 + UF_NODUMP = 0x1 + UF_OPAQUE = 0x8 + UF_SETTABLE = 0xffff + UF_TRACKED = 0x40 VDISCARD = 0xf VDSUSP = 0xb VEOF = 0x0 diff --git a/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go index e36f5178d..bb02aa6c0 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && darwin -// +build arm64,darwin // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go @@ -1270,6 +1269,16 @@ const ( SEEK_END = 0x2 SEEK_HOLE = 0x3 SEEK_SET = 0x0 + SF_APPEND = 0x40000 + SF_ARCHIVED = 0x10000 + SF_DATALESS = 0x40000000 + SF_FIRMLINK = 0x800000 + SF_IMMUTABLE = 0x20000 + SF_NOUNLINK = 0x100000 + SF_RESTRICTED = 0x80000 + SF_SETTABLE = 0x3fff0000 + SF_SUPPORTED = 0x9f0000 + SF_SYNTHETIC = 0xc0000000 SHUT_RD = 0x0 SHUT_RDWR = 0x2 SHUT_WR = 0x1 @@ -1543,6 +1552,15 @@ const ( TIOCTIMESTAMP = 0x40107459 TIOCUCNTL = 0x80047466 TOSTOP = 0x400000 + UF_APPEND = 0x4 + UF_COMPRESSED = 0x20 + UF_DATAVAULT = 0x80 + UF_HIDDEN = 0x8000 + UF_IMMUTABLE = 0x2 + UF_NODUMP = 0x1 + UF_OPAQUE = 0x8 + UF_SETTABLE = 0xffff + UF_TRACKED = 0x40 VDISCARD = 0xf VDSUSP = 0xb VEOF = 0x0 diff --git a/vendor/golang.org/x/sys/unix/zerrors_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_dragonfly_amd64.go index 17bba0e44..c0e0f8694 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_dragonfly_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_dragonfly_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && dragonfly -// +build amd64,dragonfly // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_386.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_386.go index f8c2c5138..6c6923906 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && freebsd -// +build 386,freebsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m32 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_amd64.go index 96310c3be..dd9163f8e 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && freebsd -// +build amd64,freebsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm.go index 777b69def..493a2a793 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && freebsd -// +build arm,freebsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm64.go index c557ac2db..8b437b307 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && freebsd -// +build arm64,freebsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_riscv64.go index 341b4d962..67c02dd57 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && freebsd -// +build riscv64,freebsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux.go b/vendor/golang.org/x/sys/unix/zerrors_linux.go index 398c37e52..c73cfe2f1 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux.go @@ -1,7 +1,6 @@ // Code generated by mkmerge; DO NOT EDIT. //go:build linux -// +build linux package unix @@ -481,10 +480,13 @@ const ( BPF_FROM_BE = 0x8 BPF_FROM_LE = 0x0 BPF_FS_MAGIC = 0xcafe4a11 + BPF_F_AFTER = 0x10 BPF_F_ALLOW_MULTI = 0x2 BPF_F_ALLOW_OVERRIDE = 0x1 BPF_F_ANY_ALIGNMENT = 0x2 - BPF_F_KPROBE_MULTI_RETURN = 0x1 + BPF_F_BEFORE = 0x8 + BPF_F_ID = 0x20 + BPF_F_NETFILTER_IP_DEFRAG = 0x1 BPF_F_QUERY_EFFECTIVE = 0x1 BPF_F_REPLACE = 0x4 BPF_F_SLEEPABLE = 0x10 @@ -493,6 +495,7 @@ const ( BPF_F_TEST_RUN_ON_CPU = 0x1 BPF_F_TEST_STATE_FREQ = 0x8 BPF_F_TEST_XDP_LIVE_FRAMES = 0x2 + BPF_F_XDP_DEV_BOUND_ONLY = 0x40 BPF_F_XDP_HAS_FRAGS = 0x20 BPF_H = 0x8 BPF_IMM = 0x0 @@ -520,6 +523,7 @@ const ( BPF_MAJOR_VERSION = 0x1 BPF_MAXINSNS = 0x1000 BPF_MEM = 0x60 + BPF_MEMSX = 0x80 BPF_MEMWORDS = 0x10 BPF_MINOR_VERSION = 0x1 BPF_MISC = 0x7 @@ -775,6 +779,8 @@ const ( DEVLINK_GENL_MCGRP_CONFIG_NAME = "config" DEVLINK_GENL_NAME = "devlink" DEVLINK_GENL_VERSION = 0x1 + DEVLINK_PORT_FN_CAP_IPSEC_CRYPTO = 0x4 + DEVLINK_PORT_FN_CAP_IPSEC_PACKET = 0x8 DEVLINK_PORT_FN_CAP_MIGRATABLE = 0x2 DEVLINK_PORT_FN_CAP_ROCE = 0x1 DEVLINK_SB_THRESHOLD_TO_ALPHA_MAX = 0x14 @@ -826,9 +832,9 @@ const ( DM_UUID_FLAG = 0x4000 DM_UUID_LEN = 0x81 DM_VERSION = 0xc138fd00 - DM_VERSION_EXTRA = "-ioctl (2022-07-28)" + DM_VERSION_EXTRA = "-ioctl (2023-03-01)" DM_VERSION_MAJOR = 0x4 - DM_VERSION_MINOR = 0x2f + DM_VERSION_MINOR = 0x30 DM_VERSION_PATCHLEVEL = 0x0 DT_BLK = 0x6 DT_CHR = 0x2 @@ -1197,6 +1203,7 @@ const ( FAN_EVENT_METADATA_LEN = 0x18 FAN_EVENT_ON_CHILD = 0x8000000 FAN_FS_ERROR = 0x8000 + FAN_INFO = 0x20 FAN_MARK_ADD = 0x1 FAN_MARK_DONT_FOLLOW = 0x4 FAN_MARK_EVICTABLE = 0x200 @@ -1233,6 +1240,8 @@ const ( FAN_REPORT_PIDFD = 0x80 FAN_REPORT_TARGET_FID = 0x1000 FAN_REPORT_TID = 0x100 + FAN_RESPONSE_INFO_AUDIT_RULE = 0x1 + FAN_RESPONSE_INFO_NONE = 0x0 FAN_UNLIMITED_MARKS = 0x20 FAN_UNLIMITED_QUEUE = 0x10 FD_CLOEXEC = 0x1 @@ -1694,6 +1703,7 @@ const ( KEXEC_ON_CRASH = 0x1 KEXEC_PRESERVE_CONTEXT = 0x2 KEXEC_SEGMENT_MAX = 0x10 + KEXEC_UPDATE_ELFCOREHDR = 0x4 KEYCTL_ASSUME_AUTHORITY = 0x10 KEYCTL_CAPABILITIES = 0x1f KEYCTL_CAPS0_BIG_KEY = 0x10 @@ -1791,6 +1801,7 @@ const ( LOCK_SH = 0x1 LOCK_UN = 0x8 LOOP_CLR_FD = 0x4c01 + LOOP_CONFIGURE = 0x4c0a LOOP_CTL_ADD = 0x4c80 LOOP_CTL_GET_FREE = 0x4c82 LOOP_CTL_REMOVE = 0x4c81 @@ -1860,6 +1871,7 @@ const ( MEMWRITEOOB64 = 0xc0184d15 MFD_ALLOW_SEALING = 0x2 MFD_CLOEXEC = 0x1 + MFD_EXEC = 0x10 MFD_HUGETLB = 0x4 MFD_HUGE_16GB = 0x88000000 MFD_HUGE_16MB = 0x60000000 @@ -1875,6 +1887,7 @@ const ( MFD_HUGE_8MB = 0x5c000000 MFD_HUGE_MASK = 0x3f MFD_HUGE_SHIFT = 0x1a + MFD_NOEXEC_SEAL = 0x8 MINIX2_SUPER_MAGIC = 0x2468 MINIX2_SUPER_MAGIC2 = 0x2478 MINIX3_SUPER_MAGIC = 0x4d5a @@ -1898,6 +1911,9 @@ const ( MOUNT_ATTR_SIZE_VER0 = 0x20 MOUNT_ATTR_STRICTATIME = 0x20 MOUNT_ATTR__ATIME = 0x70 + MREMAP_DONTUNMAP = 0x4 + MREMAP_FIXED = 0x2 + MREMAP_MAYMOVE = 0x1 MSDOS_SUPER_MAGIC = 0x4d44 MSG_BATCH = 0x40000 MSG_CMSG_CLOEXEC = 0x40000000 @@ -2204,6 +2220,7 @@ const ( PACKET_USER = 0x6 PACKET_VERSION = 0xa PACKET_VNET_HDR = 0xf + PACKET_VNET_HDR_SZ = 0x18 PARITY_CRC16_PR0 = 0x2 PARITY_CRC16_PR0_CCITT = 0x4 PARITY_CRC16_PR1 = 0x3 @@ -2221,6 +2238,7 @@ const ( PERF_ATTR_SIZE_VER5 = 0x70 PERF_ATTR_SIZE_VER6 = 0x78 PERF_ATTR_SIZE_VER7 = 0x80 + PERF_ATTR_SIZE_VER8 = 0x88 PERF_AUX_FLAG_COLLISION = 0x8 PERF_AUX_FLAG_CORESIGHT_FORMAT_CORESIGHT = 0x0 PERF_AUX_FLAG_CORESIGHT_FORMAT_RAW = 0x100 @@ -2264,6 +2282,7 @@ const ( PERF_MEM_LVLNUM_PMEM = 0xe PERF_MEM_LVLNUM_RAM = 0xd PERF_MEM_LVLNUM_SHIFT = 0x21 + PERF_MEM_LVLNUM_UNC = 0x8 PERF_MEM_LVL_HIT = 0x2 PERF_MEM_LVL_IO = 0x1000 PERF_MEM_LVL_L1 = 0x8 @@ -2361,6 +2380,7 @@ const ( PR_FP_EXC_UND = 0x40000 PR_FP_MODE_FR = 0x1 PR_FP_MODE_FRE = 0x2 + PR_GET_AUXV = 0x41555856 PR_GET_CHILD_SUBREAPER = 0x25 PR_GET_DUMPABLE = 0x3 PR_GET_ENDIAN = 0x13 @@ -2369,6 +2389,8 @@ const ( PR_GET_FP_MODE = 0x2e PR_GET_IO_FLUSHER = 0x3a PR_GET_KEEPCAPS = 0x7 + PR_GET_MDWE = 0x42 + PR_GET_MEMORY_MERGE = 0x44 PR_GET_NAME = 0x10 PR_GET_NO_NEW_PRIVS = 0x27 PR_GET_PDEATHSIG = 0x2 @@ -2389,6 +2411,7 @@ const ( PR_MCE_KILL_GET = 0x22 PR_MCE_KILL_LATE = 0x0 PR_MCE_KILL_SET = 0x1 + PR_MDWE_REFUSE_EXEC_GAIN = 0x1 PR_MPX_DISABLE_MANAGEMENT = 0x2c PR_MPX_ENABLE_MANAGEMENT = 0x2b PR_MTE_TAG_MASK = 0x7fff8 @@ -2406,6 +2429,15 @@ const ( PR_PAC_GET_ENABLED_KEYS = 0x3d PR_PAC_RESET_KEYS = 0x36 PR_PAC_SET_ENABLED_KEYS = 0x3c + PR_RISCV_V_GET_CONTROL = 0x46 + PR_RISCV_V_SET_CONTROL = 0x45 + PR_RISCV_V_VSTATE_CTRL_CUR_MASK = 0x3 + PR_RISCV_V_VSTATE_CTRL_DEFAULT = 0x0 + PR_RISCV_V_VSTATE_CTRL_INHERIT = 0x10 + PR_RISCV_V_VSTATE_CTRL_MASK = 0x1f + PR_RISCV_V_VSTATE_CTRL_NEXT_MASK = 0xc + PR_RISCV_V_VSTATE_CTRL_OFF = 0x1 + PR_RISCV_V_VSTATE_CTRL_ON = 0x2 PR_SCHED_CORE = 0x3e PR_SCHED_CORE_CREATE = 0x1 PR_SCHED_CORE_GET = 0x0 @@ -2423,6 +2455,8 @@ const ( PR_SET_FP_MODE = 0x2d PR_SET_IO_FLUSHER = 0x39 PR_SET_KEEPCAPS = 0x8 + PR_SET_MDWE = 0x41 + PR_SET_MEMORY_MERGE = 0x43 PR_SET_MM = 0x23 PR_SET_MM_ARG_END = 0x9 PR_SET_MM_ARG_START = 0x8 @@ -2506,6 +2540,7 @@ const ( PTRACE_GETSIGMASK = 0x420a PTRACE_GET_RSEQ_CONFIGURATION = 0x420f PTRACE_GET_SYSCALL_INFO = 0x420e + PTRACE_GET_SYSCALL_USER_DISPATCH_CONFIG = 0x4211 PTRACE_INTERRUPT = 0x4207 PTRACE_KILL = 0x8 PTRACE_LISTEN = 0x4208 @@ -2536,6 +2571,7 @@ const ( PTRACE_SETREGSET = 0x4205 PTRACE_SETSIGINFO = 0x4203 PTRACE_SETSIGMASK = 0x420b + PTRACE_SET_SYSCALL_USER_DISPATCH_CONFIG = 0x4210 PTRACE_SINGLESTEP = 0x9 PTRACE_SYSCALL = 0x18 PTRACE_SYSCALL_INFO_ENTRY = 0x1 @@ -2802,6 +2838,23 @@ const ( RWF_SUPPORTED = 0x1f RWF_SYNC = 0x4 RWF_WRITE_LIFE_NOT_SET = 0x0 + SCHED_BATCH = 0x3 + SCHED_DEADLINE = 0x6 + SCHED_FIFO = 0x1 + SCHED_FLAG_ALL = 0x7f + SCHED_FLAG_DL_OVERRUN = 0x4 + SCHED_FLAG_KEEP_ALL = 0x18 + SCHED_FLAG_KEEP_PARAMS = 0x10 + SCHED_FLAG_KEEP_POLICY = 0x8 + SCHED_FLAG_RECLAIM = 0x2 + SCHED_FLAG_RESET_ON_FORK = 0x1 + SCHED_FLAG_UTIL_CLAMP = 0x60 + SCHED_FLAG_UTIL_CLAMP_MAX = 0x40 + SCHED_FLAG_UTIL_CLAMP_MIN = 0x20 + SCHED_IDLE = 0x5 + SCHED_NORMAL = 0x0 + SCHED_RESET_ON_FORK = 0x40000000 + SCHED_RR = 0x2 SCM_CREDENTIALS = 0x2 SCM_RIGHTS = 0x1 SCM_TIMESTAMP = 0x1d @@ -2967,6 +3020,7 @@ const ( SOL_TCP = 0x6 SOL_TIPC = 0x10f SOL_TLS = 0x11a + SOL_UDP = 0x11 SOL_X25 = 0x106 SOL_XDP = 0x11b SOMAXCONN = 0x1000 @@ -3071,7 +3125,7 @@ const ( TASKSTATS_GENL_NAME = "TASKSTATS" TASKSTATS_GENL_VERSION = 0x1 TASKSTATS_TYPE_MAX = 0x6 - TASKSTATS_VERSION = 0xd + TASKSTATS_VERSION = 0xe TCIFLUSH = 0x0 TCIOFF = 0x2 TCIOFLUSH = 0x2 @@ -3237,6 +3291,7 @@ const ( TP_STATUS_COPY = 0x2 TP_STATUS_CSUMNOTREADY = 0x8 TP_STATUS_CSUM_VALID = 0x80 + TP_STATUS_GSO_TCP = 0x100 TP_STATUS_KERNEL = 0x0 TP_STATUS_LOSING = 0x4 TP_STATUS_SENDING = 0x2 @@ -3251,6 +3306,19 @@ const ( TRACEFS_MAGIC = 0x74726163 TS_COMM_LEN = 0x20 UDF_SUPER_MAGIC = 0x15013346 + UDP_CORK = 0x1 + UDP_ENCAP = 0x64 + UDP_ENCAP_ESPINUDP = 0x2 + UDP_ENCAP_ESPINUDP_NON_IKE = 0x1 + UDP_ENCAP_GTP0 = 0x4 + UDP_ENCAP_GTP1U = 0x5 + UDP_ENCAP_L2TPINUDP = 0x3 + UDP_GRO = 0x68 + UDP_NO_CHECK6_RX = 0x66 + UDP_NO_CHECK6_TX = 0x65 + UDP_SEGMENT = 0x67 + UDP_V4_FLOW = 0x2 + UDP_V6_FLOW = 0x6 UMOUNT_NOFOLLOW = 0x8 USBDEVICE_SUPER_MAGIC = 0x9fa2 UTIME_NOW = 0x3fffffff @@ -3401,6 +3469,7 @@ const ( XDP_PACKET_HEADROOM = 0x100 XDP_PGOFF_RX_RING = 0x0 XDP_PGOFF_TX_RING = 0x80000000 + XDP_PKT_CONTD = 0x1 XDP_RING_NEED_WAKEUP = 0x1 XDP_RX_RING = 0x2 XDP_SHARED_UMEM = 0x1 @@ -3413,6 +3482,7 @@ const ( XDP_UMEM_REG = 0x4 XDP_UMEM_UNALIGNED_CHUNK_FLAG = 0x1 XDP_USE_NEED_WAKEUP = 0x8 + XDP_USE_SG = 0x10 XDP_ZEROCOPY = 0x4 XENFS_SUPER_MAGIC = 0xabba1974 XFS_SUPER_MAGIC = 0x58465342 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go index a46df0f1e..4920821cf 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && linux -// +build 386,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/386/include -m32 _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80041270 BLKBSZSET = 0x40041271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80041272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -317,10 +325,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go index 6cd4a3ea9..a0c1e4112 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && linux -// +build amd64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/amd64/include -m64 _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -318,10 +326,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go index c7ebee24d..c63985560 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && linux -// +build arm,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/arm/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80041270 BLKBSZSET = 0x40041271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80041272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -324,10 +332,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go index 9d5352c3e..47cc62e25 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && linux -// +build arm64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/arm64/include -fsigned-char _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -314,10 +322,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 @@ -443,6 +453,7 @@ const ( TIOCSWINSZ = 0x5414 TIOCVHANGUP = 0x5437 TOSTOP = 0x100 + TPIDR2_MAGIC = 0x54504902 TUNATTACHFILTER = 0x401054d5 TUNDETACHFILTER = 0x401054d6 TUNGETDEVNETNS = 0x54e3 @@ -515,6 +526,7 @@ const ( XCASE = 0x4 XTABS = 0x1800 ZA_MAGIC = 0x54366345 + ZT_MAGIC = 0x5a544e01 _HIDIOCGRAWNAME = 0x80804804 _HIDIOCGRAWPHYS = 0x80404805 _HIDIOCGRAWUNIQ = 0x80404808 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go index f26a164f4..27ac4a09e 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build loong64 && linux -// +build loong64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/loong64/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -109,6 +117,9 @@ const ( IUCLC = 0x200 IXOFF = 0x1000 IXON = 0x400 + LASX_CTX_MAGIC = 0x41535801 + LBT_CTX_MAGIC = 0x42540001 + LSX_CTX_MAGIC = 0x53580001 MAP_ANON = 0x20 MAP_ANONYMOUS = 0x20 MAP_DENYWRITE = 0x800 @@ -308,10 +319,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go index 890bc3c9b..54694642a 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips && linux -// +build mips,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/mips/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40041270 BLKBSZSET = 0x80041271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40041272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -317,10 +325,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0x100 SO_PASSCRED = 0x11 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x12 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1e SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x1028 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go index 549f26ac6..3adb81d75 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && linux -// +build mips64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/mips64/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -317,10 +325,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0x100 SO_PASSCRED = 0x11 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x12 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1e SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x1028 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go index e0365e32c..2dfe98f0d 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64le && linux -// +build mips64le,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/mips64le/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -317,10 +325,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0x100 SO_PASSCRED = 0x11 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x12 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1e SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x1028 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go index fdccce15c..f5398f84f 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mipsle && linux -// +build mipsle,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/mipsle/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40041270 BLKBSZSET = 0x80041271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40041272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -317,10 +325,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0x100 SO_PASSCRED = 0x11 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x12 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1e SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x1028 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go index b2205c83f..c54f152d6 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc && linux -// +build ppc,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/ppc/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x10 B576000 = 0x15 B921600 = 0x16 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40041270 BLKBSZSET = 0x80041271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40041272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1f BS1 = 0x8000 BSDLY = 0x8000 @@ -372,10 +380,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x14 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x15 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go index 81aa5ad0f..76057dc72 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && linux -// +build ppc64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/ppc64/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x10 B576000 = 0x15 B921600 = 0x16 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1f BS1 = 0x8000 BSDLY = 0x8000 @@ -376,10 +384,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x14 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x15 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go index 76807a1fd..e0c3725e2 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64le && linux -// +build ppc64le,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/ppc64le/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x10 B576000 = 0x15 B921600 = 0x16 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1f BS1 = 0x8000 BSDLY = 0x8000 @@ -376,10 +384,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x14 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x15 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go index d4a5ab9e4..18f2813ed 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && linux -// +build riscv64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/riscv64/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -219,6 +227,9 @@ const ( PPPIOCUNBRIDGECHAN = 0x7434 PPPIOCXFERUNIT = 0x744e PR_SET_PTRACER_ANY = 0xffffffffffffffff + PTRACE_GETFDPIC = 0x21 + PTRACE_GETFDPIC_EXEC = 0x0 + PTRACE_GETFDPIC_INTERP = 0x1 RLIMIT_AS = 0x9 RLIMIT_MEMLOCK = 0x8 RLIMIT_NOFILE = 0x7 @@ -305,10 +316,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go index 66e65db95..11619d4ec 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build s390x && linux -// +build s390x,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/s390x/include -fsigned-char _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -380,10 +388,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go index f61925269..396d994da 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build sparc64 && linux -// +build sparc64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/sparc64/include _const.go @@ -30,22 +29,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -329,6 +337,54 @@ const ( SCM_WIFI_STATUS = 0x25 SFD_CLOEXEC = 0x400000 SFD_NONBLOCK = 0x4000 + SF_FP = 0x38 + SF_I0 = 0x20 + SF_I1 = 0x24 + SF_I2 = 0x28 + SF_I3 = 0x2c + SF_I4 = 0x30 + SF_I5 = 0x34 + SF_L0 = 0x0 + SF_L1 = 0x4 + SF_L2 = 0x8 + SF_L3 = 0xc + SF_L4 = 0x10 + SF_L5 = 0x14 + SF_L6 = 0x18 + SF_L7 = 0x1c + SF_PC = 0x3c + SF_RETP = 0x40 + SF_V9_FP = 0x70 + SF_V9_I0 = 0x40 + SF_V9_I1 = 0x48 + SF_V9_I2 = 0x50 + SF_V9_I3 = 0x58 + SF_V9_I4 = 0x60 + SF_V9_I5 = 0x68 + SF_V9_L0 = 0x0 + SF_V9_L1 = 0x8 + SF_V9_L2 = 0x10 + SF_V9_L3 = 0x18 + SF_V9_L4 = 0x20 + SF_V9_L5 = 0x28 + SF_V9_L6 = 0x30 + SF_V9_L7 = 0x38 + SF_V9_PC = 0x78 + SF_V9_RETP = 0x80 + SF_V9_XARG0 = 0x88 + SF_V9_XARG1 = 0x90 + SF_V9_XARG2 = 0x98 + SF_V9_XARG3 = 0xa0 + SF_V9_XARG4 = 0xa8 + SF_V9_XARG5 = 0xb0 + SF_V9_XXARG = 0xb8 + SF_XARG0 = 0x44 + SF_XARG1 = 0x48 + SF_XARG2 = 0x4c + SF_XARG3 = 0x50 + SF_XARG4 = 0x54 + SF_XARG5 = 0x58 + SF_XXARG = 0x5c SIOCATMARK = 0x8905 SIOCGPGRP = 0x8904 SIOCGSTAMPNS_NEW = 0x40108907 @@ -371,10 +427,12 @@ const ( SO_NOFCS = 0x27 SO_OOBINLINE = 0x100 SO_PASSCRED = 0x2 + SO_PASSPIDFD = 0x55 SO_PASSSEC = 0x1f SO_PEEK_OFF = 0x26 SO_PEERCRED = 0x40 SO_PEERGROUPS = 0x3d + SO_PEERPIDFD = 0x56 SO_PEERSEC = 0x1e SO_PREFER_BUSY_POLL = 0x48 SO_PROTOCOL = 0x1028 diff --git a/vendor/golang.org/x/sys/unix/zerrors_netbsd_386.go b/vendor/golang.org/x/sys/unix/zerrors_netbsd_386.go index 72f7420d2..130085df4 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_netbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zerrors_netbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && netbsd -// +build 386,netbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m32 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_netbsd_amd64.go index 8d4eb0c08..84769a1a3 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_netbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_netbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && netbsd -// +build amd64,netbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm.go b/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm.go index 9eef9749f..602ded003 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && netbsd -// +build arm,netbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -marm _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm64.go index 3b62ba192..efc0406ee 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && netbsd -// +build arm64,netbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_386.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_386.go index af20e474b..5a6500f83 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && openbsd -// +build 386,openbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m32 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_amd64.go index 6015fcb2b..a5aeeb979 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && openbsd -// +build amd64,openbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm.go index 8d44955e4..0e9748a72 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && openbsd -// +build arm,openbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go index ae16fe754..4f4449abc 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && openbsd -// +build arm64,openbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_mips64.go index 03d90fe35..76a363f0f 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && openbsd -// +build mips64,openbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go index 8e2c51b1e..43ca0cdfd 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && openbsd -// +build ppc64,openbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go index 13d403031..b1b8bb200 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && openbsd -// +build riscv64,openbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_solaris_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_solaris_amd64.go index 1afee6a08..d2ddd3176 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_solaris_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_solaris_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && solaris -// +build amd64,solaris // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_zos_s390x.go b/vendor/golang.org/x/sys/unix/zerrors_zos_s390x.go index fc7d0506f..4dfd2e051 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/zerrors_zos_s390x.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x // Hand edited based on zerrors_linux_s390x.go // TODO: auto-generate. diff --git a/vendor/golang.org/x/sys/unix/zptrace_armnn_linux.go b/vendor/golang.org/x/sys/unix/zptrace_armnn_linux.go index 97f20ca28..586317c78 100644 --- a/vendor/golang.org/x/sys/unix/zptrace_armnn_linux.go +++ b/vendor/golang.org/x/sys/unix/zptrace_armnn_linux.go @@ -1,8 +1,6 @@ // Code generated by linux/mkall.go generatePtracePair("arm", "arm64"). DO NOT EDIT. //go:build linux && (arm || arm64) -// +build linux -// +build arm arm64 package unix diff --git a/vendor/golang.org/x/sys/unix/zptrace_mipsnn_linux.go b/vendor/golang.org/x/sys/unix/zptrace_mipsnn_linux.go index 0b5f79430..d7c881be7 100644 --- a/vendor/golang.org/x/sys/unix/zptrace_mipsnn_linux.go +++ b/vendor/golang.org/x/sys/unix/zptrace_mipsnn_linux.go @@ -1,8 +1,6 @@ // Code generated by linux/mkall.go generatePtracePair("mips", "mips64"). DO NOT EDIT. //go:build linux && (mips || mips64) -// +build linux -// +build mips mips64 package unix diff --git a/vendor/golang.org/x/sys/unix/zptrace_mipsnnle_linux.go b/vendor/golang.org/x/sys/unix/zptrace_mipsnnle_linux.go index 2807f7e64..2d2de5d29 100644 --- a/vendor/golang.org/x/sys/unix/zptrace_mipsnnle_linux.go +++ b/vendor/golang.org/x/sys/unix/zptrace_mipsnnle_linux.go @@ -1,8 +1,6 @@ // Code generated by linux/mkall.go generatePtracePair("mipsle", "mips64le"). DO NOT EDIT. //go:build linux && (mipsle || mips64le) -// +build linux -// +build mipsle mips64le package unix diff --git a/vendor/golang.org/x/sys/unix/zptrace_x86_linux.go b/vendor/golang.org/x/sys/unix/zptrace_x86_linux.go index 281ea64e3..5adc79fb5 100644 --- a/vendor/golang.org/x/sys/unix/zptrace_x86_linux.go +++ b/vendor/golang.org/x/sys/unix/zptrace_x86_linux.go @@ -1,8 +1,6 @@ // Code generated by linux/mkall.go generatePtracePair("386", "amd64"). DO NOT EDIT. //go:build linux && (386 || amd64) -// +build linux -// +build 386 amd64 package unix diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go index ef9dcd1be..6ea64a3c0 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build aix && ppc -// +build aix,ppc package unix @@ -124,7 +123,6 @@ int utime(uintptr_t, uintptr_t); unsigned long long getsystemcfg(int); int umount(uintptr_t); int getrlimit64(int, uintptr_t); -int setrlimit64(int, uintptr_t); long long lseek64(int, long long, int); uintptr_t mmap(uintptr_t, uintptr_t, int, int, int, long long); @@ -213,7 +211,7 @@ func wait4(pid Pid_t, status *_C_int, options int, rusage *Rusage) (wpid Pid_t, // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctl(fd int, req uint, arg uintptr) (err error) { +func ioctl(fd int, req int, arg uintptr) (err error) { r0, er := C.ioctl(C.int(fd), C.int(req), C.uintptr_t(arg)) if r0 == -1 && er != nil { err = er @@ -223,7 +221,7 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { +func ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) { r0, er := C.ioctl(C.int(fd), C.int(req), C.uintptr_t(uintptr(arg))) if r0 == -1 && er != nil { err = er @@ -818,28 +816,6 @@ func write(fd int, p []byte) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, p *byte, np int) (n int, err error) { - r0, er := C.read(C.int(fd), C.uintptr_t(uintptr(unsafe.Pointer(p))), C.size_t(np)) - n = int(r0) - if r0 == -1 && er != nil { - err = er - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, p *byte, np int) (n int, err error) { - r0, er := C.write(C.int(fd), C.uintptr_t(uintptr(unsafe.Pointer(p))), C.size_t(np)) - n = int(r0) - if r0 == -1 && er != nil { - err = er - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Dup2(oldfd int, newfd int) (err error) { r0, er := C.dup2(C.int(oldfd), C.int(newfd)) if r0 == -1 && er != nil { @@ -1464,16 +1440,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - r0, er := C.setrlimit64(C.int(resource), C.uintptr_t(uintptr(unsafe.Pointer(rlim)))) - if r0 == -1 && er != nil { - err = er - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Seek(fd int, offset int64, whence int) (off int64, err error) { r0, er := C.lseek64(C.int(fd), C.longlong(offset), C.int(whence)) off = int64(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go index f86a94592..99ee4399a 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build aix && ppc64 -// +build aix,ppc64 package unix @@ -93,8 +92,8 @@ func wait4(pid Pid_t, status *_C_int, options int, rusage *Rusage) (wpid Pid_t, // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctl(fd int, req uint, arg uintptr) (err error) { - _, e1 := callioctl(fd, int(req), arg) +func ioctl(fd int, req int, arg uintptr) (err error) { + _, e1 := callioctl(fd, req, arg) if e1 != 0 { err = errnoErr(e1) } @@ -103,8 +102,8 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { - _, e1 := callioctl_ptr(fd, int(req), arg) +func ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) { + _, e1 := callioctl_ptr(fd, req, arg) if e1 != 0 { err = errnoErr(e1) } @@ -762,28 +761,6 @@ func write(fd int, p []byte) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, p *byte, np int) (n int, err error) { - r0, e1 := callread(fd, uintptr(unsafe.Pointer(p)), np) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, p *byte, np int) (n int, err error) { - r0, e1 := callwrite(fd, uintptr(unsafe.Pointer(p)), np) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Dup2(oldfd int, newfd int) (err error) { _, e1 := calldup2(oldfd, newfd) if e1 != 0 { @@ -1422,16 +1399,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, e1 := callsetrlimit(resource, uintptr(unsafe.Pointer(rlim))) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Seek(fd int, offset int64, whence int) (off int64, err error) { r0, e1 := calllseek(fd, offset, whence) off = int64(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go index d32a84cae..b68a78362 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build aix && ppc64 && gc -// +build aix,ppc64,gc package unix @@ -124,7 +123,6 @@ import ( //go:cgo_import_dynamic libc_getsystemcfg getsystemcfg "libc.a/shr_64.o" //go:cgo_import_dynamic libc_umount umount "libc.a/shr_64.o" //go:cgo_import_dynamic libc_getrlimit getrlimit "libc.a/shr_64.o" -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.a/shr_64.o" //go:cgo_import_dynamic libc_lseek lseek "libc.a/shr_64.o" //go:cgo_import_dynamic libc_mmap64 mmap64 "libc.a/shr_64.o" @@ -242,7 +240,6 @@ import ( //go:linkname libc_getsystemcfg libc_getsystemcfg //go:linkname libc_umount libc_umount //go:linkname libc_getrlimit libc_getrlimit -//go:linkname libc_setrlimit libc_setrlimit //go:linkname libc_lseek libc_lseek //go:linkname libc_mmap64 libc_mmap64 @@ -363,7 +360,6 @@ var ( libc_getsystemcfg, libc_umount, libc_getrlimit, - libc_setrlimit, libc_lseek, libc_mmap64 syscallFunc ) @@ -1179,13 +1175,6 @@ func callgetrlimit(resource int, rlim uintptr) (r1 uintptr, e1 Errno) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func callsetrlimit(resource int, rlim uintptr) (r1 uintptr, e1 Errno) { - r1, _, e1 = rawSyscall6(uintptr(unsafe.Pointer(&libc_setrlimit)), 2, uintptr(resource), rlim, 0, 0, 0, 0) - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func calllseek(fd int, offset int64, whence int) (r1 uintptr, e1 Errno) { r1, _, e1 = syscall6(uintptr(unsafe.Pointer(&libc_lseek)), 3, uintptr(fd), uintptr(offset), uintptr(whence), 0, 0, 0) return diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go index d7d8baf81..0a87450bf 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build aix && ppc64 && gccgo -// +build aix,ppc64,gccgo package unix @@ -123,7 +122,6 @@ int utime(uintptr_t, uintptr_t); unsigned long long getsystemcfg(int); int umount(uintptr_t); int getrlimit(int, uintptr_t); -int setrlimit(int, uintptr_t); long long lseek(int, long long, int); uintptr_t mmap64(uintptr_t, uintptr_t, int, int, int, long long); @@ -131,6 +129,7 @@ uintptr_t mmap64(uintptr_t, uintptr_t, int, int, int, long long); import "C" import ( "syscall" + "unsafe" ) // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -1055,14 +1054,6 @@ func callgetrlimit(resource int, rlim uintptr) (r1 uintptr, e1 Errno) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func callsetrlimit(resource int, rlim uintptr) (r1 uintptr, e1 Errno) { - r1 = uintptr(C.setrlimit(C.int(resource), C.uintptr_t(rlim))) - e1 = syscall.GetErrno() - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func calllseek(fd int, offset int64, whence int) (r1 uintptr, e1 Errno) { r1 = uintptr(C.lseek(C.int(fd), C.longlong(offset), C.int(whence))) e1 = syscall.GetErrno() diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go index a29ffdd56..ccb02f240 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build darwin && amd64 -// +build darwin,amd64 package unix @@ -725,6 +724,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -733,10 +738,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "/usr/lib/libSystem.B.dylib" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -1992,6 +1993,31 @@ var libc_select_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func Setattrlist(path string, attrlist *Attrlist, attrBuf []byte, options int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(attrBuf) > 0 { + _p1 = unsafe.Pointer(&attrBuf[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall6(libc_setattrlist_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(attrlist)), uintptr(_p1), uintptr(len(attrBuf)), uintptr(options), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setattrlist_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setattrlist setattrlist "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Setegid(egid int) (err error) { _, _, e1 := syscall_syscall(libc_setegid_trampoline_addr, uintptr(egid), 0, 0) if e1 != 0 { @@ -2123,20 +2149,6 @@ var libc_setreuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "/usr/lib/libSystem.B.dylib" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := syscall_rawSyscall(libc_setsid_trampoline_addr, 0, 0, 0) pid = int(r0) @@ -2399,28 +2411,6 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fstat(fd int, stat *Stat_t) (err error) { _, _, e1 := syscall_syscall(libc_fstat64_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { @@ -2510,14 +2500,6 @@ func ptrace1(request int, pid int, addr uintptr, data uintptr) (err error) { return } -func ptrace1Ptr(request int, pid int, addr uintptr, data unsafe.Pointer) (err error) { - _, _, e1 := syscall_syscall6(libc_ptrace_trampoline_addr, uintptr(request), uintptr(pid), addr, uintptr(data), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - var libc_ptrace_trampoline_addr uintptr //go:cgo_import_dynamic libc_ptrace ptrace "/usr/lib/libSystem.B.dylib" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s index 95fe4c0eb..8b8bb2840 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s @@ -5,900 +5,750 @@ TEXT libc_fdopendir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fdopendir(SB) - GLOBL ·libc_fdopendir_trampoline_addr(SB), RODATA, $8 DATA ·libc_fdopendir_trampoline_addr(SB)/8, $libc_fdopendir_trampoline<>(SB) TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getgroups(SB) - GLOBL ·libc_getgroups_trampoline_addr(SB), RODATA, $8 DATA ·libc_getgroups_trampoline_addr(SB)/8, $libc_getgroups_trampoline<>(SB) TEXT libc_setgroups_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setgroups(SB) - GLOBL ·libc_setgroups_trampoline_addr(SB), RODATA, $8 DATA ·libc_setgroups_trampoline_addr(SB)/8, $libc_setgroups_trampoline<>(SB) TEXT libc_wait4_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_wait4(SB) - GLOBL ·libc_wait4_trampoline_addr(SB), RODATA, $8 DATA ·libc_wait4_trampoline_addr(SB)/8, $libc_wait4_trampoline<>(SB) TEXT libc_accept_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_accept(SB) - GLOBL ·libc_accept_trampoline_addr(SB), RODATA, $8 DATA ·libc_accept_trampoline_addr(SB)/8, $libc_accept_trampoline<>(SB) TEXT libc_bind_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_bind(SB) - GLOBL ·libc_bind_trampoline_addr(SB), RODATA, $8 DATA ·libc_bind_trampoline_addr(SB)/8, $libc_bind_trampoline<>(SB) TEXT libc_connect_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_connect(SB) - GLOBL ·libc_connect_trampoline_addr(SB), RODATA, $8 DATA ·libc_connect_trampoline_addr(SB)/8, $libc_connect_trampoline<>(SB) TEXT libc_socket_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_socket(SB) - GLOBL ·libc_socket_trampoline_addr(SB), RODATA, $8 DATA ·libc_socket_trampoline_addr(SB)/8, $libc_socket_trampoline<>(SB) TEXT libc_getsockopt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsockopt(SB) - GLOBL ·libc_getsockopt_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsockopt_trampoline_addr(SB)/8, $libc_getsockopt_trampoline<>(SB) TEXT libc_setsockopt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setsockopt(SB) - GLOBL ·libc_setsockopt_trampoline_addr(SB), RODATA, $8 DATA ·libc_setsockopt_trampoline_addr(SB)/8, $libc_setsockopt_trampoline<>(SB) TEXT libc_getpeername_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpeername(SB) - GLOBL ·libc_getpeername_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpeername_trampoline_addr(SB)/8, $libc_getpeername_trampoline<>(SB) TEXT libc_getsockname_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsockname(SB) - GLOBL ·libc_getsockname_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsockname_trampoline_addr(SB)/8, $libc_getsockname_trampoline<>(SB) TEXT libc_shutdown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shutdown(SB) - GLOBL ·libc_shutdown_trampoline_addr(SB), RODATA, $8 DATA ·libc_shutdown_trampoline_addr(SB)/8, $libc_shutdown_trampoline<>(SB) TEXT libc_socketpair_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_socketpair(SB) - GLOBL ·libc_socketpair_trampoline_addr(SB), RODATA, $8 DATA ·libc_socketpair_trampoline_addr(SB)/8, $libc_socketpair_trampoline<>(SB) TEXT libc_recvfrom_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_recvfrom(SB) - GLOBL ·libc_recvfrom_trampoline_addr(SB), RODATA, $8 DATA ·libc_recvfrom_trampoline_addr(SB)/8, $libc_recvfrom_trampoline<>(SB) TEXT libc_sendto_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendto(SB) - GLOBL ·libc_sendto_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendto_trampoline_addr(SB)/8, $libc_sendto_trampoline<>(SB) TEXT libc_recvmsg_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_recvmsg(SB) - GLOBL ·libc_recvmsg_trampoline_addr(SB), RODATA, $8 DATA ·libc_recvmsg_trampoline_addr(SB)/8, $libc_recvmsg_trampoline<>(SB) TEXT libc_sendmsg_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendmsg(SB) - GLOBL ·libc_sendmsg_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendmsg_trampoline_addr(SB)/8, $libc_sendmsg_trampoline<>(SB) TEXT libc_kevent_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kevent(SB) - GLOBL ·libc_kevent_trampoline_addr(SB), RODATA, $8 DATA ·libc_kevent_trampoline_addr(SB)/8, $libc_kevent_trampoline<>(SB) TEXT libc_utimes_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimes(SB) - GLOBL ·libc_utimes_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimes_trampoline_addr(SB)/8, $libc_utimes_trampoline<>(SB) TEXT libc_futimes_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_futimes(SB) - GLOBL ·libc_futimes_trampoline_addr(SB), RODATA, $8 DATA ·libc_futimes_trampoline_addr(SB)/8, $libc_futimes_trampoline<>(SB) TEXT libc_poll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_poll(SB) - GLOBL ·libc_poll_trampoline_addr(SB), RODATA, $8 DATA ·libc_poll_trampoline_addr(SB)/8, $libc_poll_trampoline<>(SB) TEXT libc_madvise_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_madvise(SB) - GLOBL ·libc_madvise_trampoline_addr(SB), RODATA, $8 DATA ·libc_madvise_trampoline_addr(SB)/8, $libc_madvise_trampoline<>(SB) TEXT libc_mlock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mlock(SB) - GLOBL ·libc_mlock_trampoline_addr(SB), RODATA, $8 DATA ·libc_mlock_trampoline_addr(SB)/8, $libc_mlock_trampoline<>(SB) TEXT libc_mlockall_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mlockall(SB) - GLOBL ·libc_mlockall_trampoline_addr(SB), RODATA, $8 DATA ·libc_mlockall_trampoline_addr(SB)/8, $libc_mlockall_trampoline<>(SB) TEXT libc_mprotect_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mprotect(SB) - GLOBL ·libc_mprotect_trampoline_addr(SB), RODATA, $8 DATA ·libc_mprotect_trampoline_addr(SB)/8, $libc_mprotect_trampoline<>(SB) TEXT libc_msync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_msync(SB) - GLOBL ·libc_msync_trampoline_addr(SB), RODATA, $8 DATA ·libc_msync_trampoline_addr(SB)/8, $libc_msync_trampoline<>(SB) TEXT libc_munlock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munlock(SB) - GLOBL ·libc_munlock_trampoline_addr(SB), RODATA, $8 DATA ·libc_munlock_trampoline_addr(SB)/8, $libc_munlock_trampoline<>(SB) TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munlockall(SB) - GLOBL ·libc_munlockall_trampoline_addr(SB), RODATA, $8 DATA ·libc_munlockall_trampoline_addr(SB)/8, $libc_munlockall_trampoline<>(SB) TEXT libc_closedir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_closedir(SB) - GLOBL ·libc_closedir_trampoline_addr(SB), RODATA, $8 DATA ·libc_closedir_trampoline_addr(SB)/8, $libc_closedir_trampoline<>(SB) TEXT libc_readdir_r_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readdir_r(SB) - GLOBL ·libc_readdir_r_trampoline_addr(SB), RODATA, $8 DATA ·libc_readdir_r_trampoline_addr(SB)/8, $libc_readdir_r_trampoline<>(SB) TEXT libc_pipe_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pipe(SB) - GLOBL ·libc_pipe_trampoline_addr(SB), RODATA, $8 DATA ·libc_pipe_trampoline_addr(SB)/8, $libc_pipe_trampoline<>(SB) TEXT libc_getxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getxattr(SB) - GLOBL ·libc_getxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_getxattr_trampoline_addr(SB)/8, $libc_getxattr_trampoline<>(SB) TEXT libc_fgetxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fgetxattr(SB) - GLOBL ·libc_fgetxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fgetxattr_trampoline_addr(SB)/8, $libc_fgetxattr_trampoline<>(SB) TEXT libc_setxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setxattr(SB) - GLOBL ·libc_setxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_setxattr_trampoline_addr(SB)/8, $libc_setxattr_trampoline<>(SB) TEXT libc_fsetxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fsetxattr(SB) - GLOBL ·libc_fsetxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fsetxattr_trampoline_addr(SB)/8, $libc_fsetxattr_trampoline<>(SB) TEXT libc_removexattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_removexattr(SB) - GLOBL ·libc_removexattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_removexattr_trampoline_addr(SB)/8, $libc_removexattr_trampoline<>(SB) TEXT libc_fremovexattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fremovexattr(SB) - GLOBL ·libc_fremovexattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fremovexattr_trampoline_addr(SB)/8, $libc_fremovexattr_trampoline<>(SB) TEXT libc_listxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_listxattr(SB) - GLOBL ·libc_listxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_listxattr_trampoline_addr(SB)/8, $libc_listxattr_trampoline<>(SB) TEXT libc_flistxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_flistxattr(SB) - GLOBL ·libc_flistxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_flistxattr_trampoline_addr(SB)/8, $libc_flistxattr_trampoline<>(SB) TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) - GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fcntl(SB) - GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) TEXT libc_kill_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kill(SB) - GLOBL ·libc_kill_trampoline_addr(SB), RODATA, $8 DATA ·libc_kill_trampoline_addr(SB)/8, $libc_kill_trampoline<>(SB) TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) - GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_ioctl_trampoline_addr(SB)/8, $libc_ioctl_trampoline<>(SB) TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sysctl(SB) - GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) TEXT libc_sendfile_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendfile(SB) - GLOBL ·libc_sendfile_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendfile_trampoline_addr(SB)/8, $libc_sendfile_trampoline<>(SB) TEXT libc_shmat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmat(SB) - GLOBL ·libc_shmat_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmat_trampoline_addr(SB)/8, $libc_shmat_trampoline<>(SB) TEXT libc_shmctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmctl(SB) - GLOBL ·libc_shmctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmctl_trampoline_addr(SB)/8, $libc_shmctl_trampoline<>(SB) TEXT libc_shmdt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmdt(SB) - GLOBL ·libc_shmdt_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmdt_trampoline_addr(SB)/8, $libc_shmdt_trampoline<>(SB) TEXT libc_shmget_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmget(SB) - GLOBL ·libc_shmget_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmget_trampoline_addr(SB)/8, $libc_shmget_trampoline<>(SB) TEXT libc_access_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_access(SB) - GLOBL ·libc_access_trampoline_addr(SB), RODATA, $8 DATA ·libc_access_trampoline_addr(SB)/8, $libc_access_trampoline<>(SB) TEXT libc_adjtime_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_adjtime(SB) - GLOBL ·libc_adjtime_trampoline_addr(SB), RODATA, $8 DATA ·libc_adjtime_trampoline_addr(SB)/8, $libc_adjtime_trampoline<>(SB) TEXT libc_chdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chdir(SB) - GLOBL ·libc_chdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_chdir_trampoline_addr(SB)/8, $libc_chdir_trampoline<>(SB) TEXT libc_chflags_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chflags(SB) - GLOBL ·libc_chflags_trampoline_addr(SB), RODATA, $8 DATA ·libc_chflags_trampoline_addr(SB)/8, $libc_chflags_trampoline<>(SB) TEXT libc_chmod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chmod(SB) - GLOBL ·libc_chmod_trampoline_addr(SB), RODATA, $8 DATA ·libc_chmod_trampoline_addr(SB)/8, $libc_chmod_trampoline<>(SB) TEXT libc_chown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chown(SB) - GLOBL ·libc_chown_trampoline_addr(SB), RODATA, $8 DATA ·libc_chown_trampoline_addr(SB)/8, $libc_chown_trampoline<>(SB) TEXT libc_chroot_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chroot(SB) - GLOBL ·libc_chroot_trampoline_addr(SB), RODATA, $8 DATA ·libc_chroot_trampoline_addr(SB)/8, $libc_chroot_trampoline<>(SB) TEXT libc_clock_gettime_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clock_gettime(SB) - GLOBL ·libc_clock_gettime_trampoline_addr(SB), RODATA, $8 DATA ·libc_clock_gettime_trampoline_addr(SB)/8, $libc_clock_gettime_trampoline<>(SB) TEXT libc_close_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_close(SB) - GLOBL ·libc_close_trampoline_addr(SB), RODATA, $8 DATA ·libc_close_trampoline_addr(SB)/8, $libc_close_trampoline<>(SB) TEXT libc_clonefile_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clonefile(SB) - GLOBL ·libc_clonefile_trampoline_addr(SB), RODATA, $8 DATA ·libc_clonefile_trampoline_addr(SB)/8, $libc_clonefile_trampoline<>(SB) TEXT libc_clonefileat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clonefileat(SB) - GLOBL ·libc_clonefileat_trampoline_addr(SB), RODATA, $8 DATA ·libc_clonefileat_trampoline_addr(SB)/8, $libc_clonefileat_trampoline<>(SB) TEXT libc_dup_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_dup(SB) - GLOBL ·libc_dup_trampoline_addr(SB), RODATA, $8 DATA ·libc_dup_trampoline_addr(SB)/8, $libc_dup_trampoline<>(SB) TEXT libc_dup2_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_dup2(SB) - GLOBL ·libc_dup2_trampoline_addr(SB), RODATA, $8 DATA ·libc_dup2_trampoline_addr(SB)/8, $libc_dup2_trampoline<>(SB) TEXT libc_exchangedata_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_exchangedata(SB) - GLOBL ·libc_exchangedata_trampoline_addr(SB), RODATA, $8 DATA ·libc_exchangedata_trampoline_addr(SB)/8, $libc_exchangedata_trampoline<>(SB) TEXT libc_exit_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_exit(SB) - GLOBL ·libc_exit_trampoline_addr(SB), RODATA, $8 DATA ·libc_exit_trampoline_addr(SB)/8, $libc_exit_trampoline<>(SB) TEXT libc_faccessat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_faccessat(SB) - GLOBL ·libc_faccessat_trampoline_addr(SB), RODATA, $8 DATA ·libc_faccessat_trampoline_addr(SB)/8, $libc_faccessat_trampoline<>(SB) TEXT libc_fchdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchdir(SB) - GLOBL ·libc_fchdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchdir_trampoline_addr(SB)/8, $libc_fchdir_trampoline<>(SB) TEXT libc_fchflags_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchflags(SB) - GLOBL ·libc_fchflags_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchflags_trampoline_addr(SB)/8, $libc_fchflags_trampoline<>(SB) TEXT libc_fchmod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchmod(SB) - GLOBL ·libc_fchmod_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchmod_trampoline_addr(SB)/8, $libc_fchmod_trampoline<>(SB) TEXT libc_fchmodat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchmodat(SB) - GLOBL ·libc_fchmodat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchmodat_trampoline_addr(SB)/8, $libc_fchmodat_trampoline<>(SB) TEXT libc_fchown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchown(SB) - GLOBL ·libc_fchown_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchown_trampoline_addr(SB)/8, $libc_fchown_trampoline<>(SB) TEXT libc_fchownat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchownat(SB) - GLOBL ·libc_fchownat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchownat_trampoline_addr(SB)/8, $libc_fchownat_trampoline<>(SB) TEXT libc_fclonefileat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fclonefileat(SB) - GLOBL ·libc_fclonefileat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fclonefileat_trampoline_addr(SB)/8, $libc_fclonefileat_trampoline<>(SB) TEXT libc_flock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_flock(SB) - GLOBL ·libc_flock_trampoline_addr(SB), RODATA, $8 DATA ·libc_flock_trampoline_addr(SB)/8, $libc_flock_trampoline<>(SB) TEXT libc_fpathconf_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fpathconf(SB) - GLOBL ·libc_fpathconf_trampoline_addr(SB), RODATA, $8 DATA ·libc_fpathconf_trampoline_addr(SB)/8, $libc_fpathconf_trampoline<>(SB) TEXT libc_fsync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fsync(SB) - GLOBL ·libc_fsync_trampoline_addr(SB), RODATA, $8 DATA ·libc_fsync_trampoline_addr(SB)/8, $libc_fsync_trampoline<>(SB) TEXT libc_ftruncate_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ftruncate(SB) - GLOBL ·libc_ftruncate_trampoline_addr(SB), RODATA, $8 DATA ·libc_ftruncate_trampoline_addr(SB)/8, $libc_ftruncate_trampoline<>(SB) TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getcwd(SB) - GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) TEXT libc_getdtablesize_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getdtablesize(SB) - GLOBL ·libc_getdtablesize_trampoline_addr(SB), RODATA, $8 DATA ·libc_getdtablesize_trampoline_addr(SB)/8, $libc_getdtablesize_trampoline<>(SB) TEXT libc_getegid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getegid(SB) - GLOBL ·libc_getegid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getegid_trampoline_addr(SB)/8, $libc_getegid_trampoline<>(SB) TEXT libc_geteuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_geteuid(SB) - GLOBL ·libc_geteuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_geteuid_trampoline_addr(SB)/8, $libc_geteuid_trampoline<>(SB) TEXT libc_getgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getgid(SB) - GLOBL ·libc_getgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getgid_trampoline_addr(SB)/8, $libc_getgid_trampoline<>(SB) TEXT libc_getpgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpgid(SB) - GLOBL ·libc_getpgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpgid_trampoline_addr(SB)/8, $libc_getpgid_trampoline<>(SB) TEXT libc_getpgrp_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpgrp(SB) - GLOBL ·libc_getpgrp_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpgrp_trampoline_addr(SB)/8, $libc_getpgrp_trampoline<>(SB) TEXT libc_getpid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpid(SB) - GLOBL ·libc_getpid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpid_trampoline_addr(SB)/8, $libc_getpid_trampoline<>(SB) TEXT libc_getppid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getppid(SB) - GLOBL ·libc_getppid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getppid_trampoline_addr(SB)/8, $libc_getppid_trampoline<>(SB) TEXT libc_getpriority_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpriority(SB) - GLOBL ·libc_getpriority_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpriority_trampoline_addr(SB)/8, $libc_getpriority_trampoline<>(SB) TEXT libc_getrlimit_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getrlimit(SB) - GLOBL ·libc_getrlimit_trampoline_addr(SB), RODATA, $8 DATA ·libc_getrlimit_trampoline_addr(SB)/8, $libc_getrlimit_trampoline<>(SB) TEXT libc_getrusage_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getrusage(SB) - GLOBL ·libc_getrusage_trampoline_addr(SB), RODATA, $8 DATA ·libc_getrusage_trampoline_addr(SB)/8, $libc_getrusage_trampoline<>(SB) TEXT libc_getsid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsid(SB) - GLOBL ·libc_getsid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsid_trampoline_addr(SB)/8, $libc_getsid_trampoline<>(SB) TEXT libc_gettimeofday_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_gettimeofday(SB) - GLOBL ·libc_gettimeofday_trampoline_addr(SB), RODATA, $8 DATA ·libc_gettimeofday_trampoline_addr(SB)/8, $libc_gettimeofday_trampoline<>(SB) TEXT libc_getuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getuid(SB) - GLOBL ·libc_getuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getuid_trampoline_addr(SB)/8, $libc_getuid_trampoline<>(SB) TEXT libc_issetugid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_issetugid(SB) - GLOBL ·libc_issetugid_trampoline_addr(SB), RODATA, $8 DATA ·libc_issetugid_trampoline_addr(SB)/8, $libc_issetugid_trampoline<>(SB) TEXT libc_kqueue_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kqueue(SB) - GLOBL ·libc_kqueue_trampoline_addr(SB), RODATA, $8 DATA ·libc_kqueue_trampoline_addr(SB)/8, $libc_kqueue_trampoline<>(SB) TEXT libc_lchown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lchown(SB) - GLOBL ·libc_lchown_trampoline_addr(SB), RODATA, $8 DATA ·libc_lchown_trampoline_addr(SB)/8, $libc_lchown_trampoline<>(SB) TEXT libc_link_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_link(SB) - GLOBL ·libc_link_trampoline_addr(SB), RODATA, $8 DATA ·libc_link_trampoline_addr(SB)/8, $libc_link_trampoline<>(SB) TEXT libc_linkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_linkat(SB) - GLOBL ·libc_linkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_linkat_trampoline_addr(SB)/8, $libc_linkat_trampoline<>(SB) TEXT libc_listen_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_listen(SB) - GLOBL ·libc_listen_trampoline_addr(SB), RODATA, $8 DATA ·libc_listen_trampoline_addr(SB)/8, $libc_listen_trampoline<>(SB) TEXT libc_mkdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkdir(SB) - GLOBL ·libc_mkdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkdir_trampoline_addr(SB)/8, $libc_mkdir_trampoline<>(SB) TEXT libc_mkdirat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkdirat(SB) - GLOBL ·libc_mkdirat_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkdirat_trampoline_addr(SB)/8, $libc_mkdirat_trampoline<>(SB) TEXT libc_mkfifo_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkfifo(SB) - GLOBL ·libc_mkfifo_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkfifo_trampoline_addr(SB)/8, $libc_mkfifo_trampoline<>(SB) TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mknod(SB) - GLOBL ·libc_mknod_trampoline_addr(SB), RODATA, $8 DATA ·libc_mknod_trampoline_addr(SB)/8, $libc_mknod_trampoline<>(SB) TEXT libc_mount_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mount(SB) - GLOBL ·libc_mount_trampoline_addr(SB), RODATA, $8 DATA ·libc_mount_trampoline_addr(SB)/8, $libc_mount_trampoline<>(SB) TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_open(SB) - GLOBL ·libc_open_trampoline_addr(SB), RODATA, $8 DATA ·libc_open_trampoline_addr(SB)/8, $libc_open_trampoline<>(SB) TEXT libc_openat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_openat(SB) - GLOBL ·libc_openat_trampoline_addr(SB), RODATA, $8 DATA ·libc_openat_trampoline_addr(SB)/8, $libc_openat_trampoline<>(SB) TEXT libc_pathconf_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pathconf(SB) - GLOBL ·libc_pathconf_trampoline_addr(SB), RODATA, $8 DATA ·libc_pathconf_trampoline_addr(SB)/8, $libc_pathconf_trampoline<>(SB) TEXT libc_pread_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pread(SB) - GLOBL ·libc_pread_trampoline_addr(SB), RODATA, $8 DATA ·libc_pread_trampoline_addr(SB)/8, $libc_pread_trampoline<>(SB) TEXT libc_pwrite_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pwrite(SB) - GLOBL ·libc_pwrite_trampoline_addr(SB), RODATA, $8 DATA ·libc_pwrite_trampoline_addr(SB)/8, $libc_pwrite_trampoline<>(SB) TEXT libc_read_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_read(SB) - GLOBL ·libc_read_trampoline_addr(SB), RODATA, $8 DATA ·libc_read_trampoline_addr(SB)/8, $libc_read_trampoline<>(SB) TEXT libc_readlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readlink(SB) - GLOBL ·libc_readlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_readlink_trampoline_addr(SB)/8, $libc_readlink_trampoline<>(SB) TEXT libc_readlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readlinkat(SB) - GLOBL ·libc_readlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_readlinkat_trampoline_addr(SB)/8, $libc_readlinkat_trampoline<>(SB) TEXT libc_rename_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_rename(SB) - GLOBL ·libc_rename_trampoline_addr(SB), RODATA, $8 DATA ·libc_rename_trampoline_addr(SB)/8, $libc_rename_trampoline<>(SB) TEXT libc_renameat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_renameat(SB) - GLOBL ·libc_renameat_trampoline_addr(SB), RODATA, $8 DATA ·libc_renameat_trampoline_addr(SB)/8, $libc_renameat_trampoline<>(SB) TEXT libc_revoke_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_revoke(SB) - GLOBL ·libc_revoke_trampoline_addr(SB), RODATA, $8 DATA ·libc_revoke_trampoline_addr(SB)/8, $libc_revoke_trampoline<>(SB) TEXT libc_rmdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_rmdir(SB) - GLOBL ·libc_rmdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_rmdir_trampoline_addr(SB)/8, $libc_rmdir_trampoline<>(SB) TEXT libc_lseek_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lseek(SB) - GLOBL ·libc_lseek_trampoline_addr(SB), RODATA, $8 DATA ·libc_lseek_trampoline_addr(SB)/8, $libc_lseek_trampoline<>(SB) TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_select(SB) - GLOBL ·libc_select_trampoline_addr(SB), RODATA, $8 DATA ·libc_select_trampoline_addr(SB)/8, $libc_select_trampoline<>(SB) +TEXT libc_setattrlist_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setattrlist(SB) +GLOBL ·libc_setattrlist_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setattrlist_trampoline_addr(SB)/8, $libc_setattrlist_trampoline<>(SB) + TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setegid(SB) - GLOBL ·libc_setegid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setegid_trampoline_addr(SB)/8, $libc_setegid_trampoline<>(SB) TEXT libc_seteuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_seteuid(SB) - GLOBL ·libc_seteuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_seteuid_trampoline_addr(SB)/8, $libc_seteuid_trampoline<>(SB) TEXT libc_setgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setgid(SB) - GLOBL ·libc_setgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setgid_trampoline_addr(SB)/8, $libc_setgid_trampoline<>(SB) TEXT libc_setlogin_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setlogin(SB) - GLOBL ·libc_setlogin_trampoline_addr(SB), RODATA, $8 DATA ·libc_setlogin_trampoline_addr(SB)/8, $libc_setlogin_trampoline<>(SB) TEXT libc_setpgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setpgid(SB) - GLOBL ·libc_setpgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setpgid_trampoline_addr(SB)/8, $libc_setpgid_trampoline<>(SB) TEXT libc_setpriority_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setpriority(SB) - GLOBL ·libc_setpriority_trampoline_addr(SB), RODATA, $8 DATA ·libc_setpriority_trampoline_addr(SB)/8, $libc_setpriority_trampoline<>(SB) TEXT libc_setprivexec_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setprivexec(SB) - GLOBL ·libc_setprivexec_trampoline_addr(SB), RODATA, $8 DATA ·libc_setprivexec_trampoline_addr(SB)/8, $libc_setprivexec_trampoline<>(SB) TEXT libc_setregid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setregid(SB) - GLOBL ·libc_setregid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setregid_trampoline_addr(SB)/8, $libc_setregid_trampoline<>(SB) TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setreuid(SB) - GLOBL ·libc_setreuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setreuid_trampoline_addr(SB)/8, $libc_setreuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) - -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setsid(SB) - GLOBL ·libc_setsid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setsid_trampoline_addr(SB)/8, $libc_setsid_trampoline<>(SB) TEXT libc_settimeofday_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_settimeofday(SB) - GLOBL ·libc_settimeofday_trampoline_addr(SB), RODATA, $8 DATA ·libc_settimeofday_trampoline_addr(SB)/8, $libc_settimeofday_trampoline<>(SB) TEXT libc_setuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setuid(SB) - GLOBL ·libc_setuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setuid_trampoline_addr(SB)/8, $libc_setuid_trampoline<>(SB) TEXT libc_symlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_symlink(SB) - GLOBL ·libc_symlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_symlink_trampoline_addr(SB)/8, $libc_symlink_trampoline<>(SB) TEXT libc_symlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_symlinkat(SB) - GLOBL ·libc_symlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_symlinkat_trampoline_addr(SB)/8, $libc_symlinkat_trampoline<>(SB) TEXT libc_sync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sync(SB) - GLOBL ·libc_sync_trampoline_addr(SB), RODATA, $8 DATA ·libc_sync_trampoline_addr(SB)/8, $libc_sync_trampoline<>(SB) TEXT libc_truncate_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_truncate(SB) - GLOBL ·libc_truncate_trampoline_addr(SB), RODATA, $8 DATA ·libc_truncate_trampoline_addr(SB)/8, $libc_truncate_trampoline<>(SB) TEXT libc_umask_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_umask(SB) - GLOBL ·libc_umask_trampoline_addr(SB), RODATA, $8 DATA ·libc_umask_trampoline_addr(SB)/8, $libc_umask_trampoline<>(SB) TEXT libc_undelete_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_undelete(SB) - GLOBL ·libc_undelete_trampoline_addr(SB), RODATA, $8 DATA ·libc_undelete_trampoline_addr(SB)/8, $libc_undelete_trampoline<>(SB) TEXT libc_unlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unlink(SB) - GLOBL ·libc_unlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_unlink_trampoline_addr(SB)/8, $libc_unlink_trampoline<>(SB) TEXT libc_unlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unlinkat(SB) - GLOBL ·libc_unlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_unlinkat_trampoline_addr(SB)/8, $libc_unlinkat_trampoline<>(SB) TEXT libc_unmount_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unmount(SB) - GLOBL ·libc_unmount_trampoline_addr(SB), RODATA, $8 DATA ·libc_unmount_trampoline_addr(SB)/8, $libc_unmount_trampoline<>(SB) TEXT libc_write_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_write(SB) - GLOBL ·libc_write_trampoline_addr(SB), RODATA, $8 DATA ·libc_write_trampoline_addr(SB)/8, $libc_write_trampoline<>(SB) TEXT libc_mmap_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mmap(SB) - GLOBL ·libc_mmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_mmap_trampoline_addr(SB)/8, $libc_mmap_trampoline<>(SB) TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munmap(SB) - GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) TEXT libc_fstat64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstat64(SB) - GLOBL ·libc_fstat64_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstat64_trampoline_addr(SB)/8, $libc_fstat64_trampoline<>(SB) TEXT libc_fstatat64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstatat64(SB) - GLOBL ·libc_fstatat64_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstatat64_trampoline_addr(SB)/8, $libc_fstatat64_trampoline<>(SB) TEXT libc_fstatfs64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstatfs64(SB) - GLOBL ·libc_fstatfs64_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstatfs64_trampoline_addr(SB)/8, $libc_fstatfs64_trampoline<>(SB) TEXT libc_getfsstat64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getfsstat64(SB) - GLOBL ·libc_getfsstat64_trampoline_addr(SB), RODATA, $8 DATA ·libc_getfsstat64_trampoline_addr(SB)/8, $libc_getfsstat64_trampoline<>(SB) TEXT libc_lstat64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lstat64(SB) - GLOBL ·libc_lstat64_trampoline_addr(SB), RODATA, $8 DATA ·libc_lstat64_trampoline_addr(SB)/8, $libc_lstat64_trampoline<>(SB) TEXT libc_ptrace_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ptrace(SB) - GLOBL ·libc_ptrace_trampoline_addr(SB), RODATA, $8 DATA ·libc_ptrace_trampoline_addr(SB)/8, $libc_ptrace_trampoline<>(SB) TEXT libc_stat64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_stat64(SB) - GLOBL ·libc_stat64_trampoline_addr(SB), RODATA, $8 DATA ·libc_stat64_trampoline_addr(SB)/8, $libc_stat64_trampoline<>(SB) TEXT libc_statfs64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_statfs64(SB) - GLOBL ·libc_statfs64_trampoline_addr(SB), RODATA, $8 DATA ·libc_statfs64_trampoline_addr(SB)/8, $libc_statfs64_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go index 2fd4590bb..1b40b997b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build darwin && arm64 -// +build darwin,arm64 package unix @@ -725,6 +724,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -733,10 +738,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "/usr/lib/libSystem.B.dylib" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -1992,6 +1993,31 @@ var libc_select_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func Setattrlist(path string, attrlist *Attrlist, attrBuf []byte, options int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(attrBuf) > 0 { + _p1 = unsafe.Pointer(&attrBuf[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall6(libc_setattrlist_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(attrlist)), uintptr(_p1), uintptr(len(attrBuf)), uintptr(options), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setattrlist_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setattrlist setattrlist "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Setegid(egid int) (err error) { _, _, e1 := syscall_syscall(libc_setegid_trampoline_addr, uintptr(egid), 0, 0) if e1 != 0 { @@ -2123,20 +2149,6 @@ var libc_setreuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "/usr/lib/libSystem.B.dylib" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := syscall_rawSyscall(libc_setsid_trampoline_addr, 0, 0, 0) pid = int(r0) @@ -2399,28 +2411,6 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fstat(fd int, stat *Stat_t) (err error) { _, _, e1 := syscall_syscall(libc_fstat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { @@ -2510,14 +2500,6 @@ func ptrace1(request int, pid int, addr uintptr, data uintptr) (err error) { return } -func ptrace1Ptr(request int, pid int, addr uintptr, data unsafe.Pointer) (err error) { - _, _, e1 := syscall_syscall6(libc_ptrace_trampoline_addr, uintptr(request), uintptr(pid), addr, uintptr(data), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - var libc_ptrace_trampoline_addr uintptr //go:cgo_import_dynamic libc_ptrace ptrace "/usr/lib/libSystem.B.dylib" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s index efa5b4c98..08362c1ab 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s @@ -5,900 +5,750 @@ TEXT libc_fdopendir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fdopendir(SB) - GLOBL ·libc_fdopendir_trampoline_addr(SB), RODATA, $8 DATA ·libc_fdopendir_trampoline_addr(SB)/8, $libc_fdopendir_trampoline<>(SB) TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getgroups(SB) - GLOBL ·libc_getgroups_trampoline_addr(SB), RODATA, $8 DATA ·libc_getgroups_trampoline_addr(SB)/8, $libc_getgroups_trampoline<>(SB) TEXT libc_setgroups_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setgroups(SB) - GLOBL ·libc_setgroups_trampoline_addr(SB), RODATA, $8 DATA ·libc_setgroups_trampoline_addr(SB)/8, $libc_setgroups_trampoline<>(SB) TEXT libc_wait4_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_wait4(SB) - GLOBL ·libc_wait4_trampoline_addr(SB), RODATA, $8 DATA ·libc_wait4_trampoline_addr(SB)/8, $libc_wait4_trampoline<>(SB) TEXT libc_accept_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_accept(SB) - GLOBL ·libc_accept_trampoline_addr(SB), RODATA, $8 DATA ·libc_accept_trampoline_addr(SB)/8, $libc_accept_trampoline<>(SB) TEXT libc_bind_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_bind(SB) - GLOBL ·libc_bind_trampoline_addr(SB), RODATA, $8 DATA ·libc_bind_trampoline_addr(SB)/8, $libc_bind_trampoline<>(SB) TEXT libc_connect_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_connect(SB) - GLOBL ·libc_connect_trampoline_addr(SB), RODATA, $8 DATA ·libc_connect_trampoline_addr(SB)/8, $libc_connect_trampoline<>(SB) TEXT libc_socket_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_socket(SB) - GLOBL ·libc_socket_trampoline_addr(SB), RODATA, $8 DATA ·libc_socket_trampoline_addr(SB)/8, $libc_socket_trampoline<>(SB) TEXT libc_getsockopt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsockopt(SB) - GLOBL ·libc_getsockopt_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsockopt_trampoline_addr(SB)/8, $libc_getsockopt_trampoline<>(SB) TEXT libc_setsockopt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setsockopt(SB) - GLOBL ·libc_setsockopt_trampoline_addr(SB), RODATA, $8 DATA ·libc_setsockopt_trampoline_addr(SB)/8, $libc_setsockopt_trampoline<>(SB) TEXT libc_getpeername_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpeername(SB) - GLOBL ·libc_getpeername_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpeername_trampoline_addr(SB)/8, $libc_getpeername_trampoline<>(SB) TEXT libc_getsockname_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsockname(SB) - GLOBL ·libc_getsockname_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsockname_trampoline_addr(SB)/8, $libc_getsockname_trampoline<>(SB) TEXT libc_shutdown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shutdown(SB) - GLOBL ·libc_shutdown_trampoline_addr(SB), RODATA, $8 DATA ·libc_shutdown_trampoline_addr(SB)/8, $libc_shutdown_trampoline<>(SB) TEXT libc_socketpair_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_socketpair(SB) - GLOBL ·libc_socketpair_trampoline_addr(SB), RODATA, $8 DATA ·libc_socketpair_trampoline_addr(SB)/8, $libc_socketpair_trampoline<>(SB) TEXT libc_recvfrom_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_recvfrom(SB) - GLOBL ·libc_recvfrom_trampoline_addr(SB), RODATA, $8 DATA ·libc_recvfrom_trampoline_addr(SB)/8, $libc_recvfrom_trampoline<>(SB) TEXT libc_sendto_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendto(SB) - GLOBL ·libc_sendto_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendto_trampoline_addr(SB)/8, $libc_sendto_trampoline<>(SB) TEXT libc_recvmsg_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_recvmsg(SB) - GLOBL ·libc_recvmsg_trampoline_addr(SB), RODATA, $8 DATA ·libc_recvmsg_trampoline_addr(SB)/8, $libc_recvmsg_trampoline<>(SB) TEXT libc_sendmsg_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendmsg(SB) - GLOBL ·libc_sendmsg_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendmsg_trampoline_addr(SB)/8, $libc_sendmsg_trampoline<>(SB) TEXT libc_kevent_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kevent(SB) - GLOBL ·libc_kevent_trampoline_addr(SB), RODATA, $8 DATA ·libc_kevent_trampoline_addr(SB)/8, $libc_kevent_trampoline<>(SB) TEXT libc_utimes_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimes(SB) - GLOBL ·libc_utimes_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimes_trampoline_addr(SB)/8, $libc_utimes_trampoline<>(SB) TEXT libc_futimes_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_futimes(SB) - GLOBL ·libc_futimes_trampoline_addr(SB), RODATA, $8 DATA ·libc_futimes_trampoline_addr(SB)/8, $libc_futimes_trampoline<>(SB) TEXT libc_poll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_poll(SB) - GLOBL ·libc_poll_trampoline_addr(SB), RODATA, $8 DATA ·libc_poll_trampoline_addr(SB)/8, $libc_poll_trampoline<>(SB) TEXT libc_madvise_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_madvise(SB) - GLOBL ·libc_madvise_trampoline_addr(SB), RODATA, $8 DATA ·libc_madvise_trampoline_addr(SB)/8, $libc_madvise_trampoline<>(SB) TEXT libc_mlock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mlock(SB) - GLOBL ·libc_mlock_trampoline_addr(SB), RODATA, $8 DATA ·libc_mlock_trampoline_addr(SB)/8, $libc_mlock_trampoline<>(SB) TEXT libc_mlockall_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mlockall(SB) - GLOBL ·libc_mlockall_trampoline_addr(SB), RODATA, $8 DATA ·libc_mlockall_trampoline_addr(SB)/8, $libc_mlockall_trampoline<>(SB) TEXT libc_mprotect_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mprotect(SB) - GLOBL ·libc_mprotect_trampoline_addr(SB), RODATA, $8 DATA ·libc_mprotect_trampoline_addr(SB)/8, $libc_mprotect_trampoline<>(SB) TEXT libc_msync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_msync(SB) - GLOBL ·libc_msync_trampoline_addr(SB), RODATA, $8 DATA ·libc_msync_trampoline_addr(SB)/8, $libc_msync_trampoline<>(SB) TEXT libc_munlock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munlock(SB) - GLOBL ·libc_munlock_trampoline_addr(SB), RODATA, $8 DATA ·libc_munlock_trampoline_addr(SB)/8, $libc_munlock_trampoline<>(SB) TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munlockall(SB) - GLOBL ·libc_munlockall_trampoline_addr(SB), RODATA, $8 DATA ·libc_munlockall_trampoline_addr(SB)/8, $libc_munlockall_trampoline<>(SB) TEXT libc_closedir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_closedir(SB) - GLOBL ·libc_closedir_trampoline_addr(SB), RODATA, $8 DATA ·libc_closedir_trampoline_addr(SB)/8, $libc_closedir_trampoline<>(SB) TEXT libc_readdir_r_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readdir_r(SB) - GLOBL ·libc_readdir_r_trampoline_addr(SB), RODATA, $8 DATA ·libc_readdir_r_trampoline_addr(SB)/8, $libc_readdir_r_trampoline<>(SB) TEXT libc_pipe_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pipe(SB) - GLOBL ·libc_pipe_trampoline_addr(SB), RODATA, $8 DATA ·libc_pipe_trampoline_addr(SB)/8, $libc_pipe_trampoline<>(SB) TEXT libc_getxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getxattr(SB) - GLOBL ·libc_getxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_getxattr_trampoline_addr(SB)/8, $libc_getxattr_trampoline<>(SB) TEXT libc_fgetxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fgetxattr(SB) - GLOBL ·libc_fgetxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fgetxattr_trampoline_addr(SB)/8, $libc_fgetxattr_trampoline<>(SB) TEXT libc_setxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setxattr(SB) - GLOBL ·libc_setxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_setxattr_trampoline_addr(SB)/8, $libc_setxattr_trampoline<>(SB) TEXT libc_fsetxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fsetxattr(SB) - GLOBL ·libc_fsetxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fsetxattr_trampoline_addr(SB)/8, $libc_fsetxattr_trampoline<>(SB) TEXT libc_removexattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_removexattr(SB) - GLOBL ·libc_removexattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_removexattr_trampoline_addr(SB)/8, $libc_removexattr_trampoline<>(SB) TEXT libc_fremovexattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fremovexattr(SB) - GLOBL ·libc_fremovexattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fremovexattr_trampoline_addr(SB)/8, $libc_fremovexattr_trampoline<>(SB) TEXT libc_listxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_listxattr(SB) - GLOBL ·libc_listxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_listxattr_trampoline_addr(SB)/8, $libc_listxattr_trampoline<>(SB) TEXT libc_flistxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_flistxattr(SB) - GLOBL ·libc_flistxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_flistxattr_trampoline_addr(SB)/8, $libc_flistxattr_trampoline<>(SB) TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) - GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fcntl(SB) - GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) TEXT libc_kill_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kill(SB) - GLOBL ·libc_kill_trampoline_addr(SB), RODATA, $8 DATA ·libc_kill_trampoline_addr(SB)/8, $libc_kill_trampoline<>(SB) TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) - GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_ioctl_trampoline_addr(SB)/8, $libc_ioctl_trampoline<>(SB) TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sysctl(SB) - GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) TEXT libc_sendfile_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendfile(SB) - GLOBL ·libc_sendfile_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendfile_trampoline_addr(SB)/8, $libc_sendfile_trampoline<>(SB) TEXT libc_shmat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmat(SB) - GLOBL ·libc_shmat_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmat_trampoline_addr(SB)/8, $libc_shmat_trampoline<>(SB) TEXT libc_shmctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmctl(SB) - GLOBL ·libc_shmctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmctl_trampoline_addr(SB)/8, $libc_shmctl_trampoline<>(SB) TEXT libc_shmdt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmdt(SB) - GLOBL ·libc_shmdt_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmdt_trampoline_addr(SB)/8, $libc_shmdt_trampoline<>(SB) TEXT libc_shmget_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmget(SB) - GLOBL ·libc_shmget_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmget_trampoline_addr(SB)/8, $libc_shmget_trampoline<>(SB) TEXT libc_access_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_access(SB) - GLOBL ·libc_access_trampoline_addr(SB), RODATA, $8 DATA ·libc_access_trampoline_addr(SB)/8, $libc_access_trampoline<>(SB) TEXT libc_adjtime_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_adjtime(SB) - GLOBL ·libc_adjtime_trampoline_addr(SB), RODATA, $8 DATA ·libc_adjtime_trampoline_addr(SB)/8, $libc_adjtime_trampoline<>(SB) TEXT libc_chdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chdir(SB) - GLOBL ·libc_chdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_chdir_trampoline_addr(SB)/8, $libc_chdir_trampoline<>(SB) TEXT libc_chflags_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chflags(SB) - GLOBL ·libc_chflags_trampoline_addr(SB), RODATA, $8 DATA ·libc_chflags_trampoline_addr(SB)/8, $libc_chflags_trampoline<>(SB) TEXT libc_chmod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chmod(SB) - GLOBL ·libc_chmod_trampoline_addr(SB), RODATA, $8 DATA ·libc_chmod_trampoline_addr(SB)/8, $libc_chmod_trampoline<>(SB) TEXT libc_chown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chown(SB) - GLOBL ·libc_chown_trampoline_addr(SB), RODATA, $8 DATA ·libc_chown_trampoline_addr(SB)/8, $libc_chown_trampoline<>(SB) TEXT libc_chroot_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chroot(SB) - GLOBL ·libc_chroot_trampoline_addr(SB), RODATA, $8 DATA ·libc_chroot_trampoline_addr(SB)/8, $libc_chroot_trampoline<>(SB) TEXT libc_clock_gettime_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clock_gettime(SB) - GLOBL ·libc_clock_gettime_trampoline_addr(SB), RODATA, $8 DATA ·libc_clock_gettime_trampoline_addr(SB)/8, $libc_clock_gettime_trampoline<>(SB) TEXT libc_close_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_close(SB) - GLOBL ·libc_close_trampoline_addr(SB), RODATA, $8 DATA ·libc_close_trampoline_addr(SB)/8, $libc_close_trampoline<>(SB) TEXT libc_clonefile_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clonefile(SB) - GLOBL ·libc_clonefile_trampoline_addr(SB), RODATA, $8 DATA ·libc_clonefile_trampoline_addr(SB)/8, $libc_clonefile_trampoline<>(SB) TEXT libc_clonefileat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clonefileat(SB) - GLOBL ·libc_clonefileat_trampoline_addr(SB), RODATA, $8 DATA ·libc_clonefileat_trampoline_addr(SB)/8, $libc_clonefileat_trampoline<>(SB) TEXT libc_dup_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_dup(SB) - GLOBL ·libc_dup_trampoline_addr(SB), RODATA, $8 DATA ·libc_dup_trampoline_addr(SB)/8, $libc_dup_trampoline<>(SB) TEXT libc_dup2_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_dup2(SB) - GLOBL ·libc_dup2_trampoline_addr(SB), RODATA, $8 DATA ·libc_dup2_trampoline_addr(SB)/8, $libc_dup2_trampoline<>(SB) TEXT libc_exchangedata_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_exchangedata(SB) - GLOBL ·libc_exchangedata_trampoline_addr(SB), RODATA, $8 DATA ·libc_exchangedata_trampoline_addr(SB)/8, $libc_exchangedata_trampoline<>(SB) TEXT libc_exit_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_exit(SB) - GLOBL ·libc_exit_trampoline_addr(SB), RODATA, $8 DATA ·libc_exit_trampoline_addr(SB)/8, $libc_exit_trampoline<>(SB) TEXT libc_faccessat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_faccessat(SB) - GLOBL ·libc_faccessat_trampoline_addr(SB), RODATA, $8 DATA ·libc_faccessat_trampoline_addr(SB)/8, $libc_faccessat_trampoline<>(SB) TEXT libc_fchdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchdir(SB) - GLOBL ·libc_fchdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchdir_trampoline_addr(SB)/8, $libc_fchdir_trampoline<>(SB) TEXT libc_fchflags_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchflags(SB) - GLOBL ·libc_fchflags_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchflags_trampoline_addr(SB)/8, $libc_fchflags_trampoline<>(SB) TEXT libc_fchmod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchmod(SB) - GLOBL ·libc_fchmod_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchmod_trampoline_addr(SB)/8, $libc_fchmod_trampoline<>(SB) TEXT libc_fchmodat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchmodat(SB) - GLOBL ·libc_fchmodat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchmodat_trampoline_addr(SB)/8, $libc_fchmodat_trampoline<>(SB) TEXT libc_fchown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchown(SB) - GLOBL ·libc_fchown_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchown_trampoline_addr(SB)/8, $libc_fchown_trampoline<>(SB) TEXT libc_fchownat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchownat(SB) - GLOBL ·libc_fchownat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchownat_trampoline_addr(SB)/8, $libc_fchownat_trampoline<>(SB) TEXT libc_fclonefileat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fclonefileat(SB) - GLOBL ·libc_fclonefileat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fclonefileat_trampoline_addr(SB)/8, $libc_fclonefileat_trampoline<>(SB) TEXT libc_flock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_flock(SB) - GLOBL ·libc_flock_trampoline_addr(SB), RODATA, $8 DATA ·libc_flock_trampoline_addr(SB)/8, $libc_flock_trampoline<>(SB) TEXT libc_fpathconf_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fpathconf(SB) - GLOBL ·libc_fpathconf_trampoline_addr(SB), RODATA, $8 DATA ·libc_fpathconf_trampoline_addr(SB)/8, $libc_fpathconf_trampoline<>(SB) TEXT libc_fsync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fsync(SB) - GLOBL ·libc_fsync_trampoline_addr(SB), RODATA, $8 DATA ·libc_fsync_trampoline_addr(SB)/8, $libc_fsync_trampoline<>(SB) TEXT libc_ftruncate_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ftruncate(SB) - GLOBL ·libc_ftruncate_trampoline_addr(SB), RODATA, $8 DATA ·libc_ftruncate_trampoline_addr(SB)/8, $libc_ftruncate_trampoline<>(SB) TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getcwd(SB) - GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) TEXT libc_getdtablesize_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getdtablesize(SB) - GLOBL ·libc_getdtablesize_trampoline_addr(SB), RODATA, $8 DATA ·libc_getdtablesize_trampoline_addr(SB)/8, $libc_getdtablesize_trampoline<>(SB) TEXT libc_getegid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getegid(SB) - GLOBL ·libc_getegid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getegid_trampoline_addr(SB)/8, $libc_getegid_trampoline<>(SB) TEXT libc_geteuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_geteuid(SB) - GLOBL ·libc_geteuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_geteuid_trampoline_addr(SB)/8, $libc_geteuid_trampoline<>(SB) TEXT libc_getgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getgid(SB) - GLOBL ·libc_getgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getgid_trampoline_addr(SB)/8, $libc_getgid_trampoline<>(SB) TEXT libc_getpgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpgid(SB) - GLOBL ·libc_getpgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpgid_trampoline_addr(SB)/8, $libc_getpgid_trampoline<>(SB) TEXT libc_getpgrp_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpgrp(SB) - GLOBL ·libc_getpgrp_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpgrp_trampoline_addr(SB)/8, $libc_getpgrp_trampoline<>(SB) TEXT libc_getpid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpid(SB) - GLOBL ·libc_getpid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpid_trampoline_addr(SB)/8, $libc_getpid_trampoline<>(SB) TEXT libc_getppid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getppid(SB) - GLOBL ·libc_getppid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getppid_trampoline_addr(SB)/8, $libc_getppid_trampoline<>(SB) TEXT libc_getpriority_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpriority(SB) - GLOBL ·libc_getpriority_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpriority_trampoline_addr(SB)/8, $libc_getpriority_trampoline<>(SB) TEXT libc_getrlimit_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getrlimit(SB) - GLOBL ·libc_getrlimit_trampoline_addr(SB), RODATA, $8 DATA ·libc_getrlimit_trampoline_addr(SB)/8, $libc_getrlimit_trampoline<>(SB) TEXT libc_getrusage_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getrusage(SB) - GLOBL ·libc_getrusage_trampoline_addr(SB), RODATA, $8 DATA ·libc_getrusage_trampoline_addr(SB)/8, $libc_getrusage_trampoline<>(SB) TEXT libc_getsid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsid(SB) - GLOBL ·libc_getsid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsid_trampoline_addr(SB)/8, $libc_getsid_trampoline<>(SB) TEXT libc_gettimeofday_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_gettimeofday(SB) - GLOBL ·libc_gettimeofday_trampoline_addr(SB), RODATA, $8 DATA ·libc_gettimeofday_trampoline_addr(SB)/8, $libc_gettimeofday_trampoline<>(SB) TEXT libc_getuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getuid(SB) - GLOBL ·libc_getuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getuid_trampoline_addr(SB)/8, $libc_getuid_trampoline<>(SB) TEXT libc_issetugid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_issetugid(SB) - GLOBL ·libc_issetugid_trampoline_addr(SB), RODATA, $8 DATA ·libc_issetugid_trampoline_addr(SB)/8, $libc_issetugid_trampoline<>(SB) TEXT libc_kqueue_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kqueue(SB) - GLOBL ·libc_kqueue_trampoline_addr(SB), RODATA, $8 DATA ·libc_kqueue_trampoline_addr(SB)/8, $libc_kqueue_trampoline<>(SB) TEXT libc_lchown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lchown(SB) - GLOBL ·libc_lchown_trampoline_addr(SB), RODATA, $8 DATA ·libc_lchown_trampoline_addr(SB)/8, $libc_lchown_trampoline<>(SB) TEXT libc_link_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_link(SB) - GLOBL ·libc_link_trampoline_addr(SB), RODATA, $8 DATA ·libc_link_trampoline_addr(SB)/8, $libc_link_trampoline<>(SB) TEXT libc_linkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_linkat(SB) - GLOBL ·libc_linkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_linkat_trampoline_addr(SB)/8, $libc_linkat_trampoline<>(SB) TEXT libc_listen_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_listen(SB) - GLOBL ·libc_listen_trampoline_addr(SB), RODATA, $8 DATA ·libc_listen_trampoline_addr(SB)/8, $libc_listen_trampoline<>(SB) TEXT libc_mkdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkdir(SB) - GLOBL ·libc_mkdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkdir_trampoline_addr(SB)/8, $libc_mkdir_trampoline<>(SB) TEXT libc_mkdirat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkdirat(SB) - GLOBL ·libc_mkdirat_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkdirat_trampoline_addr(SB)/8, $libc_mkdirat_trampoline<>(SB) TEXT libc_mkfifo_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkfifo(SB) - GLOBL ·libc_mkfifo_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkfifo_trampoline_addr(SB)/8, $libc_mkfifo_trampoline<>(SB) TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mknod(SB) - GLOBL ·libc_mknod_trampoline_addr(SB), RODATA, $8 DATA ·libc_mknod_trampoline_addr(SB)/8, $libc_mknod_trampoline<>(SB) TEXT libc_mount_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mount(SB) - GLOBL ·libc_mount_trampoline_addr(SB), RODATA, $8 DATA ·libc_mount_trampoline_addr(SB)/8, $libc_mount_trampoline<>(SB) TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_open(SB) - GLOBL ·libc_open_trampoline_addr(SB), RODATA, $8 DATA ·libc_open_trampoline_addr(SB)/8, $libc_open_trampoline<>(SB) TEXT libc_openat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_openat(SB) - GLOBL ·libc_openat_trampoline_addr(SB), RODATA, $8 DATA ·libc_openat_trampoline_addr(SB)/8, $libc_openat_trampoline<>(SB) TEXT libc_pathconf_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pathconf(SB) - GLOBL ·libc_pathconf_trampoline_addr(SB), RODATA, $8 DATA ·libc_pathconf_trampoline_addr(SB)/8, $libc_pathconf_trampoline<>(SB) TEXT libc_pread_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pread(SB) - GLOBL ·libc_pread_trampoline_addr(SB), RODATA, $8 DATA ·libc_pread_trampoline_addr(SB)/8, $libc_pread_trampoline<>(SB) TEXT libc_pwrite_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pwrite(SB) - GLOBL ·libc_pwrite_trampoline_addr(SB), RODATA, $8 DATA ·libc_pwrite_trampoline_addr(SB)/8, $libc_pwrite_trampoline<>(SB) TEXT libc_read_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_read(SB) - GLOBL ·libc_read_trampoline_addr(SB), RODATA, $8 DATA ·libc_read_trampoline_addr(SB)/8, $libc_read_trampoline<>(SB) TEXT libc_readlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readlink(SB) - GLOBL ·libc_readlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_readlink_trampoline_addr(SB)/8, $libc_readlink_trampoline<>(SB) TEXT libc_readlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readlinkat(SB) - GLOBL ·libc_readlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_readlinkat_trampoline_addr(SB)/8, $libc_readlinkat_trampoline<>(SB) TEXT libc_rename_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_rename(SB) - GLOBL ·libc_rename_trampoline_addr(SB), RODATA, $8 DATA ·libc_rename_trampoline_addr(SB)/8, $libc_rename_trampoline<>(SB) TEXT libc_renameat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_renameat(SB) - GLOBL ·libc_renameat_trampoline_addr(SB), RODATA, $8 DATA ·libc_renameat_trampoline_addr(SB)/8, $libc_renameat_trampoline<>(SB) TEXT libc_revoke_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_revoke(SB) - GLOBL ·libc_revoke_trampoline_addr(SB), RODATA, $8 DATA ·libc_revoke_trampoline_addr(SB)/8, $libc_revoke_trampoline<>(SB) TEXT libc_rmdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_rmdir(SB) - GLOBL ·libc_rmdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_rmdir_trampoline_addr(SB)/8, $libc_rmdir_trampoline<>(SB) TEXT libc_lseek_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lseek(SB) - GLOBL ·libc_lseek_trampoline_addr(SB), RODATA, $8 DATA ·libc_lseek_trampoline_addr(SB)/8, $libc_lseek_trampoline<>(SB) TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_select(SB) - GLOBL ·libc_select_trampoline_addr(SB), RODATA, $8 DATA ·libc_select_trampoline_addr(SB)/8, $libc_select_trampoline<>(SB) +TEXT libc_setattrlist_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setattrlist(SB) +GLOBL ·libc_setattrlist_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setattrlist_trampoline_addr(SB)/8, $libc_setattrlist_trampoline<>(SB) + TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setegid(SB) - GLOBL ·libc_setegid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setegid_trampoline_addr(SB)/8, $libc_setegid_trampoline<>(SB) TEXT libc_seteuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_seteuid(SB) - GLOBL ·libc_seteuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_seteuid_trampoline_addr(SB)/8, $libc_seteuid_trampoline<>(SB) TEXT libc_setgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setgid(SB) - GLOBL ·libc_setgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setgid_trampoline_addr(SB)/8, $libc_setgid_trampoline<>(SB) TEXT libc_setlogin_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setlogin(SB) - GLOBL ·libc_setlogin_trampoline_addr(SB), RODATA, $8 DATA ·libc_setlogin_trampoline_addr(SB)/8, $libc_setlogin_trampoline<>(SB) TEXT libc_setpgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setpgid(SB) - GLOBL ·libc_setpgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setpgid_trampoline_addr(SB)/8, $libc_setpgid_trampoline<>(SB) TEXT libc_setpriority_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setpriority(SB) - GLOBL ·libc_setpriority_trampoline_addr(SB), RODATA, $8 DATA ·libc_setpriority_trampoline_addr(SB)/8, $libc_setpriority_trampoline<>(SB) TEXT libc_setprivexec_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setprivexec(SB) - GLOBL ·libc_setprivexec_trampoline_addr(SB), RODATA, $8 DATA ·libc_setprivexec_trampoline_addr(SB)/8, $libc_setprivexec_trampoline<>(SB) TEXT libc_setregid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setregid(SB) - GLOBL ·libc_setregid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setregid_trampoline_addr(SB)/8, $libc_setregid_trampoline<>(SB) TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setreuid(SB) - GLOBL ·libc_setreuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setreuid_trampoline_addr(SB)/8, $libc_setreuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) - -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setsid(SB) - GLOBL ·libc_setsid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setsid_trampoline_addr(SB)/8, $libc_setsid_trampoline<>(SB) TEXT libc_settimeofday_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_settimeofday(SB) - GLOBL ·libc_settimeofday_trampoline_addr(SB), RODATA, $8 DATA ·libc_settimeofday_trampoline_addr(SB)/8, $libc_settimeofday_trampoline<>(SB) TEXT libc_setuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setuid(SB) - GLOBL ·libc_setuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setuid_trampoline_addr(SB)/8, $libc_setuid_trampoline<>(SB) TEXT libc_symlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_symlink(SB) - GLOBL ·libc_symlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_symlink_trampoline_addr(SB)/8, $libc_symlink_trampoline<>(SB) TEXT libc_symlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_symlinkat(SB) - GLOBL ·libc_symlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_symlinkat_trampoline_addr(SB)/8, $libc_symlinkat_trampoline<>(SB) TEXT libc_sync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sync(SB) - GLOBL ·libc_sync_trampoline_addr(SB), RODATA, $8 DATA ·libc_sync_trampoline_addr(SB)/8, $libc_sync_trampoline<>(SB) TEXT libc_truncate_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_truncate(SB) - GLOBL ·libc_truncate_trampoline_addr(SB), RODATA, $8 DATA ·libc_truncate_trampoline_addr(SB)/8, $libc_truncate_trampoline<>(SB) TEXT libc_umask_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_umask(SB) - GLOBL ·libc_umask_trampoline_addr(SB), RODATA, $8 DATA ·libc_umask_trampoline_addr(SB)/8, $libc_umask_trampoline<>(SB) TEXT libc_undelete_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_undelete(SB) - GLOBL ·libc_undelete_trampoline_addr(SB), RODATA, $8 DATA ·libc_undelete_trampoline_addr(SB)/8, $libc_undelete_trampoline<>(SB) TEXT libc_unlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unlink(SB) - GLOBL ·libc_unlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_unlink_trampoline_addr(SB)/8, $libc_unlink_trampoline<>(SB) TEXT libc_unlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unlinkat(SB) - GLOBL ·libc_unlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_unlinkat_trampoline_addr(SB)/8, $libc_unlinkat_trampoline<>(SB) TEXT libc_unmount_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unmount(SB) - GLOBL ·libc_unmount_trampoline_addr(SB), RODATA, $8 DATA ·libc_unmount_trampoline_addr(SB)/8, $libc_unmount_trampoline<>(SB) TEXT libc_write_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_write(SB) - GLOBL ·libc_write_trampoline_addr(SB), RODATA, $8 DATA ·libc_write_trampoline_addr(SB)/8, $libc_write_trampoline<>(SB) TEXT libc_mmap_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mmap(SB) - GLOBL ·libc_mmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_mmap_trampoline_addr(SB)/8, $libc_mmap_trampoline<>(SB) TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munmap(SB) - GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) TEXT libc_fstat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstat(SB) - GLOBL ·libc_fstat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstat_trampoline_addr(SB)/8, $libc_fstat_trampoline<>(SB) TEXT libc_fstatat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstatat(SB) - GLOBL ·libc_fstatat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstatat_trampoline_addr(SB)/8, $libc_fstatat_trampoline<>(SB) TEXT libc_fstatfs_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstatfs(SB) - GLOBL ·libc_fstatfs_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstatfs_trampoline_addr(SB)/8, $libc_fstatfs_trampoline<>(SB) TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getfsstat(SB) - GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $8 DATA ·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB) TEXT libc_lstat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lstat(SB) - GLOBL ·libc_lstat_trampoline_addr(SB), RODATA, $8 DATA ·libc_lstat_trampoline_addr(SB)/8, $libc_lstat_trampoline<>(SB) TEXT libc_ptrace_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ptrace(SB) - GLOBL ·libc_ptrace_trampoline_addr(SB), RODATA, $8 DATA ·libc_ptrace_trampoline_addr(SB)/8, $libc_ptrace_trampoline<>(SB) TEXT libc_stat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_stat(SB) - GLOBL ·libc_stat_trampoline_addr(SB), RODATA, $8 DATA ·libc_stat_trampoline_addr(SB)/8, $libc_stat_trampoline<>(SB) TEXT libc_statfs_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_statfs(SB) - GLOBL ·libc_statfs_trampoline_addr(SB), RODATA, $8 DATA ·libc_statfs_trampoline_addr(SB)/8, $libc_statfs_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go index 3b8513470..aad65fc79 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build dragonfly && amd64 -// +build dragonfly,amd64 package unix @@ -1410,16 +1409,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1652,28 +1641,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go index 112906562..c0096391a 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build freebsd && 386 -// +build freebsd,386 package unix @@ -1645,16 +1644,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1872,28 +1861,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go index 55f5abfe5..7664df749 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build freebsd && amd64 -// +build freebsd,amd64 package unix @@ -1645,16 +1644,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1872,28 +1861,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go index d39651c2b..ae099182c 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build freebsd && arm -// +build freebsd,arm package unix @@ -1645,16 +1644,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1872,28 +1861,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go index ddb740868..11fd5d45b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build freebsd && arm64 -// +build freebsd,arm64 package unix @@ -1645,16 +1644,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1872,28 +1861,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go index 09a53a616..c3d2d6530 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build freebsd && riscv64 -// +build freebsd,riscv64 package unix @@ -1645,16 +1644,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1872,28 +1861,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go index b57c7050d..c698cbc01 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build illumos && amd64 -// +build illumos,amd64 package unix @@ -40,7 +39,7 @@ func readv(fd int, iovs []Iovec) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procreadv)), 3, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(iovs)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -55,7 +54,7 @@ func preadv(fd int, iovs []Iovec, off int64) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpreadv)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(iovs)), uintptr(off), 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -70,7 +69,7 @@ func writev(fd int, iovs []Iovec) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procwritev)), 3, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(iovs)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -85,7 +84,7 @@ func pwritev(fd int, iovs []Iovec, off int64) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpwritev)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(iovs)), uintptr(off), 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -96,7 +95,7 @@ func accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procaccept4)), 4, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux.go b/vendor/golang.org/x/sys/unix/zsyscall_linux.go index 430cb24de..1488d2712 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux.go @@ -1,7 +1,6 @@ // Code generated by mkmerge; DO NOT EDIT. //go:build linux -// +build linux package unix @@ -38,6 +37,21 @@ func fchmodat(dirfd int, path string, mode uint32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fchmodat2(dirfd int, path string, mode uint32, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall6(SYS_FCHMODAT2, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -1346,16 +1360,6 @@ func PivotRoot(newroot string, putold string) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Prlimit(pid int, resource int, newlimit *Rlimit, old *Rlimit) (err error) { - _, _, e1 := RawSyscall6(SYS_PRLIMIT64, uintptr(pid), uintptr(resource), uintptr(unsafe.Pointer(newlimit)), uintptr(unsafe.Pointer(old)), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) (err error) { _, _, e1 := Syscall6(SYS_PRCTL, uintptr(option), uintptr(arg2), uintptr(arg3), uintptr(arg4), uintptr(arg5), 0) if e1 != 0 { @@ -1366,7 +1370,7 @@ func Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) ( // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { +func pselect6(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *sigset_argpack) (n int, err error) { r0, _, e1 := Syscall6(SYS_PSELECT6, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask))) n = int(r0) if e1 != 0 { @@ -1744,28 +1748,6 @@ func exitThread(code int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, p *byte, np int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(p)), uintptr(np)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, p *byte, np int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(p)), uintptr(np)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func readv(fd int, iovs []Iovec) (n int, err error) { var _p0 unsafe.Pointer if len(iovs) > 0 { @@ -1878,6 +1860,17 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldaddr), uintptr(oldlength), uintptr(newlength), uintptr(flags), uintptr(newaddr), 0) + xaddr = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Madvise(b []byte, advice int) (err error) { var _p0 unsafe.Pointer if len(b) > 0 { @@ -2182,3 +2175,47 @@ func rtSigprocmask(how int, set *Sigset_t, oldset *Sigset_t, sigsetsize uintptr) } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + RawSyscallNoError(SYS_GETRESUID, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + RawSyscallNoError(SYS_GETRESGID, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func schedSetattr(pid int, attr *SchedAttr, flags uint) (err error) { + _, _, e1 := Syscall(SYS_SCHED_SETATTR, uintptr(pid), uintptr(unsafe.Pointer(attr)), uintptr(flags)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func schedGetattr(pid int, attr *SchedAttr, size uint, flags uint) (err error) { + _, _, e1 := Syscall6(SYS_SCHED_GETATTR, uintptr(pid), uintptr(unsafe.Pointer(attr)), uintptr(size), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Cachestat(fd uint, crange *CachestatRange, cstat *Cachestat_t, flags uint) (err error) { + _, _, e1 := Syscall6(SYS_CACHESTAT, uintptr(fd), uintptr(unsafe.Pointer(crange)), uintptr(unsafe.Pointer(cstat)), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go index c81b0ad47..4def3e9fc 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && 386 -// +build linux,386 package unix @@ -411,16 +410,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *rlimit32) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func futimesat(dirfd int, path string, times *[2]Timeval) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go index 2206bce7f..fef2bc8ba 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && amd64 -// +build linux,amd64 package unix @@ -334,16 +333,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go index edf6b39f1..a9fd76a88 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && arm -// +build linux,arm package unix @@ -578,16 +577,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *rlimit32) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func armSyncFileRange(fd int, flags int, off int64, n int64) (err error) { _, _, e1 := Syscall6(SYS_ARM_SYNC_FILE_RANGE, uintptr(fd), uintptr(flags), uintptr(off), uintptr(off>>32), uintptr(n), uintptr(n>>32)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go index 190609f21..460065028 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && arm64 -// +build linux,arm64 package unix @@ -289,16 +288,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go index 806ffd1e1..c8987d264 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && loong64 -// +build linux,loong64 package unix diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go index 5f984cbb1..921f43061 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && mips -// +build linux,mips package unix @@ -644,16 +643,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *rlimit32) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Alarm(seconds uint) (remaining uint, err error) { r0, _, e1 := Syscall(SYS_ALARM, uintptr(seconds), 0, 0) remaining = uint(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go index 46fc380a4..44f067829 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && mips64 -// +build linux,mips64 package unix @@ -278,16 +277,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go index cbd0d4dad..e7fa0abf0 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && mips64le -// +build linux,mips64le package unix @@ -278,16 +277,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go index 0c13d15f0..8c5125675 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && mipsle -// +build linux,mipsle package unix @@ -644,16 +643,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *rlimit32) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Alarm(seconds uint) (remaining uint, err error) { r0, _, e1 := Syscall(SYS_ALARM, uintptr(seconds), 0, 0) remaining = uint(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go index e01432aed..7392fd45e 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && ppc -// +build linux,ppc package unix @@ -624,16 +623,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *rlimit32) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func syncFileRange2(fd int, flags int, off int64, n int64) (err error) { _, _, e1 := Syscall6(SYS_SYNC_FILE_RANGE2, uintptr(fd), uintptr(flags), uintptr(off>>32), uintptr(off), uintptr(n>>32), uintptr(n)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go index 13c7ee7ba..41180434e 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && ppc64 -// +build linux,ppc64 package unix @@ -349,16 +348,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go index 02d0c0fd6..40c6ce7ae 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && ppc64le -// +build linux,ppc64le package unix @@ -349,16 +348,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go index 9fee3b1d2..2cfe34adb 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && riscv64 -// +build linux,riscv64 package unix @@ -269,16 +268,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { @@ -541,3 +530,19 @@ func kexecFileLoad(kernelFd int, initrdFd int, cmdlineLen int, cmdline string, f } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func riscvHWProbe(pairs []RISCVHWProbePairs, cpuCount uintptr, cpus *CPUSet, flags uint) (err error) { + var _p0 unsafe.Pointer + if len(pairs) > 0 { + _p0 = unsafe.Pointer(&pairs[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := Syscall6(SYS_RISCV_HWPROBE, uintptr(_p0), uintptr(len(pairs)), uintptr(cpuCount), uintptr(unsafe.Pointer(cpus)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go index 647bbfecd..61e6f0709 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && s390x -// +build linux,s390x package unix @@ -319,16 +318,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) { r0, _, e1 := Syscall6(SYS_SPLICE, uintptr(rfd), uintptr(unsafe.Pointer(roff)), uintptr(wfd), uintptr(unsafe.Pointer(woff)), uintptr(len), uintptr(flags)) n = int64(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go index ada057f89..834b84204 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && sparc64 -// +build linux,sparc64 package unix @@ -329,16 +328,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go index 8e1d9c8f6..e91ebc14a 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build netbsd && 386 -// +build netbsd,386 package unix @@ -1607,16 +1606,6 @@ func Setreuid(ruid int, euid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1834,20 +1823,13 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) + _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } @@ -1856,13 +1838,9 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) if e1 != 0 { err = errnoErr(e1) } diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go index 21c695040..be28babbc 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build netbsd && amd64 -// +build netbsd,amd64 package unix @@ -1607,16 +1606,6 @@ func Setreuid(ruid int, euid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1834,20 +1823,13 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) + _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } @@ -1856,13 +1838,9 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) if e1 != 0 { err = errnoErr(e1) } diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go index 298168f90..fb587e826 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build netbsd && arm -// +build netbsd,arm package unix @@ -1607,16 +1606,6 @@ func Setreuid(ruid int, euid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1834,20 +1823,13 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) + _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } @@ -1856,13 +1838,9 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) if e1 != 0 { err = errnoErr(e1) } diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go index 68b8bd492..d576438bb 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build netbsd && arm64 -// +build netbsd,arm64 package unix @@ -1607,16 +1606,6 @@ func Setreuid(ruid int, euid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1834,20 +1823,13 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) + _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } @@ -1856,13 +1838,9 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) if e1 != 0 { err = errnoErr(e1) } diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go index 0b0f910e1..a1d061597 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && 386 -// +build openbsd,386 package unix @@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +548,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +562,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -561,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) @@ -1894,20 +1943,6 @@ var libc_setresuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrtable(rtable int) (err error) { _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { @@ -2203,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) +func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -2212,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_getfsstat_trampoline_addr uintptr -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -2241,3 +2269,33 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error var libc_utimensat_trampoline_addr uintptr //go:cgo_import_dynamic libc_utimensat utimensat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pledge(promises *byte, execpromises *byte) (err error) { + _, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pledge_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pledge pledge "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func unveil(path *byte, flags *byte) (err error) { + _, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unveil_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unveil unveil "libc.so" + + diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s index 087444250..41b561731 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $4 DATA ·libc_getcwd_trampoline_addr(SB)/4, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresuid_trampoline_addr(SB)/4, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresgid_trampoline_addr(SB)/4, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $4 @@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $4 DATA ·libc_sysctl_trampoline_addr(SB)/4, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fcntl_trampoline_addr(SB)/4, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $4 @@ -573,11 +588,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $4 DATA ·libc_setresuid_trampoline_addr(SB)/4, $libc_setresuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $4 -DATA ·libc_setrlimit_trampoline_addr(SB)/4, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setrtable(SB) GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $4 @@ -663,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $4 DATA ·libc_munmap_trampoline_addr(SB)/4, $libc_munmap_trampoline<>(SB) +TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getfsstat(SB) +GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getfsstat_trampoline_addr(SB)/4, $libc_getfsstat_trampoline<>(SB) + TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $4 DATA ·libc_utimensat_trampoline_addr(SB)/4, $libc_utimensat_trampoline<>(SB) + +TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pledge(SB) +GLOBL ·libc_pledge_trampoline_addr(SB), RODATA, $4 +DATA ·libc_pledge_trampoline_addr(SB)/4, $libc_pledge_trampoline<>(SB) + +TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unveil(SB) +GLOBL ·libc_unveil_trampoline_addr(SB), RODATA, $4 +DATA ·libc_unveil_trampoline_addr(SB)/4, $libc_unveil_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go index 48ff5de75..5b2a74097 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && amd64 -// +build openbsd,amd64 package unix @@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +548,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +562,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -561,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) @@ -1894,20 +1943,6 @@ var libc_setresuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrtable(rtable int) (err error) { _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { @@ -2203,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) +func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -2212,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_getfsstat_trampoline_addr uintptr -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -2241,3 +2269,33 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error var libc_utimensat_trampoline_addr uintptr //go:cgo_import_dynamic libc_utimensat utimensat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pledge(promises *byte, execpromises *byte) (err error) { + _, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pledge_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pledge pledge "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func unveil(path *byte, flags *byte) (err error) { + _, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unveil_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unveil unveil "libc.so" + + diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s index 5782cd108..4019a656f 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 @@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 @@ -573,11 +588,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setrtable(SB) GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $8 @@ -663,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) +TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getfsstat(SB) +GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB) + TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) + +TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pledge(SB) +GLOBL ·libc_pledge_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pledge_trampoline_addr(SB)/8, $libc_pledge_trampoline<>(SB) + +TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unveil(SB) +GLOBL ·libc_unveil_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unveil_trampoline_addr(SB)/8, $libc_unveil_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go index 2452a641d..f6eda1344 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && arm -// +build openbsd,arm package unix @@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +548,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +562,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -561,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) @@ -1894,20 +1943,6 @@ var libc_setresuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrtable(rtable int) (err error) { _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { @@ -2203,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) +func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -2212,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_getfsstat_trampoline_addr uintptr -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -2241,3 +2269,33 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error var libc_utimensat_trampoline_addr uintptr //go:cgo_import_dynamic libc_utimensat utimensat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pledge(promises *byte, execpromises *byte) (err error) { + _, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pledge_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pledge pledge "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func unveil(path *byte, flags *byte) (err error) { + _, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unveil_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unveil unveil "libc.so" + + diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s index cf310420c..ac4af24f9 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $4 DATA ·libc_getcwd_trampoline_addr(SB)/4, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresuid_trampoline_addr(SB)/4, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresgid_trampoline_addr(SB)/4, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $4 @@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $4 DATA ·libc_sysctl_trampoline_addr(SB)/4, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fcntl_trampoline_addr(SB)/4, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $4 @@ -573,11 +588,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $4 DATA ·libc_setresuid_trampoline_addr(SB)/4, $libc_setresuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $4 -DATA ·libc_setrlimit_trampoline_addr(SB)/4, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setrtable(SB) GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $4 @@ -663,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $4 DATA ·libc_munmap_trampoline_addr(SB)/4, $libc_munmap_trampoline<>(SB) +TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getfsstat(SB) +GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getfsstat_trampoline_addr(SB)/4, $libc_getfsstat_trampoline<>(SB) + TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $4 DATA ·libc_utimensat_trampoline_addr(SB)/4, $libc_utimensat_trampoline<>(SB) + +TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pledge(SB) +GLOBL ·libc_pledge_trampoline_addr(SB), RODATA, $4 +DATA ·libc_pledge_trampoline_addr(SB)/4, $libc_pledge_trampoline<>(SB) + +TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unveil(SB) +GLOBL ·libc_unveil_trampoline_addr(SB), RODATA, $4 +DATA ·libc_unveil_trampoline_addr(SB)/4, $libc_unveil_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go index 5e35600a6..55df20ae9 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && arm64 -// +build openbsd,arm64 package unix @@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +548,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +562,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -561,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) @@ -1894,20 +1943,6 @@ var libc_setresuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrtable(rtable int) (err error) { _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { @@ -2203,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) +func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -2212,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_getfsstat_trampoline_addr uintptr -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -2241,3 +2269,33 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error var libc_utimensat_trampoline_addr uintptr //go:cgo_import_dynamic libc_utimensat utimensat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pledge(promises *byte, execpromises *byte) (err error) { + _, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pledge_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pledge pledge "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func unveil(path *byte, flags *byte) (err error) { + _, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unveil_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unveil unveil "libc.so" + + diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s index 484bb42e0..f77d53212 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 @@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 @@ -573,11 +588,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setrtable(SB) GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $8 @@ -663,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) +TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getfsstat(SB) +GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB) + TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) + +TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pledge(SB) +GLOBL ·libc_pledge_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pledge_trampoline_addr(SB)/8, $libc_pledge_trampoline<>(SB) + +TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unveil(SB) +GLOBL ·libc_unveil_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unveil_trampoline_addr(SB)/8, $libc_unveil_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go index b04cef1a1..8c1155cbc 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && mips64 -// +build openbsd,mips64 package unix @@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +548,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +562,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -561,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) @@ -1894,20 +1943,6 @@ var libc_setresuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrtable(rtable int) (err error) { _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { @@ -2203,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) +func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -2212,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_getfsstat_trampoline_addr uintptr -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -2241,3 +2269,33 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error var libc_utimensat_trampoline_addr uintptr //go:cgo_import_dynamic libc_utimensat utimensat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pledge(promises *byte, execpromises *byte) (err error) { + _, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pledge_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pledge pledge "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func unveil(path *byte, flags *byte) (err error) { + _, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unveil_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unveil unveil "libc.so" + + diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s index 55af27263..fae140b62 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 @@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 @@ -573,11 +588,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setrtable(SB) GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $8 @@ -663,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) +TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getfsstat(SB) +GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB) + TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) + +TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pledge(SB) +GLOBL ·libc_pledge_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pledge_trampoline_addr(SB)/8, $libc_pledge_trampoline<>(SB) + +TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unveil(SB) +GLOBL ·libc_unveil_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unveil_trampoline_addr(SB)/8, $libc_unveil_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go index 47a07ee0c..7cc80c58d 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && ppc64 -// +build openbsd,ppc64 package unix @@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +548,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +562,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -561,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) @@ -1894,20 +1943,6 @@ var libc_setresuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrtable(rtable int) (err error) { _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { @@ -2203,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) +func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -2212,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_getfsstat_trampoline_addr uintptr -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -2241,3 +2269,33 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error var libc_utimensat_trampoline_addr uintptr //go:cgo_import_dynamic libc_utimensat utimensat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pledge(promises *byte, execpromises *byte) (err error) { + _, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pledge_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pledge pledge "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func unveil(path *byte, flags *byte) (err error) { + _, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unveil_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unveil unveil "libc.so" + + diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s index 4028255b0..9d1e0ff06 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s @@ -189,6 +189,18 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getresuid(SB) + RET +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getresgid(SB) + RET +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 CALL libc_ioctl(SB) RET @@ -201,6 +213,12 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fcntl(SB) + RET +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 CALL libc_ppoll(SB) RET @@ -687,12 +705,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - CALL libc_setrlimit(SB) - RET -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 CALL libc_setrtable(SB) RET @@ -795,8 +807,26 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) +TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getfsstat(SB) + RET +GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB) + TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 CALL libc_utimensat(SB) RET GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) + +TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_pledge(SB) + RET +GLOBL ·libc_pledge_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pledge_trampoline_addr(SB)/8, $libc_pledge_trampoline<>(SB) + +TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_unveil(SB) + RET +GLOBL ·libc_unveil_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unveil_trampoline_addr(SB)/8, $libc_unveil_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go index 573378fdb..0688737f4 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && riscv64 -// +build openbsd,riscv64 package unix @@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +548,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +562,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -561,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) @@ -1894,20 +1943,6 @@ var libc_setresuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrtable(rtable int) (err error) { _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { @@ -2203,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) +func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -2212,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_getfsstat_trampoline_addr uintptr -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -2241,3 +2269,33 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error var libc_utimensat_trampoline_addr uintptr //go:cgo_import_dynamic libc_utimensat utimensat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pledge(promises *byte, execpromises *byte) (err error) { + _, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pledge_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pledge pledge "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func unveil(path *byte, flags *byte) (err error) { + _, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unveil_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unveil unveil "libc.so" + + diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s index e1fbd4dfa..da115f9a4 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 @@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 @@ -573,11 +588,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setrtable(SB) GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $8 @@ -663,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) +TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getfsstat(SB) +GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB) + TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) + +TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pledge(SB) +GLOBL ·libc_pledge_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pledge_trampoline_addr(SB)/8, $libc_pledge_trampoline<>(SB) + +TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unveil(SB) +GLOBL ·libc_unveil_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unveil_trampoline_addr(SB)/8, $libc_unveil_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go index 4873a1e5d..829b87feb 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build solaris && amd64 -// +build solaris,amd64 package unix @@ -110,7 +109,6 @@ import ( //go:cgo_import_dynamic libc_setpriority setpriority "libc.so" //go:cgo_import_dynamic libc_setregid setregid "libc.so" //go:cgo_import_dynamic libc_setreuid setreuid "libc.so" -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" //go:cgo_import_dynamic libc_setsid setsid "libc.so" //go:cgo_import_dynamic libc_setuid setuid "libc.so" //go:cgo_import_dynamic libc_shutdown shutdown "libsocket.so" @@ -250,7 +248,6 @@ import ( //go:linkname procSetpriority libc_setpriority //go:linkname procSetregid libc_setregid //go:linkname procSetreuid libc_setreuid -//go:linkname procSetrlimit libc_setrlimit //go:linkname procSetsid libc_setsid //go:linkname procSetuid libc_setuid //go:linkname procshutdown libc_shutdown @@ -391,7 +388,6 @@ var ( procSetpriority, procSetregid, procSetreuid, - procSetrlimit, procSetsid, procSetuid, procshutdown, @@ -439,7 +435,7 @@ func pipe(p *[2]_C_int) (n int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procpipe)), 1, uintptr(unsafe.Pointer(p)), 0, 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -449,7 +445,7 @@ func pipe(p *[2]_C_int) (n int, err error) { func pipe2(p *[2]_C_int, flags int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procpipe2)), 2, uintptr(unsafe.Pointer(p)), uintptr(flags), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -459,7 +455,7 @@ func pipe2(p *[2]_C_int, flags int) (err error) { func getsockname(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procgetsockname)), 3, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -474,7 +470,7 @@ func Getcwd(buf []byte) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procGetcwd)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(buf)), 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -485,7 +481,7 @@ func getgroups(ngid int, gid *_Gid_t) (n int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procgetgroups)), 2, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -495,7 +491,7 @@ func getgroups(ngid int, gid *_Gid_t) (n int, err error) { func setgroups(ngid int, gid *_Gid_t) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procsetgroups)), 2, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -506,7 +502,7 @@ func wait4(pid int32, statusp *_C_int, options int, rusage *Rusage) (wpid int32, r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procwait4)), 4, uintptr(pid), uintptr(unsafe.Pointer(statusp)), uintptr(options), uintptr(unsafe.Pointer(rusage)), 0, 0) wpid = int32(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -521,7 +517,7 @@ func gethostname(buf []byte) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procgethostname)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(buf)), 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -536,7 +532,7 @@ func utimes(path string, times *[2]Timeval) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procutimes)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -551,7 +547,7 @@ func utimensat(fd int, path string, times *[2]Timespec, flag int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procutimensat)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flag), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -562,7 +558,7 @@ func fcntl(fd int, cmd int, arg int) (val int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procfcntl)), 3, uintptr(fd), uintptr(cmd), uintptr(arg), 0, 0, 0) val = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -572,7 +568,7 @@ func fcntl(fd int, cmd int, arg int) (val int, err error) { func futimesat(fildes int, path *byte, times *[2]Timeval) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procfutimesat)), 3, uintptr(fildes), uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(times)), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -583,7 +579,7 @@ func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procaccept)), 3, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), 0, 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -594,7 +590,7 @@ func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_recvmsg)), 3, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -605,7 +601,7 @@ func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_sendmsg)), 3, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -615,7 +611,7 @@ func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { func acct(path *byte) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procacct)), 1, uintptr(unsafe.Pointer(path)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -646,22 +642,22 @@ func __minor(version int, dev uint64) (val uint) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctlRet(fd int, req uint, arg uintptr) (ret int, err error) { +func ioctlRet(fd int, req int, arg uintptr) (ret int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procioctl)), 3, uintptr(fd), uintptr(req), uintptr(arg), 0, 0, 0) ret = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctlPtrRet(fd int, req uint, arg unsafe.Pointer) (ret int, err error) { +func ioctlPtrRet(fd int, req int, arg unsafe.Pointer) (ret int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procioctl)), 3, uintptr(fd), uintptr(req), uintptr(arg), 0, 0, 0) ret = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -672,7 +668,7 @@ func poll(fds *PollFd, nfds int, timeout int) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpoll)), 3, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(timeout), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -687,7 +683,7 @@ func Access(path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procAccess)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -697,7 +693,7 @@ func Access(path string, mode uint32) (err error) { func Adjtime(delta *Timeval, olddelta *Timeval) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procAdjtime)), 2, uintptr(unsafe.Pointer(delta)), uintptr(unsafe.Pointer(olddelta)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -712,7 +708,7 @@ func Chdir(path string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procChdir)), 1, uintptr(unsafe.Pointer(_p0)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -727,7 +723,7 @@ func Chmod(path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procChmod)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -742,7 +738,7 @@ func Chown(path string, uid int, gid int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procChown)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -757,7 +753,7 @@ func Chroot(path string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procChroot)), 1, uintptr(unsafe.Pointer(_p0)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -767,7 +763,7 @@ func Chroot(path string) (err error) { func ClockGettime(clockid int32, time *Timespec) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procClockGettime)), 2, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -777,7 +773,7 @@ func ClockGettime(clockid int32, time *Timespec) (err error) { func Close(fd int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procClose)), 1, uintptr(fd), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -793,7 +789,7 @@ func Creat(path string, mode uint32) (fd int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procCreat)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -804,7 +800,7 @@ func Dup(fd int) (nfd int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procDup)), 1, uintptr(fd), 0, 0, 0, 0, 0) nfd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -814,7 +810,7 @@ func Dup(fd int) (nfd int, err error) { func Dup2(oldfd int, newfd int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procDup2)), 2, uintptr(oldfd), uintptr(newfd), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -836,7 +832,7 @@ func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFaccessat)), 4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -846,7 +842,7 @@ func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { func Fchdir(fd int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchdir)), 1, uintptr(fd), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -856,7 +852,7 @@ func Fchdir(fd int) (err error) { func Fchmod(fd int, mode uint32) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchmod)), 2, uintptr(fd), uintptr(mode), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -871,7 +867,7 @@ func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchmodat)), 4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -881,7 +877,7 @@ func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { func Fchown(fd int, uid int, gid int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchown)), 3, uintptr(fd), uintptr(uid), uintptr(gid), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -896,7 +892,7 @@ func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchownat)), 5, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), uintptr(flags), 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -906,7 +902,7 @@ func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { func Fdatasync(fd int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFdatasync)), 1, uintptr(fd), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -916,7 +912,7 @@ func Fdatasync(fd int) (err error) { func Flock(fd int, how int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFlock)), 2, uintptr(fd), uintptr(how), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -927,7 +923,7 @@ func Fpathconf(fd int, name int) (val int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFpathconf)), 2, uintptr(fd), uintptr(name), 0, 0, 0, 0) val = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -937,7 +933,7 @@ func Fpathconf(fd int, name int) (val int, err error) { func Fstat(fd int, stat *Stat_t) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFstat)), 2, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -952,7 +948,7 @@ func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFstatat)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -962,7 +958,7 @@ func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { func Fstatvfs(fd int, vfsstat *Statvfs_t) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFstatvfs)), 2, uintptr(fd), uintptr(unsafe.Pointer(vfsstat)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -977,7 +973,7 @@ func Getdents(fd int, buf []byte, basep *uintptr) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procGetdents)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(buf)), uintptr(unsafe.Pointer(basep)), 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1004,7 +1000,7 @@ func Getpgid(pid int) (pgid int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetpgid)), 1, uintptr(pid), 0, 0, 0, 0, 0) pgid = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1015,7 +1011,7 @@ func Getpgrp() (pgid int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetpgrp)), 0, 0, 0, 0, 0, 0, 0) pgid = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1050,7 +1046,7 @@ func Getpriority(which int, who int) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procGetpriority)), 2, uintptr(which), uintptr(who), 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1060,7 +1056,7 @@ func Getpriority(which int, who int) (n int, err error) { func Getrlimit(which int, lim *Rlimit) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetrlimit)), 2, uintptr(which), uintptr(unsafe.Pointer(lim)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1070,7 +1066,7 @@ func Getrlimit(which int, lim *Rlimit) (err error) { func Getrusage(who int, rusage *Rusage) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetrusage)), 2, uintptr(who), uintptr(unsafe.Pointer(rusage)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1081,7 +1077,7 @@ func Getsid(pid int) (sid int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetsid)), 1, uintptr(pid), 0, 0, 0, 0, 0) sid = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1091,7 +1087,7 @@ func Getsid(pid int) (sid int, err error) { func Gettimeofday(tv *Timeval) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGettimeofday)), 1, uintptr(unsafe.Pointer(tv)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1109,7 +1105,7 @@ func Getuid() (uid int) { func Kill(pid int, signum syscall.Signal) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procKill)), 2, uintptr(pid), uintptr(signum), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1124,7 +1120,7 @@ func Lchown(path string, uid int, gid int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procLchown)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1144,7 +1140,7 @@ func Link(path string, link string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procLink)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1154,7 +1150,7 @@ func Link(path string, link string) (err error) { func Listen(s int, backlog int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_llisten)), 2, uintptr(s), uintptr(backlog), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1169,7 +1165,7 @@ func Lstat(path string, stat *Stat_t) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procLstat)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1183,7 +1179,7 @@ func Madvise(b []byte, advice int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMadvise)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), uintptr(advice), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1198,7 +1194,7 @@ func Mkdir(path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMkdir)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1213,7 +1209,7 @@ func Mkdirat(dirfd int, path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMkdirat)), 3, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1228,7 +1224,7 @@ func Mkfifo(path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMkfifo)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1243,7 +1239,7 @@ func Mkfifoat(dirfd int, path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMkfifoat)), 3, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1258,7 +1254,7 @@ func Mknod(path string, mode uint32, dev int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMknod)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1273,7 +1269,7 @@ func Mknodat(dirfd int, path string, mode uint32, dev int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMknodat)), 4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1287,7 +1283,7 @@ func Mlock(b []byte) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMlock)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1297,7 +1293,7 @@ func Mlock(b []byte) (err error) { func Mlockall(flags int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMlockall)), 1, uintptr(flags), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1311,7 +1307,7 @@ func Mprotect(b []byte, prot int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMprotect)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), uintptr(prot), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1325,7 +1321,7 @@ func Msync(b []byte, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMsync)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), uintptr(flags), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1339,7 +1335,7 @@ func Munlock(b []byte) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMunlock)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1349,7 +1345,7 @@ func Munlock(b []byte) (err error) { func Munlockall() (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMunlockall)), 0, 0, 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1359,7 +1355,7 @@ func Munlockall() (err error) { func Nanosleep(time *Timespec, leftover *Timespec) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procNanosleep)), 2, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1375,7 +1371,7 @@ func Open(path string, mode int, perm uint32) (fd int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procOpen)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm), 0, 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1391,7 +1387,7 @@ func Openat(dirfd int, path string, flags int, mode uint32) (fd int, err error) r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procOpenat)), 4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags), uintptr(mode), 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1407,7 +1403,7 @@ func Pathconf(path string, name int) (val int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procPathconf)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(name), 0, 0, 0, 0) val = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1417,7 +1413,7 @@ func Pathconf(path string, name int) (val int, err error) { func Pause() (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procPause)), 0, 0, 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1432,7 +1428,7 @@ func pread(fd int, p []byte, offset int64) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpread)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), uintptr(offset), 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1447,7 +1443,7 @@ func pwrite(fd int, p []byte, offset int64) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpwrite)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), uintptr(offset), 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1462,7 +1458,7 @@ func read(fd int, p []byte) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procread)), 3, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1482,7 +1478,7 @@ func Readlink(path string, buf []byte) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procReadlink)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), uintptr(len(buf)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1502,7 +1498,7 @@ func Rename(from string, to string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procRename)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1522,7 +1518,7 @@ func Renameat(olddirfd int, oldpath string, newdirfd int, newpath string) (err e } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procRenameat)), 4, uintptr(olddirfd), uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1)), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1537,7 +1533,7 @@ func Rmdir(path string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procRmdir)), 1, uintptr(unsafe.Pointer(_p0)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1548,7 +1544,7 @@ func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proclseek)), 3, uintptr(fd), uintptr(offset), uintptr(whence), 0, 0, 0) newoffset = int64(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1559,7 +1555,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSelect)), 5, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1569,7 +1565,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err func Setegid(egid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetegid)), 1, uintptr(egid), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1579,7 +1575,7 @@ func Setegid(egid int) (err error) { func Seteuid(euid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSeteuid)), 1, uintptr(euid), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1589,7 +1585,7 @@ func Seteuid(euid int) (err error) { func Setgid(gid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetgid)), 1, uintptr(gid), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1603,7 +1599,7 @@ func Sethostname(p []byte) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSethostname)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1613,7 +1609,7 @@ func Sethostname(p []byte) (err error) { func Setpgid(pid int, pgid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetpgid)), 2, uintptr(pid), uintptr(pgid), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1623,7 +1619,7 @@ func Setpgid(pid int, pgid int) (err error) { func Setpriority(which int, who int, prio int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSetpriority)), 3, uintptr(which), uintptr(who), uintptr(prio), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1633,7 +1629,7 @@ func Setpriority(which int, who int, prio int) (err error) { func Setregid(rgid int, egid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetregid)), 2, uintptr(rgid), uintptr(egid), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1643,17 +1639,7 @@ func Setregid(rgid int, egid int) (err error) { func Setreuid(ruid int, euid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetreuid)), 2, uintptr(ruid), uintptr(euid), 0, 0, 0, 0) if e1 != 0 { - err = e1 - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetrlimit)), 2, uintptr(which), uintptr(unsafe.Pointer(lim)), 0, 0, 0, 0) - if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1664,7 +1650,7 @@ func Setsid() (pid int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetsid)), 0, 0, 0, 0, 0, 0, 0) pid = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1674,7 +1660,7 @@ func Setsid() (pid int, err error) { func Setuid(uid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetuid)), 1, uintptr(uid), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1684,7 +1670,7 @@ func Setuid(uid int) (err error) { func Shutdown(s int, how int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procshutdown)), 2, uintptr(s), uintptr(how), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1699,7 +1685,7 @@ func Stat(path string, stat *Stat_t) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procStat)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1714,7 +1700,7 @@ func Statvfs(path string, vfsstat *Statvfs_t) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procStatvfs)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(vfsstat)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1734,7 +1720,7 @@ func Symlink(path string, link string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSymlink)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1744,7 +1730,7 @@ func Symlink(path string, link string) (err error) { func Sync() (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSync)), 0, 0, 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1755,7 +1741,7 @@ func Sysconf(which int) (n int64, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSysconf)), 1, uintptr(which), 0, 0, 0, 0, 0) n = int64(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1766,7 +1752,7 @@ func Times(tms *Tms) (ticks uintptr, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procTimes)), 1, uintptr(unsafe.Pointer(tms)), 0, 0, 0, 0, 0) ticks = uintptr(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1781,7 +1767,7 @@ func Truncate(path string, length int64) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procTruncate)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(length), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1791,7 +1777,7 @@ func Truncate(path string, length int64) (err error) { func Fsync(fd int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFsync)), 1, uintptr(fd), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1801,7 +1787,7 @@ func Fsync(fd int) (err error) { func Ftruncate(fd int, length int64) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFtruncate)), 2, uintptr(fd), uintptr(length), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1819,7 +1805,7 @@ func Umask(mask int) (oldmask int) { func Uname(buf *Utsname) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procUname)), 1, uintptr(unsafe.Pointer(buf)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1834,7 +1820,7 @@ func Unmount(target string, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procumount)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1849,7 +1835,7 @@ func Unlink(path string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procUnlink)), 1, uintptr(unsafe.Pointer(_p0)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1864,7 +1850,7 @@ func Unlinkat(dirfd int, path string, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procUnlinkat)), 3, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1874,7 +1860,7 @@ func Unlinkat(dirfd int, path string, flags int) (err error) { func Ustat(dev int, ubuf *Ustat_t) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procUstat)), 2, uintptr(dev), uintptr(unsafe.Pointer(ubuf)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1889,7 +1875,7 @@ func Utime(path string, buf *Utimbuf) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procUtime)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(buf)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1899,7 +1885,7 @@ func Utime(path string, buf *Utimbuf) (err error) { func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_bind)), 3, uintptr(s), uintptr(addr), uintptr(addrlen), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1909,7 +1895,7 @@ func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { func connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_connect)), 3, uintptr(s), uintptr(addr), uintptr(addrlen), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1920,7 +1906,7 @@ func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) ( r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procmmap)), 6, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), uintptr(pos)) ret = uintptr(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1930,7 +1916,7 @@ func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) ( func munmap(addr uintptr, length uintptr) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procmunmap)), 2, uintptr(addr), uintptr(length), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1941,7 +1927,7 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procsendfile)), 4, uintptr(outfd), uintptr(infd), uintptr(unsafe.Pointer(offset)), uintptr(count), 0, 0) written = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1955,7 +1941,7 @@ func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) ( } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_sendto)), 6, uintptr(s), uintptr(unsafe.Pointer(_p0)), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen)) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1966,7 +1952,7 @@ func socket(domain int, typ int, proto int) (fd int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_socket)), 3, uintptr(domain), uintptr(typ), uintptr(proto), 0, 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1976,7 +1962,7 @@ func socket(domain int, typ int, proto int) (fd int, err error) { func socketpair(domain int, typ int, proto int, fd *[2]int32) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&proc__xnet_socketpair)), 4, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1991,7 +1977,7 @@ func write(fd int, p []byte) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procwrite)), 3, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2001,7 +1987,7 @@ func write(fd int, p []byte) (n int, err error) { func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_getsockopt)), 5, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2011,7 +1997,7 @@ func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procgetpeername)), 3, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2021,7 +2007,7 @@ func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { func setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procsetsockopt)), 5, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2036,7 +2022,7 @@ func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Sockl r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procrecvfrom)), 6, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen))) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2047,7 +2033,7 @@ func port_create() (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_create)), 0, 0, 0, 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2058,7 +2044,7 @@ func port_associate(port int, source int, object uintptr, events int, user *byte r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_associate)), 5, uintptr(port), uintptr(source), uintptr(object), uintptr(events), uintptr(unsafe.Pointer(user)), 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2069,7 +2055,7 @@ func port_dissociate(port int, source int, object uintptr) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_dissociate)), 3, uintptr(port), uintptr(source), uintptr(object), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2080,7 +2066,7 @@ func port_get(port int, pe *portEvent, timeout *Timespec) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_get)), 3, uintptr(port), uintptr(unsafe.Pointer(pe)), uintptr(unsafe.Pointer(timeout)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2091,7 +2077,7 @@ func port_getn(port int, pe *portEvent, max uint32, nget *uint32, timeout *Times r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_getn)), 5, uintptr(port), uintptr(unsafe.Pointer(pe)), uintptr(max), uintptr(unsafe.Pointer(nget)), uintptr(unsafe.Pointer(timeout)), 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2101,7 +2087,7 @@ func port_getn(port int, pe *portEvent, max uint32, nget *uint32, timeout *Times func putmsg(fd int, clptr *strbuf, dataptr *strbuf, flags int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procputmsg)), 4, uintptr(fd), uintptr(unsafe.Pointer(clptr)), uintptr(unsafe.Pointer(dataptr)), uintptr(flags), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2111,7 +2097,7 @@ func putmsg(fd int, clptr *strbuf, dataptr *strbuf, flags int) (err error) { func getmsg(fd int, clptr *strbuf, dataptr *strbuf, flags *int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procgetmsg)), 4, uintptr(fd), uintptr(unsafe.Pointer(clptr)), uintptr(unsafe.Pointer(dataptr)), uintptr(unsafe.Pointer(flags)), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } diff --git a/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go b/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go index 07bfe2ef9..94f011238 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build zos && s390x -// +build zos,s390x package unix @@ -40,17 +39,6 @@ func read(fd int, p []byte) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func write(fd int, p []byte) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { @@ -257,7 +245,7 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctl(fd int, req uint, arg uintptr) (err error) { +func ioctl(fd int, req int, arg uintptr) (err error) { _, _, e1 := syscall_syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { err = errnoErr(e1) @@ -267,7 +255,7 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { +func ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { err = errnoErr(e1) diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go index 55e048471..3a58ae819 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build 386 && openbsd -// +build 386,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go index d2243cf83..dcb7a0eb7 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build amd64 && openbsd -// +build amd64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go index 82dc51bd8..db5a7bf13 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build arm && openbsd -// +build arm,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go index cbdda1a4a..7be575a77 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build arm64 && openbsd -// +build arm64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_mips64.go index f55eae1a8..d6e3174c6 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build mips64 && openbsd -// +build mips64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go index e44054470..ee97157d0 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build ppc64 && openbsd -// +build ppc64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go index a0db82fce..35c3b91d0 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build riscv64 && openbsd -// +build riscv64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_darwin_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_darwin_amd64.go index f8298ff9b..5edda7687 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_darwin_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && darwin -// +build amd64,darwin package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_darwin_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_darwin_arm64.go index 5eb433bbf..0dc9e8b4d 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_darwin_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && darwin -// +build arm64,darwin package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_dragonfly_amd64.go index 703675c0c..308ddf3a1 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_dragonfly_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_dragonfly_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && dragonfly -// +build amd64,dragonfly package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go index 4e0d96107..418664e3d 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && freebsd -// +build 386,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go index 01636b838..34d0b86d7 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && freebsd -// +build amd64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go index ad99bc106..b71cf45e2 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && freebsd -// +build arm,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go index 89dcc4274..e32df1c1e 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && freebsd -// +build arm64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_riscv64.go index ee37aaa0c..15ad6111f 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && freebsd -// +build riscv64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go index c9c4ad031..fcf3ecbdd 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && linux -// +build 386,linux package unix @@ -447,4 +446,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go index 12ff3417c..f56dc2504 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && linux -// +build amd64,linux package unix @@ -369,4 +368,7 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 + SYS_MAP_SHADOW_STACK = 453 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go index c3fb5e77a..974bf2467 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && linux -// +build arm,linux package unix @@ -411,4 +410,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go index 358c847a4..39a2739e2 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && linux -// +build arm64,linux package unix @@ -314,4 +313,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go index 81c4849b1..cf9c9d77e 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build loong64 && linux -// +build loong64,linux package unix @@ -308,4 +307,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go index 202a57e90..10b7362ef 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips && linux -// +build mips,linux package unix @@ -431,4 +430,6 @@ const ( SYS_PROCESS_MRELEASE = 4448 SYS_FUTEX_WAITV = 4449 SYS_SET_MEMPOLICY_HOME_NODE = 4450 + SYS_CACHESTAT = 4451 + SYS_FCHMODAT2 = 4452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go index 1fbceb52d..cd4d8b4fd 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && linux -// +build mips64,linux package unix @@ -361,4 +360,6 @@ const ( SYS_PROCESS_MRELEASE = 5448 SYS_FUTEX_WAITV = 5449 SYS_SET_MEMPOLICY_HOME_NODE = 5450 + SYS_CACHESTAT = 5451 + SYS_FCHMODAT2 = 5452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go index b4ffb7a20..2c0efca81 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64le && linux -// +build mips64le,linux package unix @@ -361,4 +360,6 @@ const ( SYS_PROCESS_MRELEASE = 5448 SYS_FUTEX_WAITV = 5449 SYS_SET_MEMPOLICY_HOME_NODE = 5450 + SYS_CACHESTAT = 5451 + SYS_FCHMODAT2 = 5452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go index 867985f9b..a72e31d39 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mipsle && linux -// +build mipsle,linux package unix @@ -431,4 +430,6 @@ const ( SYS_PROCESS_MRELEASE = 4448 SYS_FUTEX_WAITV = 4449 SYS_SET_MEMPOLICY_HOME_NODE = 4450 + SYS_CACHESTAT = 4451 + SYS_FCHMODAT2 = 4452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go index a8cce69ed..c7d1e3747 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc && linux -// +build ppc,linux package unix @@ -438,4 +437,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go index d44c5b39d..f4d4838c8 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && linux -// +build ppc64,linux package unix @@ -410,4 +409,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go index 4214dd9c0..b64f0e591 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64le && linux -// +build ppc64le,linux package unix @@ -410,4 +409,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go index 3e594a8c0..95711195a 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && linux -// +build riscv64,linux package unix @@ -251,6 +250,8 @@ const ( SYS_ACCEPT4 = 242 SYS_RECVMMSG = 243 SYS_ARCH_SPECIFIC_SYSCALL = 244 + SYS_RISCV_HWPROBE = 258 + SYS_RISCV_FLUSH_ICACHE = 259 SYS_WAIT4 = 260 SYS_PRLIMIT64 = 261 SYS_FANOTIFY_INIT = 262 @@ -313,4 +314,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go index 7ea465204..f94e943bc 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build s390x && linux -// +build s390x,linux package unix @@ -372,7 +371,10 @@ const ( SYS_LANDLOCK_CREATE_RULESET = 444 SYS_LANDLOCK_ADD_RULE = 445 SYS_LANDLOCK_RESTRICT_SELF = 446 + SYS_MEMFD_SECRET = 447 SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go index 92f628ef4..ba0c2bc51 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build sparc64 && linux -// +build sparc64,linux package unix @@ -389,4 +388,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_386.go b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_386.go index 3a6699eba..b2aa8cd49 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && netbsd -// +build 386,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_amd64.go index 5677cd4f1..524a1b1c9 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && netbsd -// +build amd64,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm.go index e784cb6db..d59b943ac 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && netbsd -// +build arm,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm64.go index bd4952efa..31e771d53 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build arm64 && netbsd -// +build arm64,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_386.go index 597733813..9fd77c6cb 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && openbsd -// +build 386,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_amd64.go index 16af29189..af10af28c 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && openbsd -// +build amd64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm.go index f59b18a97..cc2028af4 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && openbsd -// +build arm,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go index 721ef5910..c06dd4415 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && openbsd -// +build arm64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_mips64.go index 01c43a01f..9ddbf3e08 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && openbsd -// +build mips64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go index f258cfa24..19a6ee413 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && openbsd -// +build ppc64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go index 07919e0ec..05192a782 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && openbsd -// +build riscv64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_zos_s390x.go b/vendor/golang.org/x/sys/unix/zsysnum_zos_s390x.go index 073daad43..b2e308581 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_zos_s390x.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_aix_ppc.go b/vendor/golang.org/x/sys/unix/ztypes_aix_ppc.go index 7a8161c1d..3e6d57cae 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_aix_ppc.go +++ b/vendor/golang.org/x/sys/unix/ztypes_aix_ppc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc && aix -// +build ppc,aix package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_aix_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_aix_ppc64.go index 07ed733c5..3a219bdce 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_aix_ppc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_aix_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && aix -// +build ppc64,aix package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go index e2a64f099..091d107f3 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && darwin -// +build amd64,darwin package unix @@ -151,6 +150,16 @@ type Dirent struct { _ [3]byte } +type Attrlist struct { + Bitmapcount uint16 + Reserved uint16 + Commonattr uint32 + Volattr uint32 + Dirattr uint32 + Fileattr uint32 + Forkattr uint32 +} + const ( PathMax = 0x400 ) @@ -610,6 +619,7 @@ const ( AT_REMOVEDIR = 0x80 AT_SYMLINK_FOLLOW = 0x40 AT_SYMLINK_NOFOLLOW = 0x20 + AT_EACCESS = 0x10 ) type PollFd struct { diff --git a/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go index 34aa77521..28ff4ef74 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && darwin -// +build arm64,darwin package unix @@ -151,6 +150,16 @@ type Dirent struct { _ [3]byte } +type Attrlist struct { + Bitmapcount uint16 + Reserved uint16 + Commonattr uint32 + Volattr uint32 + Dirattr uint32 + Fileattr uint32 + Forkattr uint32 +} + const ( PathMax = 0x400 ) @@ -610,6 +619,7 @@ const ( AT_REMOVEDIR = 0x80 AT_SYMLINK_FOLLOW = 0x40 AT_SYMLINK_NOFOLLOW = 0x20 + AT_EACCESS = 0x10 ) type PollFd struct { diff --git a/vendor/golang.org/x/sys/unix/ztypes_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_dragonfly_amd64.go index d0ba8e9b8..30e405bb4 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_dragonfly_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_dragonfly_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && dragonfly -// +build amd64,dragonfly package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go index 29dc48337..6cbd094a3 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && freebsd -// +build 386,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go index 0a89b2890..7c03b6ee7 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && freebsd -// +build amd64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go index c8666bb15..422107ee8 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && freebsd -// +build arm,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go index 88fb48a88..505a12acf 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && freebsd -// +build arm64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go index 698dc975e..cc986c790 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && freebsd -// +build riscv64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux.go b/vendor/golang.org/x/sys/unix/ztypes_linux.go index ca84727cf..bbf8399ff 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux.go @@ -1,7 +1,6 @@ // Code generated by mkmerge; DO NOT EDIT. //go:build linux -// +build linux package unix @@ -866,6 +865,11 @@ const ( POLLNVAL = 0x20 ) +type sigset_argpack struct { + ss *Sigset_t + ssLen uintptr +} + type SignalfdSiginfo struct { Signo uint32 Errno int32 @@ -1538,6 +1542,10 @@ const ( IFLA_GRO_MAX_SIZE = 0x3a IFLA_TSO_MAX_SIZE = 0x3b IFLA_TSO_MAX_SEGS = 0x3c + IFLA_ALLMULTI = 0x3d + IFLA_DEVLINK_PORT = 0x3e + IFLA_GSO_IPV4_MAX_SIZE = 0x3f + IFLA_GRO_IPV4_MAX_SIZE = 0x40 IFLA_PROTO_DOWN_REASON_UNSPEC = 0x0 IFLA_PROTO_DOWN_REASON_MASK = 0x1 IFLA_PROTO_DOWN_REASON_VALUE = 0x2 @@ -1968,7 +1976,7 @@ const ( NFT_MSG_GETFLOWTABLE = 0x17 NFT_MSG_DELFLOWTABLE = 0x18 NFT_MSG_GETRULE_RESET = 0x19 - NFT_MSG_MAX = 0x1a + NFT_MSG_MAX = 0x22 NFTA_LIST_UNSPEC = 0x0 NFTA_LIST_ELEM = 0x1 NFTA_HOOK_UNSPEC = 0x0 @@ -2555,6 +2563,11 @@ const ( BPF_REG_8 = 0x8 BPF_REG_9 = 0x9 BPF_REG_10 = 0xa + BPF_CGROUP_ITER_ORDER_UNSPEC = 0x0 + BPF_CGROUP_ITER_SELF_ONLY = 0x1 + BPF_CGROUP_ITER_DESCENDANTS_PRE = 0x2 + BPF_CGROUP_ITER_DESCENDANTS_POST = 0x3 + BPF_CGROUP_ITER_ANCESTORS_UP = 0x4 BPF_MAP_CREATE = 0x0 BPF_MAP_LOOKUP_ELEM = 0x1 BPF_MAP_UPDATE_ELEM = 0x2 @@ -2566,6 +2579,7 @@ const ( BPF_PROG_ATTACH = 0x8 BPF_PROG_DETACH = 0x9 BPF_PROG_TEST_RUN = 0xa + BPF_PROG_RUN = 0xa BPF_PROG_GET_NEXT_ID = 0xb BPF_MAP_GET_NEXT_ID = 0xc BPF_PROG_GET_FD_BY_ID = 0xd @@ -2610,6 +2624,7 @@ const ( BPF_MAP_TYPE_CPUMAP = 0x10 BPF_MAP_TYPE_XSKMAP = 0x11 BPF_MAP_TYPE_SOCKHASH = 0x12 + BPF_MAP_TYPE_CGROUP_STORAGE_DEPRECATED = 0x13 BPF_MAP_TYPE_CGROUP_STORAGE = 0x13 BPF_MAP_TYPE_REUSEPORT_SOCKARRAY = 0x14 BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE = 0x15 @@ -2620,6 +2635,10 @@ const ( BPF_MAP_TYPE_STRUCT_OPS = 0x1a BPF_MAP_TYPE_RINGBUF = 0x1b BPF_MAP_TYPE_INODE_STORAGE = 0x1c + BPF_MAP_TYPE_TASK_STORAGE = 0x1d + BPF_MAP_TYPE_BLOOM_FILTER = 0x1e + BPF_MAP_TYPE_USER_RINGBUF = 0x1f + BPF_MAP_TYPE_CGRP_STORAGE = 0x20 BPF_PROG_TYPE_UNSPEC = 0x0 BPF_PROG_TYPE_SOCKET_FILTER = 0x1 BPF_PROG_TYPE_KPROBE = 0x2 @@ -2651,6 +2670,8 @@ const ( BPF_PROG_TYPE_EXT = 0x1c BPF_PROG_TYPE_LSM = 0x1d BPF_PROG_TYPE_SK_LOOKUP = 0x1e + BPF_PROG_TYPE_SYSCALL = 0x1f + BPF_PROG_TYPE_NETFILTER = 0x20 BPF_CGROUP_INET_INGRESS = 0x0 BPF_CGROUP_INET_EGRESS = 0x1 BPF_CGROUP_INET_SOCK_CREATE = 0x2 @@ -2689,6 +2710,17 @@ const ( BPF_XDP_CPUMAP = 0x23 BPF_SK_LOOKUP = 0x24 BPF_XDP = 0x25 + BPF_SK_SKB_VERDICT = 0x26 + BPF_SK_REUSEPORT_SELECT = 0x27 + BPF_SK_REUSEPORT_SELECT_OR_MIGRATE = 0x28 + BPF_PERF_EVENT = 0x29 + BPF_TRACE_KPROBE_MULTI = 0x2a + BPF_LSM_CGROUP = 0x2b + BPF_STRUCT_OPS = 0x2c + BPF_NETFILTER = 0x2d + BPF_TCX_INGRESS = 0x2e + BPF_TCX_EGRESS = 0x2f + BPF_TRACE_UPROBE_MULTI = 0x30 BPF_LINK_TYPE_UNSPEC = 0x0 BPF_LINK_TYPE_RAW_TRACEPOINT = 0x1 BPF_LINK_TYPE_TRACING = 0x2 @@ -2696,6 +2728,21 @@ const ( BPF_LINK_TYPE_ITER = 0x4 BPF_LINK_TYPE_NETNS = 0x5 BPF_LINK_TYPE_XDP = 0x6 + BPF_LINK_TYPE_PERF_EVENT = 0x7 + BPF_LINK_TYPE_KPROBE_MULTI = 0x8 + BPF_LINK_TYPE_STRUCT_OPS = 0x9 + BPF_LINK_TYPE_NETFILTER = 0xa + BPF_LINK_TYPE_TCX = 0xb + BPF_LINK_TYPE_UPROBE_MULTI = 0xc + BPF_PERF_EVENT_UNSPEC = 0x0 + BPF_PERF_EVENT_UPROBE = 0x1 + BPF_PERF_EVENT_URETPROBE = 0x2 + BPF_PERF_EVENT_KPROBE = 0x3 + BPF_PERF_EVENT_KRETPROBE = 0x4 + BPF_PERF_EVENT_TRACEPOINT = 0x5 + BPF_PERF_EVENT_EVENT = 0x6 + BPF_F_KPROBE_MULTI_RETURN = 0x1 + BPF_F_UPROBE_MULTI_RETURN = 0x1 BPF_ANY = 0x0 BPF_NOEXIST = 0x1 BPF_EXIST = 0x2 @@ -2713,6 +2760,8 @@ const ( BPF_F_MMAPABLE = 0x400 BPF_F_PRESERVE_ELEMS = 0x800 BPF_F_INNER_MAP = 0x1000 + BPF_F_LINK = 0x2000 + BPF_F_PATH_FD = 0x4000 BPF_STATS_RUN_TIME = 0x0 BPF_STACK_BUILD_ID_EMPTY = 0x0 BPF_STACK_BUILD_ID_VALID = 0x1 @@ -2733,6 +2782,8 @@ const ( BPF_F_ZERO_CSUM_TX = 0x2 BPF_F_DONT_FRAGMENT = 0x4 BPF_F_SEQ_NUMBER = 0x8 + BPF_F_NO_TUNNEL_KEY = 0x10 + BPF_F_TUNINFO_FLAGS = 0x10 BPF_F_INDEX_MASK = 0xffffffff BPF_F_CURRENT_CPU = 0xffffffff BPF_F_CTXLEN_MASK = 0xfffff00000000 @@ -2747,6 +2798,9 @@ const ( BPF_F_ADJ_ROOM_ENCAP_L4_GRE = 0x8 BPF_F_ADJ_ROOM_ENCAP_L4_UDP = 0x10 BPF_F_ADJ_ROOM_NO_CSUM_RESET = 0x20 + BPF_F_ADJ_ROOM_ENCAP_L2_ETH = 0x40 + BPF_F_ADJ_ROOM_DECAP_L3_IPV4 = 0x80 + BPF_F_ADJ_ROOM_DECAP_L3_IPV6 = 0x100 BPF_ADJ_ROOM_ENCAP_L2_MASK = 0xff BPF_ADJ_ROOM_ENCAP_L2_SHIFT = 0x38 BPF_F_SYSCTL_BASE_NAME = 0x1 @@ -2771,10 +2825,16 @@ const ( BPF_LWT_ENCAP_SEG6 = 0x0 BPF_LWT_ENCAP_SEG6_INLINE = 0x1 BPF_LWT_ENCAP_IP = 0x2 + BPF_F_BPRM_SECUREEXEC = 0x1 + BPF_F_BROADCAST = 0x8 + BPF_F_EXCLUDE_INGRESS = 0x10 + BPF_SKB_TSTAMP_UNSPEC = 0x0 + BPF_SKB_TSTAMP_DELIVERY_MONO = 0x1 BPF_OK = 0x0 BPF_DROP = 0x2 BPF_REDIRECT = 0x7 BPF_LWT_REROUTE = 0x80 + BPF_FLOW_DISSECTOR_CONTINUE = 0x81 BPF_SOCK_OPS_RTO_CB_FLAG = 0x1 BPF_SOCK_OPS_RETRANS_CB_FLAG = 0x2 BPF_SOCK_OPS_STATE_CB_FLAG = 0x4 @@ -2829,6 +2889,8 @@ const ( BPF_DEVCG_DEV_CHAR = 0x2 BPF_FIB_LOOKUP_DIRECT = 0x1 BPF_FIB_LOOKUP_OUTPUT = 0x2 + BPF_FIB_LOOKUP_SKIP_NEIGH = 0x4 + BPF_FIB_LOOKUP_TBID = 0x8 BPF_FIB_LKUP_RET_SUCCESS = 0x0 BPF_FIB_LKUP_RET_BLACKHOLE = 0x1 BPF_FIB_LKUP_RET_UNREACHABLE = 0x2 @@ -2838,6 +2900,10 @@ const ( BPF_FIB_LKUP_RET_UNSUPP_LWT = 0x6 BPF_FIB_LKUP_RET_NO_NEIGH = 0x7 BPF_FIB_LKUP_RET_FRAG_NEEDED = 0x8 + BPF_MTU_CHK_SEGS = 0x1 + BPF_MTU_CHK_RET_SUCCESS = 0x0 + BPF_MTU_CHK_RET_FRAG_NEEDED = 0x1 + BPF_MTU_CHK_RET_SEGS_TOOBIG = 0x2 BPF_FD_TYPE_RAW_TRACEPOINT = 0x0 BPF_FD_TYPE_TRACEPOINT = 0x1 BPF_FD_TYPE_KPROBE = 0x2 @@ -2847,6 +2913,20 @@ const ( BPF_FLOW_DISSECTOR_F_PARSE_1ST_FRAG = 0x1 BPF_FLOW_DISSECTOR_F_STOP_AT_FLOW_LABEL = 0x2 BPF_FLOW_DISSECTOR_F_STOP_AT_ENCAP = 0x4 + BPF_CORE_FIELD_BYTE_OFFSET = 0x0 + BPF_CORE_FIELD_BYTE_SIZE = 0x1 + BPF_CORE_FIELD_EXISTS = 0x2 + BPF_CORE_FIELD_SIGNED = 0x3 + BPF_CORE_FIELD_LSHIFT_U64 = 0x4 + BPF_CORE_FIELD_RSHIFT_U64 = 0x5 + BPF_CORE_TYPE_ID_LOCAL = 0x6 + BPF_CORE_TYPE_ID_TARGET = 0x7 + BPF_CORE_TYPE_EXISTS = 0x8 + BPF_CORE_TYPE_SIZE = 0x9 + BPF_CORE_ENUMVAL_EXISTS = 0xa + BPF_CORE_ENUMVAL_VALUE = 0xb + BPF_CORE_TYPE_MATCHES = 0xc + BPF_F_TIMER_ABS = 0x1 ) const ( @@ -2925,6 +3005,12 @@ type LoopInfo64 struct { Encrypt_key [32]uint8 Init [2]uint64 } +type LoopConfig struct { + Fd uint32 + Size uint32 + Info LoopInfo64 + _ [8]uint64 +} type TIPCSocketAddr struct { Ref uint32 @@ -3605,7 +3691,7 @@ const ( ETHTOOL_MSG_PSE_GET = 0x24 ETHTOOL_MSG_PSE_SET = 0x25 ETHTOOL_MSG_RSS_GET = 0x26 - ETHTOOL_MSG_USER_MAX = 0x26 + ETHTOOL_MSG_USER_MAX = 0x2b ETHTOOL_MSG_KERNEL_NONE = 0x0 ETHTOOL_MSG_STRSET_GET_REPLY = 0x1 ETHTOOL_MSG_LINKINFO_GET_REPLY = 0x2 @@ -3645,7 +3731,7 @@ const ( ETHTOOL_MSG_MODULE_NTF = 0x24 ETHTOOL_MSG_PSE_GET_REPLY = 0x25 ETHTOOL_MSG_RSS_GET_REPLY = 0x26 - ETHTOOL_MSG_KERNEL_MAX = 0x26 + ETHTOOL_MSG_KERNEL_MAX = 0x2b ETHTOOL_A_HEADER_UNSPEC = 0x0 ETHTOOL_A_HEADER_DEV_INDEX = 0x1 ETHTOOL_A_HEADER_DEV_NAME = 0x2 @@ -3749,7 +3835,7 @@ const ( ETHTOOL_A_RINGS_TCP_DATA_SPLIT = 0xb ETHTOOL_A_RINGS_CQE_SIZE = 0xc ETHTOOL_A_RINGS_TX_PUSH = 0xd - ETHTOOL_A_RINGS_MAX = 0xd + ETHTOOL_A_RINGS_MAX = 0x10 ETHTOOL_A_CHANNELS_UNSPEC = 0x0 ETHTOOL_A_CHANNELS_HEADER = 0x1 ETHTOOL_A_CHANNELS_RX_MAX = 0x2 @@ -3787,14 +3873,14 @@ const ( ETHTOOL_A_COALESCE_RATE_SAMPLE_INTERVAL = 0x17 ETHTOOL_A_COALESCE_USE_CQE_MODE_TX = 0x18 ETHTOOL_A_COALESCE_USE_CQE_MODE_RX = 0x19 - ETHTOOL_A_COALESCE_MAX = 0x19 + ETHTOOL_A_COALESCE_MAX = 0x1c ETHTOOL_A_PAUSE_UNSPEC = 0x0 ETHTOOL_A_PAUSE_HEADER = 0x1 ETHTOOL_A_PAUSE_AUTONEG = 0x2 ETHTOOL_A_PAUSE_RX = 0x3 ETHTOOL_A_PAUSE_TX = 0x4 ETHTOOL_A_PAUSE_STATS = 0x5 - ETHTOOL_A_PAUSE_MAX = 0x5 + ETHTOOL_A_PAUSE_MAX = 0x6 ETHTOOL_A_PAUSE_STAT_UNSPEC = 0x0 ETHTOOL_A_PAUSE_STAT_PAD = 0x1 ETHTOOL_A_PAUSE_STAT_TX_FRAMES = 0x2 @@ -4444,7 +4530,7 @@ const ( NL80211_ATTR_MAC_HINT = 0xc8 NL80211_ATTR_MAC_MASK = 0xd7 NL80211_ATTR_MAX_AP_ASSOC_STA = 0xca - NL80211_ATTR_MAX = 0x141 + NL80211_ATTR_MAX = 0x146 NL80211_ATTR_MAX_CRIT_PROT_DURATION = 0xb4 NL80211_ATTR_MAX_CSA_COUNTERS = 0xce NL80211_ATTR_MAX_MATCH_SETS = 0x85 @@ -4673,7 +4759,7 @@ const ( NL80211_BAND_ATTR_HT_CAPA = 0x4 NL80211_BAND_ATTR_HT_MCS_SET = 0x3 NL80211_BAND_ATTR_IFTYPE_DATA = 0x9 - NL80211_BAND_ATTR_MAX = 0xb + NL80211_BAND_ATTR_MAX = 0xd NL80211_BAND_ATTR_RATES = 0x2 NL80211_BAND_ATTR_VHT_CAPA = 0x8 NL80211_BAND_ATTR_VHT_MCS_SET = 0x7 @@ -4814,7 +4900,7 @@ const ( NL80211_CMD_LEAVE_IBSS = 0x2c NL80211_CMD_LEAVE_MESH = 0x45 NL80211_CMD_LEAVE_OCB = 0x6d - NL80211_CMD_MAX = 0x98 + NL80211_CMD_MAX = 0x9a NL80211_CMD_MICHAEL_MIC_FAILURE = 0x29 NL80211_CMD_MODIFY_LINK_STA = 0x97 NL80211_CMD_NAN_MATCH = 0x78 @@ -5448,7 +5534,7 @@ const ( NL80211_RATE_INFO_HE_RU_ALLOC_52 = 0x1 NL80211_RATE_INFO_HE_RU_ALLOC_996 = 0x5 NL80211_RATE_INFO_HE_RU_ALLOC = 0x11 - NL80211_RATE_INFO_MAX = 0x16 + NL80211_RATE_INFO_MAX = 0x1d NL80211_RATE_INFO_MCS = 0x2 NL80211_RATE_INFO_SHORT_GI = 0x4 NL80211_RATE_INFO_VHT_MCS = 0x6 @@ -5795,6 +5881,8 @@ const ( TUN_F_TSO6 = 0x4 TUN_F_TSO_ECN = 0x8 TUN_F_UFO = 0x10 + TUN_F_USO4 = 0x20 + TUN_F_USO6 = 0x40 ) const ( @@ -5804,9 +5892,37 @@ const ( ) const ( - VIRTIO_NET_HDR_GSO_NONE = 0x0 - VIRTIO_NET_HDR_GSO_TCPV4 = 0x1 - VIRTIO_NET_HDR_GSO_UDP = 0x3 - VIRTIO_NET_HDR_GSO_TCPV6 = 0x4 - VIRTIO_NET_HDR_GSO_ECN = 0x80 + VIRTIO_NET_HDR_GSO_NONE = 0x0 + VIRTIO_NET_HDR_GSO_TCPV4 = 0x1 + VIRTIO_NET_HDR_GSO_UDP = 0x3 + VIRTIO_NET_HDR_GSO_TCPV6 = 0x4 + VIRTIO_NET_HDR_GSO_UDP_L4 = 0x5 + VIRTIO_NET_HDR_GSO_ECN = 0x80 ) + +type SchedAttr struct { + Size uint32 + Policy uint32 + Flags uint64 + Nice int32 + Priority uint32 + Runtime uint64 + Deadline uint64 + Period uint64 + Util_min uint32 + Util_max uint32 +} + +const SizeofSchedAttr = 0x38 + +type Cachestat_t struct { + Cache uint64 + Dirty uint64 + Writeback uint64 + Evicted uint64 + Recently_evicted uint64 +} +type CachestatRange struct { + Off uint64 + Len uint64 +} diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go index 4ecc1495c..438a30aff 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && linux -// +build 386,linux package unix @@ -337,6 +336,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go index 34fddff96..adceca355 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && linux -// +build amd64,linux package unix @@ -350,6 +349,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go index 3b14a6031..eeaa00a37 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && linux -// +build arm,linux package unix @@ -328,6 +327,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go index 0517651ab..6739aa91d 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && linux -// +build arm64,linux package unix @@ -329,6 +328,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go index 3b0c51813..9920ef631 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build loong64 && linux -// +build loong64,linux package unix @@ -330,6 +329,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go index fccdf4dd0..2923b799a 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips && linux -// +build mips,linux package unix @@ -333,6 +332,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go index 500de8fc0..ce2750ee4 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && linux -// +build mips64,linux package unix @@ -332,6 +331,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go index d0434cd2c..3038811d7 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64le && linux -// +build mips64le,linux package unix @@ -332,6 +331,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go index 84206ba53..efc6fed18 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mipsle && linux -// +build mipsle,linux package unix @@ -333,6 +332,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go index ab078cf1f..9a654b75a 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc && linux -// +build ppc,linux package unix @@ -340,6 +339,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go index 42eb2c4ce..40d358e33 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && linux -// +build ppc64,linux package unix @@ -339,6 +338,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go index 31304a4e8..148c6ceb8 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64le && linux -// +build ppc64le,linux package unix @@ -339,6 +338,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go index c311f9612..72ba81543 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && linux -// +build riscv64,linux package unix @@ -357,6 +356,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 @@ -716,3 +717,30 @@ type SysvShmDesc struct { _ uint64 _ uint64 } + +type RISCVHWProbePairs struct { + Key int64 + Value uint64 +} + +const ( + RISCV_HWPROBE_KEY_MVENDORID = 0x0 + RISCV_HWPROBE_KEY_MARCHID = 0x1 + RISCV_HWPROBE_KEY_MIMPID = 0x2 + RISCV_HWPROBE_KEY_BASE_BEHAVIOR = 0x3 + RISCV_HWPROBE_BASE_BEHAVIOR_IMA = 0x1 + RISCV_HWPROBE_KEY_IMA_EXT_0 = 0x4 + RISCV_HWPROBE_IMA_FD = 0x1 + RISCV_HWPROBE_IMA_C = 0x2 + RISCV_HWPROBE_IMA_V = 0x4 + RISCV_HWPROBE_EXT_ZBA = 0x8 + RISCV_HWPROBE_EXT_ZBB = 0x10 + RISCV_HWPROBE_EXT_ZBS = 0x20 + RISCV_HWPROBE_KEY_CPUPERF_0 = 0x5 + RISCV_HWPROBE_MISALIGNED_UNKNOWN = 0x0 + RISCV_HWPROBE_MISALIGNED_EMULATED = 0x1 + RISCV_HWPROBE_MISALIGNED_SLOW = 0x2 + RISCV_HWPROBE_MISALIGNED_FAST = 0x3 + RISCV_HWPROBE_MISALIGNED_UNSUPPORTED = 0x4 + RISCV_HWPROBE_MISALIGNED_MASK = 0x7 +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go index bba3cefac..71e765508 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build s390x && linux -// +build s390x,linux package unix @@ -352,6 +351,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go index ad8a01380..4abbdb9de 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build sparc64 && linux -// +build sparc64,linux package unix @@ -334,6 +333,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go index 9bc4c8f9d..f22e7947d 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && netbsd -// +build 386,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go index bb05f655d..066a7d83d 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && netbsd -// +build amd64,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go index db40e3a19..439548ec9 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && netbsd -// +build arm,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go index 11121151c..16085d3bb 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && netbsd -// +build arm64,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go index 26eba23b7..afd13a3af 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && openbsd -// +build 386,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go index 5a5479886..5d97f1f9b 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && openbsd -// +build amd64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go index be58c4e1f..34871cdc1 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && openbsd -// +build arm,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go index 52338266c..5911bceb3 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && openbsd -// +build arm64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go index 605cfdb12..e4f24f3bc 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && openbsd -// +build mips64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go index d6724c010..ca50a7930 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && openbsd -// +build ppc64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go index ddfd27a43..d7d7f7902 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && openbsd -// +build riscv64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go index 0400747c6..14160576d 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && solaris -// +build amd64,solaris package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go b/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go index aec1efcb3..54f31be63 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x // Hand edited based on ztypes_linux_s390x.go // TODO: auto-generate. diff --git a/vendor/golang.org/x/sys/windows/aliases.go b/vendor/golang.org/x/sys/windows/aliases.go index a20ebea63..ce2d713d6 100644 --- a/vendor/golang.org/x/sys/windows/aliases.go +++ b/vendor/golang.org/x/sys/windows/aliases.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build windows && go1.9 -// +build windows,go1.9 package windows diff --git a/vendor/golang.org/x/sys/windows/empty.s b/vendor/golang.org/x/sys/windows/empty.s index fdbbbcd31..ba64caca5 100644 --- a/vendor/golang.org/x/sys/windows/empty.s +++ b/vendor/golang.org/x/sys/windows/empty.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !go1.12 -// +build !go1.12 // This file is here to allow bodyless functions with go:linkname for Go 1.11 // and earlier (see https://golang.org/issue/23311). diff --git a/vendor/golang.org/x/sys/windows/env_windows.go b/vendor/golang.org/x/sys/windows/env_windows.go index 92ac05ff4..b8ad19250 100644 --- a/vendor/golang.org/x/sys/windows/env_windows.go +++ b/vendor/golang.org/x/sys/windows/env_windows.go @@ -37,14 +37,14 @@ func (token Token) Environ(inheritExisting bool) (env []string, err error) { return nil, err } defer DestroyEnvironmentBlock(block) - blockp := uintptr(unsafe.Pointer(block)) + blockp := unsafe.Pointer(block) for { - entry := UTF16PtrToString((*uint16)(unsafe.Pointer(blockp))) + entry := UTF16PtrToString((*uint16)(blockp)) if len(entry) == 0 { break } env = append(env, entry) - blockp += 2 * (uintptr(len(entry)) + 1) + blockp = unsafe.Add(blockp, 2*(len(entry)+1)) } return env, nil } diff --git a/vendor/golang.org/x/sys/windows/eventlog.go b/vendor/golang.org/x/sys/windows/eventlog.go index 2cd60645e..6c366955d 100644 --- a/vendor/golang.org/x/sys/windows/eventlog.go +++ b/vendor/golang.org/x/sys/windows/eventlog.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build windows -// +build windows package windows diff --git a/vendor/golang.org/x/sys/windows/exec_windows.go b/vendor/golang.org/x/sys/windows/exec_windows.go index 75980fd44..9cabbb694 100644 --- a/vendor/golang.org/x/sys/windows/exec_windows.go +++ b/vendor/golang.org/x/sys/windows/exec_windows.go @@ -22,7 +22,7 @@ import ( // but only if there is space or tab inside s. func EscapeArg(s string) string { if len(s) == 0 { - return "\"\"" + return `""` } n := len(s) hasSpace := false @@ -35,7 +35,7 @@ func EscapeArg(s string) string { } } if hasSpace { - n += 2 + n += 2 // Reserve space for quotes. } if n == len(s) { return s @@ -82,36 +82,106 @@ func EscapeArg(s string) string { // in CreateProcess's CommandLine argument, CreateService/ChangeServiceConfig's BinaryPathName argument, // or any program that uses CommandLineToArgv. func ComposeCommandLine(args []string) string { - var commandLine string - for i := range args { - if i > 0 { - commandLine += " " + if len(args) == 0 { + return "" + } + + // Per https://learn.microsoft.com/en-us/windows/win32/api/shellapi/nf-shellapi-commandlinetoargvw: + // “This function accepts command lines that contain a program name; the + // program name can be enclosed in quotation marks or not.” + // + // Unfortunately, it provides no means of escaping interior quotation marks + // within that program name, and we have no way to report them here. + prog := args[0] + mustQuote := len(prog) == 0 + for i := 0; i < len(prog); i++ { + c := prog[i] + if c <= ' ' || (c == '"' && i == 0) { + // Force quotes for not only the ASCII space and tab as described in the + // MSDN article, but also ASCII control characters. + // The documentation for CommandLineToArgvW doesn't say what happens when + // the first argument is not a valid program name, but it empirically + // seems to drop unquoted control characters. + mustQuote = true + break + } + } + var commandLine []byte + if mustQuote { + commandLine = make([]byte, 0, len(prog)+2) + commandLine = append(commandLine, '"') + for i := 0; i < len(prog); i++ { + c := prog[i] + if c == '"' { + // This quote would interfere with our surrounding quotes. + // We have no way to report an error, so just strip out + // the offending character instead. + continue + } + commandLine = append(commandLine, c) + } + commandLine = append(commandLine, '"') + } else { + if len(args) == 1 { + // args[0] is a valid command line representing itself. + // No need to allocate a new slice or string for it. + return prog } - commandLine += EscapeArg(args[i]) + commandLine = []byte(prog) } - return commandLine + + for _, arg := range args[1:] { + commandLine = append(commandLine, ' ') + // TODO(bcmills): since we're already appending to a slice, it would be nice + // to avoid the intermediate allocations of EscapeArg. + // Perhaps we can factor out an appendEscapedArg function. + commandLine = append(commandLine, EscapeArg(arg)...) + } + return string(commandLine) } // DecomposeCommandLine breaks apart its argument command line into unescaped parts using CommandLineToArgv, // as gathered from GetCommandLine, QUERY_SERVICE_CONFIG's BinaryPathName argument, or elsewhere that // command lines are passed around. +// DecomposeCommandLine returns an error if commandLine contains NUL. func DecomposeCommandLine(commandLine string) ([]string, error) { if len(commandLine) == 0 { return []string{}, nil } + utf16CommandLine, err := UTF16FromString(commandLine) + if err != nil { + return nil, errorspkg.New("string with NUL passed to DecomposeCommandLine") + } var argc int32 - argv, err := CommandLineToArgv(StringToUTF16Ptr(commandLine), &argc) + argv, err := commandLineToArgv(&utf16CommandLine[0], &argc) if err != nil { return nil, err } defer LocalFree(Handle(unsafe.Pointer(argv))) + var args []string - for _, v := range (*argv)[:argc] { - args = append(args, UTF16ToString((*v)[:])) + for _, p := range unsafe.Slice(argv, argc) { + args = append(args, UTF16PtrToString(p)) } return args, nil } +// CommandLineToArgv parses a Unicode command line string and sets +// argc to the number of parsed arguments. +// +// The returned memory should be freed using a single call to LocalFree. +// +// Note that although the return type of CommandLineToArgv indicates 8192 +// entries of up to 8192 characters each, the actual count of parsed arguments +// may exceed 8192, and the documentation for CommandLineToArgvW does not mention +// any bound on the lengths of the individual argument strings. +// (See https://go.dev/issue/63236.) +func CommandLineToArgv(cmd *uint16, argc *int32) (argv *[8192]*[8192]uint16, err error) { + argp, err := commandLineToArgv(cmd, argc) + argv = (*[8192]*[8192]uint16)(unsafe.Pointer(argp)) + return argv, err +} + func CloseOnExec(fd Handle) { SetHandleInformation(Handle(fd), HANDLE_FLAG_INHERIT, 0) } diff --git a/vendor/golang.org/x/sys/windows/mksyscall.go b/vendor/golang.org/x/sys/windows/mksyscall.go index 8563f79c5..dbcdb090c 100644 --- a/vendor/golang.org/x/sys/windows/mksyscall.go +++ b/vendor/golang.org/x/sys/windows/mksyscall.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build generate -// +build generate package windows diff --git a/vendor/golang.org/x/sys/windows/race.go b/vendor/golang.org/x/sys/windows/race.go index 9196b089c..0f1bdc386 100644 --- a/vendor/golang.org/x/sys/windows/race.go +++ b/vendor/golang.org/x/sys/windows/race.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build windows && race -// +build windows,race package windows diff --git a/vendor/golang.org/x/sys/windows/race0.go b/vendor/golang.org/x/sys/windows/race0.go index 7bae4817a..0c78da78b 100644 --- a/vendor/golang.org/x/sys/windows/race0.go +++ b/vendor/golang.org/x/sys/windows/race0.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build windows && !race -// +build windows,!race package windows diff --git a/vendor/golang.org/x/sys/windows/security_windows.go b/vendor/golang.org/x/sys/windows/security_windows.go index d414ef13b..26be94a8a 100644 --- a/vendor/golang.org/x/sys/windows/security_windows.go +++ b/vendor/golang.org/x/sys/windows/security_windows.go @@ -7,8 +7,6 @@ package windows import ( "syscall" "unsafe" - - "golang.org/x/sys/internal/unsafeheader" ) const ( @@ -1341,21 +1339,14 @@ func (selfRelativeSD *SECURITY_DESCRIPTOR) copySelfRelativeSecurityDescriptor() sdLen = min } - var src []byte - h := (*unsafeheader.Slice)(unsafe.Pointer(&src)) - h.Data = unsafe.Pointer(selfRelativeSD) - h.Len = sdLen - h.Cap = sdLen - + src := unsafe.Slice((*byte)(unsafe.Pointer(selfRelativeSD)), sdLen) + // SECURITY_DESCRIPTOR has pointers in it, which means checkptr expects for it to + // be aligned properly. When we're copying a Windows-allocated struct to a + // Go-allocated one, make sure that the Go allocation is aligned to the + // pointer size. const psize = int(unsafe.Sizeof(uintptr(0))) - - var dst []byte - h = (*unsafeheader.Slice)(unsafe.Pointer(&dst)) alloc := make([]uintptr, (sdLen+psize-1)/psize) - h.Data = (*unsafeheader.Slice)(unsafe.Pointer(&alloc)).Data - h.Len = sdLen - h.Cap = sdLen - + dst := unsafe.Slice((*byte)(unsafe.Pointer(&alloc[0])), sdLen) copy(dst, src) return (*SECURITY_DESCRIPTOR)(unsafe.Pointer(&dst[0])) } diff --git a/vendor/golang.org/x/sys/windows/service.go b/vendor/golang.org/x/sys/windows/service.go index f8deca839..a9dc6308d 100644 --- a/vendor/golang.org/x/sys/windows/service.go +++ b/vendor/golang.org/x/sys/windows/service.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build windows -// +build windows package windows @@ -141,6 +140,12 @@ const ( SERVICE_DYNAMIC_INFORMATION_LEVEL_START_REASON = 1 ) +type ENUM_SERVICE_STATUS struct { + ServiceName *uint16 + DisplayName *uint16 + ServiceStatus SERVICE_STATUS +} + type SERVICE_STATUS struct { ServiceType uint32 CurrentState uint32 @@ -212,6 +217,10 @@ type SERVICE_FAILURE_ACTIONS struct { Actions *SC_ACTION } +type SERVICE_FAILURE_ACTIONS_FLAG struct { + FailureActionsOnNonCrashFailures int32 +} + type SC_ACTION struct { Type uint32 Delay uint32 @@ -245,3 +254,4 @@ type QUERY_SERVICE_LOCK_STATUS struct { //sys UnsubscribeServiceChangeNotifications(subscription uintptr) = sechost.UnsubscribeServiceChangeNotifications? //sys RegisterServiceCtrlHandlerEx(serviceName *uint16, handlerProc uintptr, context uintptr) (handle Handle, err error) = advapi32.RegisterServiceCtrlHandlerExW //sys QueryServiceDynamicInformation(service Handle, infoLevel uint32, dynamicInfo unsafe.Pointer) (err error) = advapi32.QueryServiceDynamicInformation? +//sys EnumDependentServices(service Handle, activityState uint32, services *ENUM_SERVICE_STATUS, buffSize uint32, bytesNeeded *uint32, servicesReturned *uint32) (err error) = advapi32.EnumDependentServicesW diff --git a/vendor/golang.org/x/sys/windows/str.go b/vendor/golang.org/x/sys/windows/str.go index 4fc01434e..6a4f9ce6a 100644 --- a/vendor/golang.org/x/sys/windows/str.go +++ b/vendor/golang.org/x/sys/windows/str.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build windows -// +build windows package windows diff --git a/vendor/golang.org/x/sys/windows/syscall.go b/vendor/golang.org/x/sys/windows/syscall.go index 8732cdb95..e85ed6b9c 100644 --- a/vendor/golang.org/x/sys/windows/syscall.go +++ b/vendor/golang.org/x/sys/windows/syscall.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build windows -// +build windows // Package windows contains an interface to the low-level operating system // primitives. OS details vary depending on the underlying system, and diff --git a/vendor/golang.org/x/sys/windows/syscall_windows.go b/vendor/golang.org/x/sys/windows/syscall_windows.go index 3723b2c22..47dc57967 100644 --- a/vendor/golang.org/x/sys/windows/syscall_windows.go +++ b/vendor/golang.org/x/sys/windows/syscall_windows.go @@ -15,8 +15,6 @@ import ( "time" "unicode/utf16" "unsafe" - - "golang.org/x/sys/internal/unsafeheader" ) type Handle uintptr @@ -135,14 +133,14 @@ func Getpagesize() int { return 4096 } // NewCallback converts a Go function to a function pointer conforming to the stdcall calling convention. // This is useful when interoperating with Windows code requiring callbacks. -// The argument is expected to be a function with with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. +// The argument is expected to be a function with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. func NewCallback(fn interface{}) uintptr { return syscall.NewCallback(fn) } // NewCallbackCDecl converts a Go function to a function pointer conforming to the cdecl calling convention. // This is useful when interoperating with Windows code requiring callbacks. -// The argument is expected to be a function with with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. +// The argument is expected to be a function with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. func NewCallbackCDecl(fn interface{}) uintptr { return syscall.NewCallbackCDecl(fn) } @@ -157,6 +155,8 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys GetModuleFileName(module Handle, filename *uint16, size uint32) (n uint32, err error) = kernel32.GetModuleFileNameW //sys GetModuleHandleEx(flags uint32, moduleName *uint16, module *Handle) (err error) = kernel32.GetModuleHandleExW //sys SetDefaultDllDirectories(directoryFlags uint32) (err error) +//sys AddDllDirectory(path *uint16) (cookie uintptr, err error) = kernel32.AddDllDirectory +//sys RemoveDllDirectory(cookie uintptr) (err error) = kernel32.RemoveDllDirectory //sys SetDllDirectory(path string) (err error) = kernel32.SetDllDirectoryW //sys GetVersion() (ver uint32, err error) //sys FormatMessage(flags uint32, msgsrc uintptr, msgid uint32, langid uint32, buf []uint16, args *byte) (n uint32, err error) = FormatMessageW @@ -216,7 +216,7 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys shGetKnownFolderPath(id *KNOWNFOLDERID, flags uint32, token Token, path **uint16) (ret error) = shell32.SHGetKnownFolderPath //sys TerminateProcess(handle Handle, exitcode uint32) (err error) //sys GetExitCodeProcess(handle Handle, exitcode *uint32) (err error) -//sys GetStartupInfo(startupInfo *StartupInfo) (err error) = GetStartupInfoW +//sys getStartupInfo(startupInfo *StartupInfo) = GetStartupInfoW //sys GetProcessTimes(handle Handle, creationTime *Filetime, exitTime *Filetime, kernelTime *Filetime, userTime *Filetime) (err error) //sys DuplicateHandle(hSourceProcessHandle Handle, hSourceHandle Handle, hTargetProcessHandle Handle, lpTargetHandle *Handle, dwDesiredAccess uint32, bInheritHandle bool, dwOptions uint32) (err error) //sys WaitForSingleObject(handle Handle, waitMilliseconds uint32) (event uint32, err error) [failretval==0xffffffff] @@ -235,12 +235,13 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys CreateEnvironmentBlock(block **uint16, token Token, inheritExisting bool) (err error) = userenv.CreateEnvironmentBlock //sys DestroyEnvironmentBlock(block *uint16) (err error) = userenv.DestroyEnvironmentBlock //sys getTickCount64() (ms uint64) = kernel32.GetTickCount64 +//sys GetFileTime(handle Handle, ctime *Filetime, atime *Filetime, wtime *Filetime) (err error) //sys SetFileTime(handle Handle, ctime *Filetime, atime *Filetime, wtime *Filetime) (err error) //sys GetFileAttributes(name *uint16) (attrs uint32, err error) [failretval==INVALID_FILE_ATTRIBUTES] = kernel32.GetFileAttributesW //sys SetFileAttributes(name *uint16, attrs uint32) (err error) = kernel32.SetFileAttributesW //sys GetFileAttributesEx(name *uint16, level uint32, info *byte) (err error) = kernel32.GetFileAttributesExW //sys GetCommandLine() (cmd *uint16) = kernel32.GetCommandLineW -//sys CommandLineToArgv(cmd *uint16, argc *int32) (argv *[8192]*[8192]uint16, err error) [failretval==nil] = shell32.CommandLineToArgvW +//sys commandLineToArgv(cmd *uint16, argc *int32) (argv **uint16, err error) [failretval==nil] = shell32.CommandLineToArgvW //sys LocalFree(hmem Handle) (handle Handle, err error) [failretval!=0] //sys LocalAlloc(flags uint32, length uint32) (ptr uintptr, err error) //sys SetHandleInformation(handle Handle, mask uint32, flags uint32) (err error) @@ -299,12 +300,15 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys RegNotifyChangeKeyValue(key Handle, watchSubtree bool, notifyFilter uint32, event Handle, asynchronous bool) (regerrno error) = advapi32.RegNotifyChangeKeyValue //sys GetCurrentProcessId() (pid uint32) = kernel32.GetCurrentProcessId //sys ProcessIdToSessionId(pid uint32, sessionid *uint32) (err error) = kernel32.ProcessIdToSessionId +//sys ClosePseudoConsole(console Handle) = kernel32.ClosePseudoConsole +//sys createPseudoConsole(size uint32, in Handle, out Handle, flags uint32, pconsole *Handle) (hr error) = kernel32.CreatePseudoConsole //sys GetConsoleMode(console Handle, mode *uint32) (err error) = kernel32.GetConsoleMode //sys SetConsoleMode(console Handle, mode uint32) (err error) = kernel32.SetConsoleMode //sys GetConsoleScreenBufferInfo(console Handle, info *ConsoleScreenBufferInfo) (err error) = kernel32.GetConsoleScreenBufferInfo //sys setConsoleCursorPosition(console Handle, position uint32) (err error) = kernel32.SetConsoleCursorPosition //sys WriteConsole(console Handle, buf *uint16, towrite uint32, written *uint32, reserved *byte) (err error) = kernel32.WriteConsoleW //sys ReadConsole(console Handle, buf *uint16, toread uint32, read *uint32, inputControl *byte) (err error) = kernel32.ReadConsoleW +//sys resizePseudoConsole(pconsole Handle, size uint32) (hr error) = kernel32.ResizePseudoConsole //sys CreateToolhelp32Snapshot(flags uint32, processId uint32) (handle Handle, err error) [failretval==InvalidHandle] = kernel32.CreateToolhelp32Snapshot //sys Module32First(snapshot Handle, moduleEntry *ModuleEntry32) (err error) = kernel32.Module32FirstW //sys Module32Next(snapshot Handle, moduleEntry *ModuleEntry32) (err error) = kernel32.Module32NextW @@ -405,7 +409,7 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys VerQueryValue(block unsafe.Pointer, subBlock string, pointerToBufferPointer unsafe.Pointer, bufSize *uint32) (err error) = version.VerQueryValueW // Process Status API (PSAPI) -//sys EnumProcesses(processIds []uint32, bytesReturned *uint32) (err error) = psapi.EnumProcesses +//sys enumProcesses(processIds *uint32, nSize uint32, bytesReturned *uint32) (err error) = psapi.EnumProcesses //sys EnumProcessModules(process Handle, module *Handle, cb uint32, cbNeeded *uint32) (err error) = psapi.EnumProcessModules //sys EnumProcessModulesEx(process Handle, module *Handle, cb uint32, cbNeeded *uint32, filterFlag uint32) (err error) = psapi.EnumProcessModulesEx //sys GetModuleInformation(process Handle, module Handle, modinfo *ModuleInfo, cb uint32) (err error) = psapi.GetModuleInformation @@ -437,6 +441,10 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys DwmGetWindowAttribute(hwnd HWND, attribute uint32, value unsafe.Pointer, size uint32) (ret error) = dwmapi.DwmGetWindowAttribute //sys DwmSetWindowAttribute(hwnd HWND, attribute uint32, value unsafe.Pointer, size uint32) (ret error) = dwmapi.DwmSetWindowAttribute +// Windows Multimedia API +//sys TimeBeginPeriod (period uint32) (err error) [failretval != 0] = winmm.timeBeginPeriod +//sys TimeEndPeriod (period uint32) (err error) [failretval != 0] = winmm.timeEndPeriod + // syscall interface implementation for other packages // GetCurrentProcess returns the handle for the current process. @@ -964,7 +972,8 @@ func (sa *SockaddrUnix) sockaddr() (unsafe.Pointer, int32, error) { if n > 0 { sl += int32(n) + 1 } - if sa.raw.Path[0] == '@' { + if sa.raw.Path[0] == '@' || (sa.raw.Path[0] == 0 && sl > 3) { + // Check sl > 3 so we don't change unnamed socket behavior. sa.raw.Path[0] = 0 // Don't count trailing NUL for abstract address. sl-- @@ -1354,6 +1363,17 @@ func SetsockoptIPv6Mreq(fd Handle, level, opt int, mreq *IPv6Mreq) (err error) { return syscall.EWINDOWS } +func EnumProcesses(processIds []uint32, bytesReturned *uint32) error { + // EnumProcesses syscall expects the size parameter to be in bytes, but the code generated with mksyscall uses + // the length of the processIds slice instead. Hence, this wrapper function is added to fix the discrepancy. + var p *uint32 + if len(processIds) > 0 { + p = &processIds[0] + } + size := uint32(len(processIds) * 4) + return enumProcesses(p, size, bytesReturned) +} + func Getpid() (pid int) { return int(GetCurrentProcessId()) } func FindFirstFile(name *uint16, data *Win32finddata) (handle Handle, err error) { @@ -1613,6 +1633,11 @@ func SetConsoleCursorPosition(console Handle, position Coord) error { return setConsoleCursorPosition(console, *((*uint32)(unsafe.Pointer(&position)))) } +func GetStartupInfo(startupInfo *StartupInfo) error { + getStartupInfo(startupInfo) + return nil +} + func (s NTStatus) Errno() syscall.Errno { return rtlNtStatusToDosErrorNoTeb(s) } @@ -1647,12 +1672,8 @@ func NewNTUnicodeString(s string) (*NTUnicodeString, error) { // Slice returns a uint16 slice that aliases the data in the NTUnicodeString. func (s *NTUnicodeString) Slice() []uint16 { - var slice []uint16 - hdr := (*unsafeheader.Slice)(unsafe.Pointer(&slice)) - hdr.Data = unsafe.Pointer(s.Buffer) - hdr.Len = int(s.Length) - hdr.Cap = int(s.MaximumLength) - return slice + slice := unsafe.Slice(s.Buffer, s.MaximumLength) + return slice[:s.Length] } func (s *NTUnicodeString) String() string { @@ -1675,12 +1696,8 @@ func NewNTString(s string) (*NTString, error) { // Slice returns a byte slice that aliases the data in the NTString. func (s *NTString) Slice() []byte { - var slice []byte - hdr := (*unsafeheader.Slice)(unsafe.Pointer(&slice)) - hdr.Data = unsafe.Pointer(s.Buffer) - hdr.Len = int(s.Length) - hdr.Cap = int(s.MaximumLength) - return slice + slice := unsafe.Slice(s.Buffer, s.MaximumLength) + return slice[:s.Length] } func (s *NTString) String() string { @@ -1732,10 +1749,7 @@ func LoadResourceData(module, resInfo Handle) (data []byte, err error) { if err != nil { return } - h := (*unsafeheader.Slice)(unsafe.Pointer(&data)) - h.Data = unsafe.Pointer(ptr) - h.Len = int(size) - h.Cap = int(size) + data = unsafe.Slice((*byte)(unsafe.Pointer(ptr)), size) return } @@ -1806,3 +1820,17 @@ type PSAPI_WORKING_SET_EX_INFORMATION struct { // A PSAPI_WORKING_SET_EX_BLOCK union that indicates the attributes of the page at VirtualAddress. VirtualAttributes PSAPI_WORKING_SET_EX_BLOCK } + +// CreatePseudoConsole creates a windows pseudo console. +func CreatePseudoConsole(size Coord, in Handle, out Handle, flags uint32, pconsole *Handle) error { + // We need this wrapper to manually cast Coord to uint32. The autogenerated wrappers only + // accept arguments that can be casted to uintptr, and Coord can't. + return createPseudoConsole(*((*uint32)(unsafe.Pointer(&size))), in, out, flags, pconsole) +} + +// ResizePseudoConsole resizes the internal buffers of the pseudo console to the width and height specified in `size`. +func ResizePseudoConsole(pconsole Handle, size Coord) error { + // We need this wrapper to manually cast Coord to uint32. The autogenerated wrappers only + // accept arguments that can be casted to uintptr, and Coord can't. + return resizePseudoConsole(pconsole, *((*uint32)(unsafe.Pointer(&size)))) +} diff --git a/vendor/golang.org/x/sys/windows/types_windows.go b/vendor/golang.org/x/sys/windows/types_windows.go index 857acf103..359780f6a 100644 --- a/vendor/golang.org/x/sys/windows/types_windows.go +++ b/vendor/golang.org/x/sys/windows/types_windows.go @@ -247,6 +247,7 @@ const ( PROC_THREAD_ATTRIBUTE_MITIGATION_POLICY = 0x00020007 PROC_THREAD_ATTRIBUTE_UMS_THREAD = 0x00030006 PROC_THREAD_ATTRIBUTE_PROTECTION_LEVEL = 0x0002000b + PROC_THREAD_ATTRIBUTE_PSEUDOCONSOLE = 0x00020016 ) const ( @@ -1093,7 +1094,33 @@ const ( SOMAXCONN = 0x7fffffff - TCP_NODELAY = 1 + TCP_NODELAY = 1 + TCP_EXPEDITED_1122 = 2 + TCP_KEEPALIVE = 3 + TCP_MAXSEG = 4 + TCP_MAXRT = 5 + TCP_STDURG = 6 + TCP_NOURG = 7 + TCP_ATMARK = 8 + TCP_NOSYNRETRIES = 9 + TCP_TIMESTAMPS = 10 + TCP_OFFLOAD_PREFERENCE = 11 + TCP_CONGESTION_ALGORITHM = 12 + TCP_DELAY_FIN_ACK = 13 + TCP_MAXRTMS = 14 + TCP_FASTOPEN = 15 + TCP_KEEPCNT = 16 + TCP_KEEPIDLE = TCP_KEEPALIVE + TCP_KEEPINTVL = 17 + TCP_FAIL_CONNECT_ON_ICMP_ERROR = 18 + TCP_ICMP_ERROR_INFO = 19 + + UDP_NOCHECKSUM = 1 + UDP_SEND_MSG_SIZE = 2 + UDP_RECV_MAX_COALESCED_SIZE = 3 + UDP_CHECKSUM_COVERAGE = 20 + + UDP_COALESCED_INFO = 3 SHUT_RD = 0 SHUT_WR = 1 @@ -2139,6 +2166,12 @@ const ( ENABLE_LVB_GRID_WORLDWIDE = 0x10 ) +// Pseudo console related constants used for the flags parameter to +// CreatePseudoConsole. See: https://learn.microsoft.com/en-us/windows/console/createpseudoconsole +const ( + PSEUDOCONSOLE_INHERIT_CURSOR = 0x1 +) + type Coord struct { X int16 Y int16 @@ -2220,19 +2253,23 @@ type JOBOBJECT_BASIC_UI_RESTRICTIONS struct { } const ( - // JobObjectInformationClass + // JobObjectInformationClass for QueryInformationJobObject and SetInformationJobObject JobObjectAssociateCompletionPortInformation = 7 + JobObjectBasicAccountingInformation = 1 + JobObjectBasicAndIoAccountingInformation = 8 JobObjectBasicLimitInformation = 2 + JobObjectBasicProcessIdList = 3 JobObjectBasicUIRestrictions = 4 JobObjectCpuRateControlInformation = 15 JobObjectEndOfJobTimeInformation = 6 JobObjectExtendedLimitInformation = 9 JobObjectGroupInformation = 11 JobObjectGroupInformationEx = 14 - JobObjectLimitViolationInformation2 = 35 + JobObjectLimitViolationInformation = 13 + JobObjectLimitViolationInformation2 = 34 JobObjectNetRateControlInformation = 32 JobObjectNotificationLimitInformation = 12 - JobObjectNotificationLimitInformation2 = 34 + JobObjectNotificationLimitInformation2 = 33 JobObjectSecurityLimitInformation = 5 ) diff --git a/vendor/golang.org/x/sys/windows/zsyscall_windows.go b/vendor/golang.org/x/sys/windows/zsyscall_windows.go index 6d2a26853..146a1f019 100644 --- a/vendor/golang.org/x/sys/windows/zsyscall_windows.go +++ b/vendor/golang.org/x/sys/windows/zsyscall_windows.go @@ -55,6 +55,7 @@ var ( moduser32 = NewLazySystemDLL("user32.dll") moduserenv = NewLazySystemDLL("userenv.dll") modversion = NewLazySystemDLL("version.dll") + modwinmm = NewLazySystemDLL("winmm.dll") modwintrust = NewLazySystemDLL("wintrust.dll") modws2_32 = NewLazySystemDLL("ws2_32.dll") modwtsapi32 = NewLazySystemDLL("wtsapi32.dll") @@ -86,6 +87,7 @@ var ( procDeleteService = modadvapi32.NewProc("DeleteService") procDeregisterEventSource = modadvapi32.NewProc("DeregisterEventSource") procDuplicateTokenEx = modadvapi32.NewProc("DuplicateTokenEx") + procEnumDependentServicesW = modadvapi32.NewProc("EnumDependentServicesW") procEnumServicesStatusExW = modadvapi32.NewProc("EnumServicesStatusExW") procEqualSid = modadvapi32.NewProc("EqualSid") procFreeSid = modadvapi32.NewProc("FreeSid") @@ -182,10 +184,12 @@ var ( procGetAdaptersInfo = modiphlpapi.NewProc("GetAdaptersInfo") procGetBestInterfaceEx = modiphlpapi.NewProc("GetBestInterfaceEx") procGetIfEntry = modiphlpapi.NewProc("GetIfEntry") + procAddDllDirectory = modkernel32.NewProc("AddDllDirectory") procAssignProcessToJobObject = modkernel32.NewProc("AssignProcessToJobObject") procCancelIo = modkernel32.NewProc("CancelIo") procCancelIoEx = modkernel32.NewProc("CancelIoEx") procCloseHandle = modkernel32.NewProc("CloseHandle") + procClosePseudoConsole = modkernel32.NewProc("ClosePseudoConsole") procConnectNamedPipe = modkernel32.NewProc("ConnectNamedPipe") procCreateDirectoryW = modkernel32.NewProc("CreateDirectoryW") procCreateEventExW = modkernel32.NewProc("CreateEventExW") @@ -200,6 +204,7 @@ var ( procCreateNamedPipeW = modkernel32.NewProc("CreateNamedPipeW") procCreatePipe = modkernel32.NewProc("CreatePipe") procCreateProcessW = modkernel32.NewProc("CreateProcessW") + procCreatePseudoConsole = modkernel32.NewProc("CreatePseudoConsole") procCreateSymbolicLinkW = modkernel32.NewProc("CreateSymbolicLinkW") procCreateToolhelp32Snapshot = modkernel32.NewProc("CreateToolhelp32Snapshot") procDefineDosDeviceW = modkernel32.NewProc("DefineDosDeviceW") @@ -249,6 +254,7 @@ var ( procGetFileAttributesW = modkernel32.NewProc("GetFileAttributesW") procGetFileInformationByHandle = modkernel32.NewProc("GetFileInformationByHandle") procGetFileInformationByHandleEx = modkernel32.NewProc("GetFileInformationByHandleEx") + procGetFileTime = modkernel32.NewProc("GetFileTime") procGetFileType = modkernel32.NewProc("GetFileType") procGetFinalPathNameByHandleW = modkernel32.NewProc("GetFinalPathNameByHandleW") procGetFullPathNameW = modkernel32.NewProc("GetFullPathNameW") @@ -325,7 +331,9 @@ var ( procReadProcessMemory = modkernel32.NewProc("ReadProcessMemory") procReleaseMutex = modkernel32.NewProc("ReleaseMutex") procRemoveDirectoryW = modkernel32.NewProc("RemoveDirectoryW") + procRemoveDllDirectory = modkernel32.NewProc("RemoveDllDirectory") procResetEvent = modkernel32.NewProc("ResetEvent") + procResizePseudoConsole = modkernel32.NewProc("ResizePseudoConsole") procResumeThread = modkernel32.NewProc("ResumeThread") procSetCommTimeouts = modkernel32.NewProc("SetCommTimeouts") procSetConsoleCursorPosition = modkernel32.NewProc("SetConsoleCursorPosition") @@ -467,6 +475,8 @@ var ( procGetFileVersionInfoSizeW = modversion.NewProc("GetFileVersionInfoSizeW") procGetFileVersionInfoW = modversion.NewProc("GetFileVersionInfoW") procVerQueryValueW = modversion.NewProc("VerQueryValueW") + proctimeBeginPeriod = modwinmm.NewProc("timeBeginPeriod") + proctimeEndPeriod = modwinmm.NewProc("timeEndPeriod") procWinVerifyTrustEx = modwintrust.NewProc("WinVerifyTrustEx") procFreeAddrInfoW = modws2_32.NewProc("FreeAddrInfoW") procGetAddrInfoW = modws2_32.NewProc("GetAddrInfoW") @@ -734,6 +744,14 @@ func DuplicateTokenEx(existingToken Token, desiredAccess uint32, tokenAttributes return } +func EnumDependentServices(service Handle, activityState uint32, services *ENUM_SERVICE_STATUS, buffSize uint32, bytesNeeded *uint32, servicesReturned *uint32) (err error) { + r1, _, e1 := syscall.Syscall6(procEnumDependentServicesW.Addr(), 6, uintptr(service), uintptr(activityState), uintptr(unsafe.Pointer(services)), uintptr(buffSize), uintptr(unsafe.Pointer(bytesNeeded)), uintptr(unsafe.Pointer(servicesReturned))) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func EnumServicesStatusEx(mgr Handle, infoLevel uint32, serviceType uint32, serviceState uint32, services *byte, bufSize uint32, bytesNeeded *uint32, servicesReturned *uint32, resumeHandle *uint32, groupName *uint16) (err error) { r1, _, e1 := syscall.Syscall12(procEnumServicesStatusExW.Addr(), 10, uintptr(mgr), uintptr(infoLevel), uintptr(serviceType), uintptr(serviceState), uintptr(unsafe.Pointer(services)), uintptr(bufSize), uintptr(unsafe.Pointer(bytesNeeded)), uintptr(unsafe.Pointer(servicesReturned)), uintptr(unsafe.Pointer(resumeHandle)), uintptr(unsafe.Pointer(groupName)), 0, 0) if r1 == 0 { @@ -1589,6 +1607,15 @@ func GetIfEntry(pIfRow *MibIfRow) (errcode error) { return } +func AddDllDirectory(path *uint16) (cookie uintptr, err error) { + r0, _, e1 := syscall.Syscall(procAddDllDirectory.Addr(), 1, uintptr(unsafe.Pointer(path)), 0, 0) + cookie = uintptr(r0) + if cookie == 0 { + err = errnoErr(e1) + } + return +} + func AssignProcessToJobObject(job Handle, process Handle) (err error) { r1, _, e1 := syscall.Syscall(procAssignProcessToJobObject.Addr(), 2, uintptr(job), uintptr(process), 0) if r1 == 0 { @@ -1621,6 +1648,11 @@ func CloseHandle(handle Handle) (err error) { return } +func ClosePseudoConsole(console Handle) { + syscall.Syscall(procClosePseudoConsole.Addr(), 1, uintptr(console), 0, 0) + return +} + func ConnectNamedPipe(pipe Handle, overlapped *Overlapped) (err error) { r1, _, e1 := syscall.Syscall(procConnectNamedPipe.Addr(), 2, uintptr(pipe), uintptr(unsafe.Pointer(overlapped)), 0) if r1 == 0 { @@ -1750,6 +1782,14 @@ func CreateProcess(appName *uint16, commandLine *uint16, procSecurity *SecurityA return } +func createPseudoConsole(size uint32, in Handle, out Handle, flags uint32, pconsole *Handle) (hr error) { + r0, _, _ := syscall.Syscall6(procCreatePseudoConsole.Addr(), 5, uintptr(size), uintptr(in), uintptr(out), uintptr(flags), uintptr(unsafe.Pointer(pconsole)), 0) + if r0 != 0 { + hr = syscall.Errno(r0) + } + return +} + func CreateSymbolicLink(symlinkfilename *uint16, targetfilename *uint16, flags uint32) (err error) { r1, _, e1 := syscall.Syscall(procCreateSymbolicLinkW.Addr(), 3, uintptr(unsafe.Pointer(symlinkfilename)), uintptr(unsafe.Pointer(targetfilename)), uintptr(flags)) if r1&0xff == 0 { @@ -2157,6 +2197,14 @@ func GetFileInformationByHandleEx(handle Handle, class uint32, outBuffer *byte, return } +func GetFileTime(handle Handle, ctime *Filetime, atime *Filetime, wtime *Filetime) (err error) { + r1, _, e1 := syscall.Syscall6(procGetFileTime.Addr(), 4, uintptr(handle), uintptr(unsafe.Pointer(ctime)), uintptr(unsafe.Pointer(atime)), uintptr(unsafe.Pointer(wtime)), 0, 0) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func GetFileType(filehandle Handle) (n uint32, err error) { r0, _, e1 := syscall.Syscall(procGetFileType.Addr(), 1, uintptr(filehandle), 0, 0) n = uint32(r0) @@ -2358,11 +2406,8 @@ func GetShortPathName(longpath *uint16, shortpath *uint16, buflen uint32) (n uin return } -func GetStartupInfo(startupInfo *StartupInfo) (err error) { - r1, _, e1 := syscall.Syscall(procGetStartupInfoW.Addr(), 1, uintptr(unsafe.Pointer(startupInfo)), 0, 0) - if r1 == 0 { - err = errnoErr(e1) - } +func getStartupInfo(startupInfo *StartupInfo) { + syscall.Syscall(procGetStartupInfoW.Addr(), 1, uintptr(unsafe.Pointer(startupInfo)), 0, 0) return } @@ -2845,6 +2890,14 @@ func RemoveDirectory(path *uint16) (err error) { return } +func RemoveDllDirectory(cookie uintptr) (err error) { + r1, _, e1 := syscall.Syscall(procRemoveDllDirectory.Addr(), 1, uintptr(cookie), 0, 0) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func ResetEvent(event Handle) (err error) { r1, _, e1 := syscall.Syscall(procResetEvent.Addr(), 1, uintptr(event), 0, 0) if r1 == 0 { @@ -2853,6 +2906,14 @@ func ResetEvent(event Handle) (err error) { return } +func resizePseudoConsole(pconsole Handle, size uint32) (hr error) { + r0, _, _ := syscall.Syscall(procResizePseudoConsole.Addr(), 2, uintptr(pconsole), uintptr(size), 0) + if r0 != 0 { + hr = syscall.Errno(r0) + } + return +} + func ResumeThread(thread Handle) (ret uint32, err error) { r0, _, e1 := syscall.Syscall(procResumeThread.Addr(), 1, uintptr(thread), 0, 0) ret = uint32(r0) @@ -3507,12 +3568,8 @@ func EnumProcessModulesEx(process Handle, module *Handle, cb uint32, cbNeeded *u return } -func EnumProcesses(processIds []uint32, bytesReturned *uint32) (err error) { - var _p0 *uint32 - if len(processIds) > 0 { - _p0 = &processIds[0] - } - r1, _, e1 := syscall.Syscall(procEnumProcesses.Addr(), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(processIds)), uintptr(unsafe.Pointer(bytesReturned))) +func enumProcesses(processIds *uint32, nSize uint32, bytesReturned *uint32) (err error) { + r1, _, e1 := syscall.Syscall(procEnumProcesses.Addr(), 3, uintptr(unsafe.Pointer(processIds)), uintptr(nSize), uintptr(unsafe.Pointer(bytesReturned))) if r1 == 0 { err = errnoErr(e1) } @@ -3815,9 +3872,9 @@ func setupUninstallOEMInf(infFileName *uint16, flags SUOI, reserved uintptr) (er return } -func CommandLineToArgv(cmd *uint16, argc *int32) (argv *[8192]*[8192]uint16, err error) { +func commandLineToArgv(cmd *uint16, argc *int32) (argv **uint16, err error) { r0, _, e1 := syscall.Syscall(procCommandLineToArgvW.Addr(), 2, uintptr(unsafe.Pointer(cmd)), uintptr(unsafe.Pointer(argc)), 0) - argv = (*[8192]*[8192]uint16)(unsafe.Pointer(r0)) + argv = (**uint16)(unsafe.Pointer(r0)) if argv == nil { err = errnoErr(e1) } @@ -4012,6 +4069,22 @@ func _VerQueryValue(block unsafe.Pointer, subBlock *uint16, pointerToBufferPoint return } +func TimeBeginPeriod(period uint32) (err error) { + r1, _, e1 := syscall.Syscall(proctimeBeginPeriod.Addr(), 1, uintptr(period), 0, 0) + if r1 != 0 { + err = errnoErr(e1) + } + return +} + +func TimeEndPeriod(period uint32) (err error) { + r1, _, e1 := syscall.Syscall(proctimeEndPeriod.Addr(), 1, uintptr(period), 0, 0) + if r1 != 0 { + err = errnoErr(e1) + } + return +} + func WinVerifyTrustEx(hwnd HWND, actionId *GUID, data *WinTrustData) (ret error) { r0, _, _ := syscall.Syscall(procWinVerifyTrustEx.Addr(), 3, uintptr(hwnd), uintptr(unsafe.Pointer(actionId)), uintptr(unsafe.Pointer(data))) if r0 != 0 { diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go index 32af9de59..a09ed198a 100644 --- a/vendor/golang.org/x/text/internal/language/compact/tables.go +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -790,226 +790,226 @@ const ( var coreTags = []language.CompactCoreInfo{ // 773 elements // Entry 0 - 1F - 0x00000000, 0x01600000, 0x016000d2, 0x01600161, - 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, - 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, - 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, - 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, - 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, - 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, - 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + 0x00000000, 0x01600000, 0x016000d3, 0x01600162, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100081, + 0x02700000, 0x02700070, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068, + 0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098, + 0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad, + 0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca, + 0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109, // Entry 20 - 3F - 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, - 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, - 0x04300000, 0x04300099, 0x04400000, 0x0440012f, - 0x04800000, 0x0480006e, 0x05800000, 0x05820000, - 0x05820032, 0x0585a000, 0x0585a032, 0x05e00000, + 0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d, + 0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000, + 0x04300000, 0x0430009a, 0x04400000, 0x04400130, + 0x04800000, 0x0480006f, 0x05800000, 0x05820000, + 0x05820032, 0x0585b000, 0x0585b032, 0x05e00000, 0x05e00052, 0x07100000, 0x07100047, 0x07500000, - 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, - 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + 0x07500163, 0x07900000, 0x07900130, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4, // Entry 40 - 5F - 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, - 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, - 0x0b500000, 0x0b500099, 0x0b700000, 0x0b720000, - 0x0b720033, 0x0b75a000, 0x0b75a033, 0x0d700000, - 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, - 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, - 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, - 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + 0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000, + 0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079, + 0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000, + 0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000, + 0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f, + 0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000, + 0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000, + 0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d, // Entry 60 - 7F - 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, - 0x10000000, 0x1000007b, 0x10100000, 0x10100063, - 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, - 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, - 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, - 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, - 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, - 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + 0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107, + 0x10000000, 0x1000007c, 0x10100000, 0x10100064, + 0x10100083, 0x10800000, 0x108000a5, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061, + 0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000, + 0x117000d5, 0x11f00000, 0x11f00061, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00115, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5, // Entry 80 - 9F - 0x13000000, 0x13000080, 0x13000122, 0x13600000, - 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x13000000, 0x13000081, 0x13000123, 0x13600000, + 0x1360005e, 0x13600088, 0x13900000, 0x13900001, 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, - 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, - 0x13900060, 0x13900061, 0x13900063, 0x13900064, + 0x13900050, 0x13900052, 0x1390005d, 0x1390005e, + 0x13900061, 0x13900062, 0x13900064, 0x13900065, // Entry A0 - BF - 0x1390006d, 0x13900072, 0x13900073, 0x13900074, - 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, - 0x13900080, 0x13900081, 0x13900083, 0x1390008a, - 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, - 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, - 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, - 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, - 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + 0x1390006e, 0x13900073, 0x13900074, 0x13900075, + 0x13900076, 0x1390007c, 0x1390007d, 0x13900080, + 0x13900081, 0x13900082, 0x13900084, 0x1390008b, + 0x1390008d, 0x1390008e, 0x13900097, 0x13900098, + 0x13900099, 0x1390009a, 0x1390009b, 0x139000a0, + 0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa, + 0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6, + 0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8, // Entry C0 - DF - 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, - 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, - 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, - 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, - 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, - 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, - 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, - 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + 0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf, + 0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7, + 0x139000da, 0x139000de, 0x139000e0, 0x139000e1, + 0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec, + 0x139000ed, 0x139000f1, 0x13900108, 0x1390010a, + 0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e, + 0x1390010f, 0x13900110, 0x13900113, 0x13900118, + 0x1390011c, 0x1390011e, 0x13900120, 0x13900126, // Entry E0 - FF - 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, - 0x13900131, 0x13900133, 0x13900135, 0x13900139, - 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, - 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x1390012a, 0x1390012d, 0x1390012e, 0x13900130, + 0x13900132, 0x13900134, 0x13900136, 0x1390013a, + 0x1390013d, 0x1390013e, 0x13900140, 0x13900143, + 0x13900162, 0x13900163, 0x13900165, 0x13c00000, 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, - 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, - 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + 0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066, + 0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087, // Entry 100 - 11F - 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, - 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, - 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, - 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, - 0x14500000, 0x1450006e, 0x14600000, 0x14600052, - 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, - 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, - 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + 0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0, + 0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8, + 0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136, + 0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b, + 0x14500000, 0x1450006f, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009d, 0x14e00000, + 0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115, + 0x15100000, 0x15100073, 0x15300000, 0x153000e8, // Entry 120 - 13F - 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15800000, 0x15800064, 0x15800077, 0x15e00000, 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, - 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, - 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, - 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, - 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + 0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b, + 0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087, + 0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb, + 0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4, // Entry 140 - 15F - 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, - 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, - 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, - 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, - 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, - 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, - 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, - 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + 0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4, + 0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103, + 0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d, + 0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140, + 0x15e00141, 0x15e00160, 0x16900000, 0x1690009f, + 0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097, + 0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f, + 0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3, // Entry 160 - 17F - 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, - 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, - 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, - 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, - 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, - 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, - 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, - 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + 0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000, + 0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000, + 0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000, + 0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000, + 0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091, + 0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096, + 0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053, // Entry 180 - 19F - 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, - 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, - 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, - 0x200000a2, 0x20300000, 0x20700000, 0x20700052, - 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, - 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, - 0x21200067, 0x21600000, 0x21700000, 0x217000a4, - 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e, + 0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114, + 0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a3, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a00130, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007e, 0x21200000, + 0x21200068, 0x21600000, 0x21700000, 0x217000a5, + 0x21f00000, 0x22300000, 0x22300130, 0x22700000, // Entry 1A0 - 1BF - 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, - 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, - 0x24400052, 0x24500000, 0x24500082, 0x24600000, - 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, - 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, - 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, - 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, - 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + 0x2270005b, 0x23400000, 0x234000c4, 0x23900000, + 0x239000a5, 0x24200000, 0x242000af, 0x24400000, + 0x24400052, 0x24500000, 0x24500083, 0x24600000, + 0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000, + 0x2510009a, 0x25400000, 0x254000ab, 0x254000ac, + 0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a, + 0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00061, 0x27400000, 0x28100000, // Entry 1C0 - 1DF - 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, - 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, - 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000, + 0x29100130, 0x29500000, 0x295000b8, 0x2a300000, + 0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000, 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, - 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, - 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, - 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, - 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + 0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c, + 0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000, + 0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000, // Entry 1E0 - 1FF - 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, - 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, - 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, - 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, - 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, - 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, - 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, - 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + 0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5, + 0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0, + 0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a, + 0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000, + 0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1, + 0x31f0010e, 0x32000000, 0x320000cc, 0x32500000, + 0x32500052, 0x33100000, 0x331000c5, 0x33a00000, // Entry 200 - 21F - 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, - 0x34700000, 0x347000da, 0x34700110, 0x34e00000, - 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, - 0x35100000, 0x35100099, 0x351000db, 0x36700000, - 0x36700030, 0x36700036, 0x36700040, 0x3670005b, - 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, - 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x33a0009d, 0x34100000, 0x34500000, 0x345000d3, + 0x34700000, 0x347000db, 0x34700111, 0x34e00000, + 0x34e00165, 0x35000000, 0x35000061, 0x350000da, + 0x35100000, 0x3510009a, 0x351000dc, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005c, + 0x367000da, 0x36700117, 0x3670011c, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000db, 0x36c00000, 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, // Entry 220 - 23F - 0x37a00000, 0x38000000, 0x38000117, 0x38700000, - 0x38900000, 0x38900131, 0x39000000, 0x3900006f, - 0x390000a4, 0x39500000, 0x39500099, 0x39800000, - 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, - 0x39d050e8, 0x39d36000, 0x39d36099, 0x3a100000, - 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x37a00000, 0x38000000, 0x38000118, 0x38700000, + 0x38900000, 0x38900132, 0x39000000, 0x39000070, + 0x390000a5, 0x39500000, 0x3950009a, 0x39800000, + 0x3980007e, 0x39800107, 0x39d00000, 0x39d05000, + 0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000, + 0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001, 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, - 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + 0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087, // Entry 240 - 25F - 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, - 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, - 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2, + 0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000, + 0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000, 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, - 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, - 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, - 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, - 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + 0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130, + 0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af, + 0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000, + 0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000, // Entry 260 - 27F - 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, - 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, - 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, - 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000, + 0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000, + 0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d, + 0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4, 0x40200000, 0x4020004c, 0x40700000, 0x40800000, - 0x4085a000, 0x4085a0ba, 0x408e8000, 0x408e80ba, - 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, - 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + 0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb, + 0x40c00000, 0x40c000b4, 0x41200000, 0x41200112, + 0x41600000, 0x41600110, 0x41c00000, 0x41d00000, // Entry 280 - 29F - 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, - 0x42300000, 0x42300164, 0x42900000, 0x42900062, - 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, - 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, - 0x43220000, 0x43220033, 0x432200bd, 0x43220105, - 0x4322014d, 0x4325a000, 0x4325a033, 0x4325a0bd, - 0x4325a105, 0x4325a14d, 0x43700000, 0x43a00000, - 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + 0x41e00000, 0x41f00000, 0x41f00073, 0x42200000, + 0x42300000, 0x42300165, 0x42900000, 0x42900063, + 0x42900070, 0x429000a5, 0x42900116, 0x43100000, + 0x43100027, 0x431000c3, 0x4310014e, 0x43200000, + 0x43220000, 0x43220033, 0x432200be, 0x43220106, + 0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be, + 0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400073, // Entry 2A0 - 2BF - 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, - 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, - 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, - 0x46100000, 0x46100099, 0x46400000, 0x464000a4, - 0x46400131, 0x46700000, 0x46700124, 0x46b00000, - 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, - 0x47100000, 0x47600000, 0x47600127, 0x47a00000, - 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + 0x4440010d, 0x44500000, 0x4450004b, 0x445000a5, + 0x44500130, 0x44500132, 0x44e00000, 0x45000000, + 0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e, + 0x46100000, 0x4610009a, 0x46400000, 0x464000a5, + 0x46400132, 0x46700000, 0x46700125, 0x46b00000, + 0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070, + 0x47100000, 0x47600000, 0x47600128, 0x47a00000, + 0x48000000, 0x48200000, 0x4820012a, 0x48a00000, // Entry 2C0 - 2DF - 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, - 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, - 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, - 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000, + 0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000, + 0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9, 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, - 0x4bc20137, 0x4bc5a000, 0x4bc5a137, 0x4be00000, - 0x4be5a000, 0x4be5a0b4, 0x4bef1000, 0x4bef10b4, - 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + 0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000, + 0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5, + 0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000, // Entry 2E0 - 2FF - 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, - 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, - 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115, + 0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000, 0x50900052, 0x51200000, 0x51200001, 0x51800000, - 0x5180003b, 0x518000d6, 0x51f00000, 0x51f3b000, - 0x51f3b053, 0x51f3c000, 0x51f3c08d, 0x52800000, - 0x528000ba, 0x52900000, 0x5293b000, 0x5293b053, - 0x5293b08d, 0x5293b0c6, 0x5293b10d, 0x5293c000, + 0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000, + 0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000, + 0x528000bb, 0x52900000, 0x5293b000, 0x5293b053, + 0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000, // Entry 300 - 31F - 0x5293c08d, 0x5293c0c6, 0x5293c12e, 0x52f00000, - 0x52f00161, + 0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000, + 0x52f00162, } // Size: 3116 bytes const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" -// Total table size 3147 bytes (3KiB); checksum: 6772C83C +// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5 diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go index fb6b58378..14167e74e 100644 --- a/vendor/golang.org/x/text/internal/language/tables.go +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -7,11 +7,11 @@ import "golang.org/x/text/internal/tag" // CLDRVersion is the CLDR version from which the tables in this package are derived. const CLDRVersion = "32" -const NumLanguages = 8752 +const NumLanguages = 8798 -const NumScripts = 258 +const NumScripts = 261 -const NumRegions = 357 +const NumRegions = 358 type FromTo struct { From uint16 @@ -263,7 +263,7 @@ var langNoIndex = [2197]uint8{ 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72, 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, @@ -278,7 +278,7 @@ var langNoIndex = [2197]uint8{ 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x6f, 0xff, 0xff, + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff, 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, @@ -289,11 +289,11 @@ var langNoIndex = [2197]uint8{ // Entry C0 - FF 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, - 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7b, 0xf3, 0xef, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef, 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03, 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, // Entry 100 - 13F 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, @@ -303,20 +303,20 @@ var langNoIndex = [2197]uint8{ 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + 0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb, // Entry 140 - 17F 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, - 0x03, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06, 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05, 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, // Entry 180 - 1BF 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, @@ -337,7 +337,7 @@ var langNoIndex = [2197]uint8{ 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, - 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01, 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, // Entry 240 - 27F @@ -359,13 +359,13 @@ var langNoIndex = [2197]uint8{ 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9, 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08, 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, // Entry 300 - 33F 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, @@ -392,14 +392,14 @@ var langNoIndex = [2197]uint8{ 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f, 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, // Entry 3C0 - 3FF 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, - 0x40, 0x54, 0x9f, 0x8a, 0xdb, 0xf9, 0x2e, 0x11, - 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x01, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20, + 0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03, 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, @@ -424,12 +424,12 @@ var langNoIndex = [2197]uint8{ // Entry 480 - 4BF 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x05, 0xc5, 0x05, + 0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05, 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, + 0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, // Entry 4C0 - 4FF 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, @@ -441,7 +441,7 @@ var langNoIndex = [2197]uint8{ 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, // Entry 500 - 53F 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7, 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, @@ -449,7 +449,7 @@ var langNoIndex = [2197]uint8{ 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, @@ -464,13 +464,13 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81, 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02, 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, @@ -491,20 +491,20 @@ var langNoIndex = [2197]uint8{ 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9, 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, // Entry 680 - 6BF 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x04, 0x1d, 0x73, 0x7f, 0xf8, 0xda, + 0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda, 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06, 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, // Entry 6C0 - 6FF - 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, - 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, + 0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -513,7 +513,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, // Entry 700 - 73F 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01, 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, @@ -522,7 +522,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 740 - 77F 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46, 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, @@ -530,12 +530,12 @@ var langNoIndex = [2197]uint8{ 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0, 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40, 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, // Entry 7C0 - 7FF @@ -545,11 +545,11 @@ var langNoIndex = [2197]uint8{ 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01, 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, // Entry 800 - 83F 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1, 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, @@ -557,11 +557,11 @@ var langNoIndex = [2197]uint8{ 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x81, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x14, 0xf1, + 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1, 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, @@ -583,8 +583,8 @@ var altLangIndex = [6]uint16{ } // AliasMap maps langIDs to their suggested replacements. -// Size: 716 bytes, 179 elements -var AliasMap = [179]FromTo{ +// Size: 772 bytes, 193 elements +var AliasMap = [193]FromTo{ 0: {From: 0x82, To: 0x88}, 1: {From: 0x187, To: 0x1ae}, 2: {From: 0x1f3, To: 0x1e1}, @@ -599,223 +599,239 @@ var AliasMap = [179]FromTo{ 11: {From: 0x4a2, To: 0x21}, 12: {From: 0x53e, To: 0x544}, 13: {From: 0x58f, To: 0x12d}, - 14: {From: 0x630, To: 0x1eb1}, - 15: {From: 0x651, To: 0x431}, - 16: {From: 0x662, To: 0x431}, - 17: {From: 0x6ed, To: 0x3a}, - 18: {From: 0x6f8, To: 0x1d7}, - 19: {From: 0x709, To: 0x3625}, - 20: {From: 0x73e, To: 0x21a1}, - 21: {From: 0x7b3, To: 0x56}, - 22: {From: 0x7b9, To: 0x299b}, - 23: {From: 0x7c5, To: 0x58}, - 24: {From: 0x7e6, To: 0x145}, - 25: {From: 0x80c, To: 0x5a}, - 26: {From: 0x815, To: 0x8d}, - 27: {From: 0x87e, To: 0x810}, - 28: {From: 0x8a8, To: 0x8b7}, - 29: {From: 0x8c3, To: 0xee3}, - 30: {From: 0x8fa, To: 0x1dc}, - 31: {From: 0x9ef, To: 0x331}, - 32: {From: 0xa36, To: 0x2c5}, - 33: {From: 0xa3d, To: 0xbf}, - 34: {From: 0xabe, To: 0x3322}, - 35: {From: 0xb38, To: 0x529}, - 36: {From: 0xb75, To: 0x265a}, - 37: {From: 0xb7e, To: 0xbc3}, - 38: {From: 0xb9b, To: 0x44e}, - 39: {From: 0xbbc, To: 0x4229}, - 40: {From: 0xbbf, To: 0x529}, - 41: {From: 0xbfe, To: 0x2da7}, - 42: {From: 0xc2e, To: 0x3181}, - 43: {From: 0xcb9, To: 0xf3}, - 44: {From: 0xd08, To: 0xfa}, - 45: {From: 0xdc8, To: 0x11a}, - 46: {From: 0xdd7, To: 0x32d}, - 47: {From: 0xdf8, To: 0xdfb}, - 48: {From: 0xdfe, To: 0x531}, - 49: {From: 0xe01, To: 0xdf3}, - 50: {From: 0xedf, To: 0x205a}, - 51: {From: 0xee9, To: 0x222e}, - 52: {From: 0xeee, To: 0x2e9a}, - 53: {From: 0xf39, To: 0x367}, - 54: {From: 0x10d0, To: 0x140}, - 55: {From: 0x1104, To: 0x2d0}, - 56: {From: 0x11a0, To: 0x1ec}, - 57: {From: 0x1279, To: 0x21}, - 58: {From: 0x1424, To: 0x15e}, - 59: {From: 0x1470, To: 0x14e}, - 60: {From: 0x151f, To: 0xd9b}, - 61: {From: 0x1523, To: 0x390}, - 62: {From: 0x1532, To: 0x19f}, - 63: {From: 0x1580, To: 0x210}, - 64: {From: 0x1583, To: 0x10d}, - 65: {From: 0x15a3, To: 0x3caf}, - 66: {From: 0x1630, To: 0x222e}, - 67: {From: 0x166a, To: 0x19b}, - 68: {From: 0x16c8, To: 0x136}, - 69: {From: 0x1700, To: 0x29f8}, - 70: {From: 0x1718, To: 0x194}, - 71: {From: 0x1727, To: 0xf3f}, - 72: {From: 0x177a, To: 0x178}, - 73: {From: 0x1809, To: 0x17b6}, - 74: {From: 0x1816, To: 0x18f3}, - 75: {From: 0x188a, To: 0x436}, - 76: {From: 0x1979, To: 0x1d01}, - 77: {From: 0x1a74, To: 0x2bb0}, - 78: {From: 0x1a8a, To: 0x1f8}, - 79: {From: 0x1b5a, To: 0x1fa}, - 80: {From: 0x1b86, To: 0x1515}, - 81: {From: 0x1d64, To: 0x2c9b}, - 82: {From: 0x2038, To: 0x37b1}, - 83: {From: 0x203d, To: 0x20dd}, - 84: {From: 0x205a, To: 0x30b}, - 85: {From: 0x20e3, To: 0x274}, - 86: {From: 0x20ee, To: 0x263}, - 87: {From: 0x20f2, To: 0x22d}, - 88: {From: 0x20f9, To: 0x256}, - 89: {From: 0x210f, To: 0x21eb}, - 90: {From: 0x2135, To: 0x27d}, - 91: {From: 0x2160, To: 0x913}, - 92: {From: 0x2199, To: 0x121}, - 93: {From: 0x21ce, To: 0x1561}, - 94: {From: 0x21e6, To: 0x504}, - 95: {From: 0x21f4, To: 0x49f}, - 96: {From: 0x21fb, To: 0x269}, - 97: {From: 0x222d, To: 0x121}, - 98: {From: 0x2237, To: 0x121}, - 99: {From: 0x2262, To: 0x92a}, - 100: {From: 0x2316, To: 0x3226}, - 101: {From: 0x236a, To: 0x2835}, - 102: {From: 0x2382, To: 0x3365}, - 103: {From: 0x2472, To: 0x2c7}, - 104: {From: 0x24e4, To: 0x2ff}, - 105: {From: 0x24f0, To: 0x2fa}, - 106: {From: 0x24fa, To: 0x31f}, - 107: {From: 0x2550, To: 0xb5b}, - 108: {From: 0x25a9, To: 0xe2}, - 109: {From: 0x263e, To: 0x2d0}, - 110: {From: 0x26c9, To: 0x26b4}, - 111: {From: 0x26f9, To: 0x3c8}, - 112: {From: 0x2727, To: 0x3caf}, - 113: {From: 0x2755, To: 0x6a4}, - 114: {From: 0x2765, To: 0x26b4}, - 115: {From: 0x2789, To: 0x4358}, - 116: {From: 0x27c9, To: 0x2001}, - 117: {From: 0x28ea, To: 0x27b1}, - 118: {From: 0x28ef, To: 0x2837}, - 119: {From: 0x2914, To: 0x351}, - 120: {From: 0x2986, To: 0x2da7}, - 121: {From: 0x29f0, To: 0x96b}, - 122: {From: 0x2b1a, To: 0x38d}, - 123: {From: 0x2bfc, To: 0x395}, - 124: {From: 0x2c3f, To: 0x3caf}, - 125: {From: 0x2ce1, To: 0x2201}, - 126: {From: 0x2cfc, To: 0x3be}, - 127: {From: 0x2d13, To: 0x597}, - 128: {From: 0x2d47, To: 0x148}, - 129: {From: 0x2d48, To: 0x148}, - 130: {From: 0x2dff, To: 0x2f1}, - 131: {From: 0x2e08, To: 0x19cc}, - 132: {From: 0x2e1a, To: 0x2d95}, - 133: {From: 0x2e21, To: 0x292}, - 134: {From: 0x2e54, To: 0x7d}, - 135: {From: 0x2e65, To: 0x2282}, - 136: {From: 0x2ea0, To: 0x2e9b}, - 137: {From: 0x2eef, To: 0x2ed7}, - 138: {From: 0x3193, To: 0x3c4}, - 139: {From: 0x3366, To: 0x338e}, - 140: {From: 0x342a, To: 0x3dc}, - 141: {From: 0x34ee, To: 0x18d0}, - 142: {From: 0x35c8, To: 0x2c9b}, - 143: {From: 0x35e6, To: 0x412}, - 144: {From: 0x3658, To: 0x246}, - 145: {From: 0x3676, To: 0x3f4}, - 146: {From: 0x36fd, To: 0x445}, - 147: {From: 0x37c0, To: 0x121}, - 148: {From: 0x3816, To: 0x38f2}, - 149: {From: 0x382a, To: 0x2b48}, - 150: {From: 0x382b, To: 0x2c9b}, - 151: {From: 0x382f, To: 0xa9}, - 152: {From: 0x3832, To: 0x3228}, - 153: {From: 0x386c, To: 0x39a6}, - 154: {From: 0x3892, To: 0x3fc0}, - 155: {From: 0x38a5, To: 0x39d7}, - 156: {From: 0x38b4, To: 0x1fa4}, - 157: {From: 0x38b5, To: 0x2e9a}, - 158: {From: 0x395c, To: 0x47e}, - 159: {From: 0x3b4e, To: 0xd91}, - 160: {From: 0x3b78, To: 0x137}, - 161: {From: 0x3c99, To: 0x4bc}, - 162: {From: 0x3fbd, To: 0x100}, - 163: {From: 0x4208, To: 0xa91}, - 164: {From: 0x42be, To: 0x573}, - 165: {From: 0x42f9, To: 0x3f60}, - 166: {From: 0x4378, To: 0x25a}, - 167: {From: 0x43b8, To: 0xe6c}, - 168: {From: 0x43cd, To: 0x10f}, - 169: {From: 0x44af, To: 0x3322}, - 170: {From: 0x44e3, To: 0x512}, - 171: {From: 0x45ca, To: 0x2409}, - 172: {From: 0x45dd, To: 0x26dc}, - 173: {From: 0x4610, To: 0x48ae}, - 174: {From: 0x46ae, To: 0x46a0}, - 175: {From: 0x473e, To: 0x4745}, - 176: {From: 0x4817, To: 0x3503}, - 177: {From: 0x4916, To: 0x31f}, - 178: {From: 0x49a7, To: 0x523}, + 14: {From: 0x62b, To: 0x34}, + 15: {From: 0x62f, To: 0x14}, + 16: {From: 0x630, To: 0x1eb1}, + 17: {From: 0x651, To: 0x431}, + 18: {From: 0x662, To: 0x431}, + 19: {From: 0x6ed, To: 0x3a}, + 20: {From: 0x6f8, To: 0x1d7}, + 21: {From: 0x709, To: 0x3625}, + 22: {From: 0x73e, To: 0x21a1}, + 23: {From: 0x7b3, To: 0x56}, + 24: {From: 0x7b9, To: 0x299b}, + 25: {From: 0x7c5, To: 0x58}, + 26: {From: 0x7e6, To: 0x145}, + 27: {From: 0x80c, To: 0x5a}, + 28: {From: 0x815, To: 0x8d}, + 29: {From: 0x87e, To: 0x810}, + 30: {From: 0x8a8, To: 0x8b7}, + 31: {From: 0x8c3, To: 0xee3}, + 32: {From: 0x8fa, To: 0x1dc}, + 33: {From: 0x9ef, To: 0x331}, + 34: {From: 0xa36, To: 0x2c5}, + 35: {From: 0xa3d, To: 0xbf}, + 36: {From: 0xabe, To: 0x3322}, + 37: {From: 0xb38, To: 0x529}, + 38: {From: 0xb75, To: 0x265a}, + 39: {From: 0xb7e, To: 0xbc3}, + 40: {From: 0xb9b, To: 0x44e}, + 41: {From: 0xbbc, To: 0x4229}, + 42: {From: 0xbbf, To: 0x529}, + 43: {From: 0xbfe, To: 0x2da7}, + 44: {From: 0xc2e, To: 0x3181}, + 45: {From: 0xcb9, To: 0xf3}, + 46: {From: 0xd08, To: 0xfa}, + 47: {From: 0xdc8, To: 0x11a}, + 48: {From: 0xdd7, To: 0x32d}, + 49: {From: 0xdf8, To: 0xdfb}, + 50: {From: 0xdfe, To: 0x531}, + 51: {From: 0xe01, To: 0xdf3}, + 52: {From: 0xedf, To: 0x205a}, + 53: {From: 0xee9, To: 0x222e}, + 54: {From: 0xeee, To: 0x2e9a}, + 55: {From: 0xf39, To: 0x367}, + 56: {From: 0x10d0, To: 0x140}, + 57: {From: 0x1104, To: 0x2d0}, + 58: {From: 0x11a0, To: 0x1ec}, + 59: {From: 0x1279, To: 0x21}, + 60: {From: 0x1424, To: 0x15e}, + 61: {From: 0x1470, To: 0x14e}, + 62: {From: 0x151f, To: 0xd9b}, + 63: {From: 0x1523, To: 0x390}, + 64: {From: 0x1532, To: 0x19f}, + 65: {From: 0x1580, To: 0x210}, + 66: {From: 0x1583, To: 0x10d}, + 67: {From: 0x15a3, To: 0x3caf}, + 68: {From: 0x1630, To: 0x222e}, + 69: {From: 0x166a, To: 0x19b}, + 70: {From: 0x16c8, To: 0x136}, + 71: {From: 0x1700, To: 0x29f8}, + 72: {From: 0x1718, To: 0x194}, + 73: {From: 0x1727, To: 0xf3f}, + 74: {From: 0x177a, To: 0x178}, + 75: {From: 0x1809, To: 0x17b6}, + 76: {From: 0x1816, To: 0x18f3}, + 77: {From: 0x188a, To: 0x436}, + 78: {From: 0x1979, To: 0x1d01}, + 79: {From: 0x1a74, To: 0x2bb0}, + 80: {From: 0x1a8a, To: 0x1f8}, + 81: {From: 0x1b5a, To: 0x1fa}, + 82: {From: 0x1b86, To: 0x1515}, + 83: {From: 0x1d64, To: 0x2c9b}, + 84: {From: 0x2038, To: 0x37b1}, + 85: {From: 0x203d, To: 0x20dd}, + 86: {From: 0x2042, To: 0x2e00}, + 87: {From: 0x205a, To: 0x30b}, + 88: {From: 0x20e3, To: 0x274}, + 89: {From: 0x20ee, To: 0x263}, + 90: {From: 0x20f2, To: 0x22d}, + 91: {From: 0x20f9, To: 0x256}, + 92: {From: 0x210f, To: 0x21eb}, + 93: {From: 0x2135, To: 0x27d}, + 94: {From: 0x2160, To: 0x913}, + 95: {From: 0x2199, To: 0x121}, + 96: {From: 0x21ce, To: 0x1561}, + 97: {From: 0x21e6, To: 0x504}, + 98: {From: 0x21f4, To: 0x49f}, + 99: {From: 0x21fb, To: 0x269}, + 100: {From: 0x222d, To: 0x121}, + 101: {From: 0x2237, To: 0x121}, + 102: {From: 0x2248, To: 0x217d}, + 103: {From: 0x2262, To: 0x92a}, + 104: {From: 0x2316, To: 0x3226}, + 105: {From: 0x236a, To: 0x2835}, + 106: {From: 0x2382, To: 0x3365}, + 107: {From: 0x2472, To: 0x2c7}, + 108: {From: 0x24e4, To: 0x2ff}, + 109: {From: 0x24f0, To: 0x2fa}, + 110: {From: 0x24fa, To: 0x31f}, + 111: {From: 0x2550, To: 0xb5b}, + 112: {From: 0x25a9, To: 0xe2}, + 113: {From: 0x263e, To: 0x2d0}, + 114: {From: 0x26c9, To: 0x26b4}, + 115: {From: 0x26f9, To: 0x3c8}, + 116: {From: 0x2727, To: 0x3caf}, + 117: {From: 0x2755, To: 0x6a4}, + 118: {From: 0x2765, To: 0x26b4}, + 119: {From: 0x2789, To: 0x4358}, + 120: {From: 0x27c9, To: 0x2001}, + 121: {From: 0x28ea, To: 0x27b1}, + 122: {From: 0x28ef, To: 0x2837}, + 123: {From: 0x28fe, To: 0xaa5}, + 124: {From: 0x2914, To: 0x351}, + 125: {From: 0x2986, To: 0x2da7}, + 126: {From: 0x29f0, To: 0x96b}, + 127: {From: 0x2b1a, To: 0x38d}, + 128: {From: 0x2bfc, To: 0x395}, + 129: {From: 0x2c3f, To: 0x3caf}, + 130: {From: 0x2ce1, To: 0x2201}, + 131: {From: 0x2cfc, To: 0x3be}, + 132: {From: 0x2d13, To: 0x597}, + 133: {From: 0x2d47, To: 0x148}, + 134: {From: 0x2d48, To: 0x148}, + 135: {From: 0x2dff, To: 0x2f1}, + 136: {From: 0x2e08, To: 0x19cc}, + 137: {From: 0x2e10, To: 0xc45}, + 138: {From: 0x2e1a, To: 0x2d95}, + 139: {From: 0x2e21, To: 0x292}, + 140: {From: 0x2e54, To: 0x7d}, + 141: {From: 0x2e65, To: 0x2282}, + 142: {From: 0x2e97, To: 0x1a4}, + 143: {From: 0x2ea0, To: 0x2e9b}, + 144: {From: 0x2eef, To: 0x2ed7}, + 145: {From: 0x3193, To: 0x3c4}, + 146: {From: 0x3366, To: 0x338e}, + 147: {From: 0x342a, To: 0x3dc}, + 148: {From: 0x34ee, To: 0x18d0}, + 149: {From: 0x35c8, To: 0x2c9b}, + 150: {From: 0x35e6, To: 0x412}, + 151: {From: 0x35f5, To: 0x24b}, + 152: {From: 0x360d, To: 0x1dc}, + 153: {From: 0x3658, To: 0x246}, + 154: {From: 0x3676, To: 0x3f4}, + 155: {From: 0x36fd, To: 0x445}, + 156: {From: 0x3747, To: 0x3b42}, + 157: {From: 0x37c0, To: 0x121}, + 158: {From: 0x3816, To: 0x38f2}, + 159: {From: 0x382a, To: 0x2b48}, + 160: {From: 0x382b, To: 0x2c9b}, + 161: {From: 0x382f, To: 0xa9}, + 162: {From: 0x3832, To: 0x3228}, + 163: {From: 0x386c, To: 0x39a6}, + 164: {From: 0x3892, To: 0x3fc0}, + 165: {From: 0x38a0, To: 0x45f}, + 166: {From: 0x38a5, To: 0x39d7}, + 167: {From: 0x38b4, To: 0x1fa4}, + 168: {From: 0x38b5, To: 0x2e9a}, + 169: {From: 0x38fa, To: 0x38f1}, + 170: {From: 0x395c, To: 0x47e}, + 171: {From: 0x3b4e, To: 0xd91}, + 172: {From: 0x3b78, To: 0x137}, + 173: {From: 0x3c99, To: 0x4bc}, + 174: {From: 0x3fbd, To: 0x100}, + 175: {From: 0x4208, To: 0xa91}, + 176: {From: 0x42be, To: 0x573}, + 177: {From: 0x42f9, To: 0x3f60}, + 178: {From: 0x4378, To: 0x25a}, + 179: {From: 0x43b8, To: 0xe6c}, + 180: {From: 0x43cd, To: 0x10f}, + 181: {From: 0x43d4, To: 0x4848}, + 182: {From: 0x44af, To: 0x3322}, + 183: {From: 0x44e3, To: 0x512}, + 184: {From: 0x45ca, To: 0x2409}, + 185: {From: 0x45dd, To: 0x26dc}, + 186: {From: 0x4610, To: 0x48ae}, + 187: {From: 0x46ae, To: 0x46a0}, + 188: {From: 0x473e, To: 0x4745}, + 189: {From: 0x4817, To: 0x3503}, + 190: {From: 0x483b, To: 0x208b}, + 191: {From: 0x4916, To: 0x31f}, + 192: {From: 0x49a7, To: 0x523}, } -// Size: 179 bytes, 179 elements -var AliasTypes = [179]AliasType{ +// Size: 193 bytes, 193 elements +var AliasTypes = [193]AliasType{ // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, - 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, 0, 2, - 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, - 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0, + 1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, + 0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, + 1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, // Entry 40 - 7F - 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, - 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, - 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, 1, 1, 0, 1, - 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 0, 0, 1, 0, + 1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, + 2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, + 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, // Entry 80 - BF - 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 0, 2, - 1, 1, 1, 0, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, - 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, - 0, 1, 1, + 1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0, + 0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0, + 0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0, + 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1, + // Entry C0 - FF + 1, } const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) // script is an alphabetically sorted list of ISO 15924 codes. The index // of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 1040 bytes +const script tag.Index = "" + // Size: 1052 bytes "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + - "JavaJpanJurcKaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatg" + - "LatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMend" + - "MercMeroMlymModiMongMoonMrooMteiMultMymrNandNarbNbatNewaNkdbNkgbNkooNshu" + - "OgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlvPhnxPiqd" + - "PlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaamQaanQaao" + - "QaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabeQabfQabg" + - "QabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabwQabxRanj" + - "RjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogdSogoSora" + - "SoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglg" + - "ThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsuxYeziYiiiZanb" + - "ZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + "JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" + + "LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" + + "MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" + + "NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" + + "PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + + "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + + "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + + "QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" + + "SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" + + "TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" + + "YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" // suppressScript is an index from langID to the dominant script for that language, // if it exists. If a script is given, it should be suppressed from the language tag. @@ -824,7 +840,7 @@ var suppressScript = [1330]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -833,7 +849,7 @@ var suppressScript = [1330]uint8{ // Entry 40 - 7F 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -846,53 +862,53 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry C0 - FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F - 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xea, 0x00, 0x00, 0x00, 0x00, 0xec, 0x00, 0x00, + 0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00, // Entry 140 - 17F - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 180 - 1BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x35, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, // Entry 1C0 - 1FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x5a, 0x5a, 0x00, 0x08, + 0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x5a, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, // Entry 200 - 23F 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -903,9 +919,9 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 240 - 27F - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x00, 0x00, 0x4e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x53, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -913,93 +929,93 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 280 - 2BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 2C0 - 2FF - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, // Entry 300 - 33F - 0x00, 0x00, 0x00, 0x00, 0x6e, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5a, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x5a, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, // Entry 3C0 - 3FF - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 400 - 43F - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xd4, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, // Entry 440 - 47F - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe3, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe6, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xeb, 0x00, 0x00, 0x00, 0x2c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 480 - 4BF - 0x5a, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 4C0 - 4FF - 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 500 - 53F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1007,7 +1023,7 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, } @@ -1016,16 +1032,16 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) // isoRegionOffset needs to be added to the index of regionISO to obtain the regionID @@ -1034,8 +1050,8 @@ const ( const isoRegionOffset = 32 // regionTypes defines the status of a region for various standards. -// Size: 358 bytes, 358 elements -var regionTypes = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionTypes = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1048,45 +1064,45 @@ var regionTypes = [358]uint8{ // Entry 40 - 7F 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, - 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06, + 0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry 80 - BF 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry C0 - FF - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, // Entry 100 - 13F - 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, // Entry 140 - 17F - 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, - 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, } // regionISO holds a list of alphabetically sorted 2-letter ISO region codes. @@ -1094,27 +1110,27 @@ var regionTypes = [358]uint8{ // - [A-Z}{2}: the first letter of the 2-letter code plus these two // letters form the 3-letter ISO code. // - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1308 bytes +const regionISO tag.Index = "" + // Size: 1312 bytes "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + - "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + - "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + - "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + - "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + - "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + - "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + - "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + - "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + - "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + - "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + - "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + - "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + - "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + - "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + - "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + "CQ CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" + + "OMDYHYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSM" + + "FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" + + "NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERL" + + "ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" + + "\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" + + "LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" + + "MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" + + "NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" + + "\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" + + "QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" + + "SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" + + "SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" + + "TOTVUVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" + + "NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" + + "NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" + + "ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff" // altRegionISO3 holds a list of 3-letter region codes that cannot be // mapped to 2-letter codes using the default algorithm. This is a short list. @@ -1124,38 +1140,38 @@ const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" // of the 3-letter ISO codes in altRegionISO3. // Size: 22 bytes, 11 elements var altRegionIDs = [11]uint16{ - 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, - 0x0121, 0x015f, 0x00dc, + 0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106, + 0x0122, 0x0160, 0x00dd, } // Size: 80 bytes, 20 elements var regionOldMap = [20]FromTo{ - 0: {From: 0x44, To: 0xc4}, - 1: {From: 0x58, To: 0xa7}, - 2: {From: 0x5f, To: 0x60}, - 3: {From: 0x66, To: 0x3b}, - 4: {From: 0x79, To: 0x78}, - 5: {From: 0x93, To: 0x37}, - 6: {From: 0xa3, To: 0x133}, - 7: {From: 0xc1, To: 0x133}, - 8: {From: 0xd7, To: 0x13f}, - 9: {From: 0xdc, To: 0x2b}, - 10: {From: 0xef, To: 0x133}, - 11: {From: 0xf2, To: 0xe2}, - 12: {From: 0xfc, To: 0x70}, - 13: {From: 0x103, To: 0x164}, - 14: {From: 0x12a, To: 0x126}, - 15: {From: 0x132, To: 0x7b}, - 16: {From: 0x13a, To: 0x13e}, - 17: {From: 0x141, To: 0x133}, - 18: {From: 0x15d, To: 0x15e}, - 19: {From: 0x163, To: 0x4b}, + 0: {From: 0x44, To: 0xc5}, + 1: {From: 0x59, To: 0xa8}, + 2: {From: 0x60, To: 0x61}, + 3: {From: 0x67, To: 0x3b}, + 4: {From: 0x7a, To: 0x79}, + 5: {From: 0x94, To: 0x37}, + 6: {From: 0xa4, To: 0x134}, + 7: {From: 0xc2, To: 0x134}, + 8: {From: 0xd8, To: 0x140}, + 9: {From: 0xdd, To: 0x2b}, + 10: {From: 0xf0, To: 0x134}, + 11: {From: 0xf3, To: 0xe3}, + 12: {From: 0xfd, To: 0x71}, + 13: {From: 0x104, To: 0x165}, + 14: {From: 0x12b, To: 0x127}, + 15: {From: 0x133, To: 0x7c}, + 16: {From: 0x13b, To: 0x13f}, + 17: {From: 0x142, To: 0x134}, + 18: {From: 0x15e, To: 0x15f}, + 19: {From: 0x164, To: 0x4b}, } // m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are // codes indicating collections of regions. -// Size: 716 bytes, 358 elements -var m49 = [358]int16{ +// Size: 718 bytes, 359 elements +var m49 = [359]int16{ // Entry 0 - 3F 0, 1, 2, 3, 5, 9, 11, 13, 14, 15, 17, 18, 19, 21, 29, 30, @@ -1168,45 +1184,45 @@ var m49 = [358]int16{ // Entry 40 - 7F 535, 76, 44, 64, 104, 74, 72, 112, 84, 124, 166, 180, 140, 178, 756, 384, - 184, 152, 120, 156, 170, 0, 188, 891, - 296, 192, 132, 531, 162, 196, 203, 278, - 276, 0, 262, 208, 212, 214, 204, 12, - 0, 218, 233, 818, 732, 232, 724, 231, - 967, 0, 246, 242, 238, 583, 234, 0, - 250, 249, 266, 826, 308, 268, 254, 831, + 184, 152, 120, 156, 170, 0, 0, 188, + 891, 296, 192, 132, 531, 162, 196, 203, + 278, 276, 0, 262, 208, 212, 214, 204, + 12, 0, 218, 233, 818, 732, 232, 724, + 231, 967, 0, 246, 242, 238, 583, 234, + 0, 250, 249, 266, 826, 308, 268, 254, // Entry 80 - BF - 288, 292, 304, 270, 324, 312, 226, 300, - 239, 320, 316, 624, 328, 344, 334, 340, - 191, 332, 348, 854, 0, 360, 372, 376, - 833, 356, 86, 368, 364, 352, 380, 832, - 388, 400, 392, 581, 404, 417, 116, 296, - 174, 659, 408, 410, 414, 136, 398, 418, - 422, 662, 438, 144, 430, 426, 440, 442, - 428, 434, 504, 492, 498, 499, 663, 450, + 831, 288, 292, 304, 270, 324, 312, 226, + 300, 239, 320, 316, 624, 328, 344, 334, + 340, 191, 332, 348, 854, 0, 360, 372, + 376, 833, 356, 86, 368, 364, 352, 380, + 832, 388, 400, 392, 581, 404, 417, 116, + 296, 174, 659, 408, 410, 414, 136, 398, + 418, 422, 662, 438, 144, 430, 426, 440, + 442, 428, 434, 504, 492, 498, 499, 663, // Entry C0 - FF - 584, 581, 807, 466, 104, 496, 446, 580, - 474, 478, 500, 470, 480, 462, 454, 484, - 458, 508, 516, 540, 562, 574, 566, 548, - 558, 528, 578, 524, 10, 520, 536, 570, - 554, 512, 591, 0, 604, 258, 598, 608, - 586, 616, 666, 612, 630, 275, 620, 581, - 585, 600, 591, 634, 959, 960, 961, 962, - 963, 964, 965, 966, 967, 968, 969, 970, + 450, 584, 581, 807, 466, 104, 496, 446, + 580, 474, 478, 500, 470, 480, 462, 454, + 484, 458, 508, 516, 540, 562, 574, 566, + 548, 558, 528, 578, 524, 10, 520, 536, + 570, 554, 512, 591, 0, 604, 258, 598, + 608, 586, 616, 666, 612, 630, 275, 620, + 581, 585, 600, 591, 634, 959, 960, 961, + 962, 963, 964, 965, 966, 967, 968, 969, // Entry 100 - 13F - 971, 972, 638, 716, 642, 688, 643, 646, - 682, 90, 690, 729, 752, 702, 654, 705, - 744, 703, 694, 674, 686, 706, 740, 728, - 678, 810, 222, 534, 760, 748, 0, 796, - 148, 260, 768, 764, 762, 772, 626, 795, - 788, 776, 626, 792, 780, 798, 158, 834, - 804, 800, 826, 581, 0, 840, 858, 860, - 336, 670, 704, 862, 92, 850, 704, 548, + 970, 971, 972, 638, 716, 642, 688, 643, + 646, 682, 90, 690, 729, 752, 702, 654, + 705, 744, 703, 694, 674, 686, 706, 740, + 728, 678, 810, 222, 534, 760, 748, 0, + 796, 148, 260, 768, 764, 762, 772, 626, + 795, 788, 776, 626, 792, 780, 798, 158, + 834, 804, 800, 826, 581, 0, 840, 858, + 860, 336, 670, 704, 862, 92, 850, 704, // Entry 140 - 17F - 876, 581, 882, 973, 974, 975, 976, 977, - 978, 979, 980, 981, 982, 983, 984, 985, - 986, 987, 988, 989, 990, 991, 992, 993, - 994, 995, 996, 997, 998, 720, 887, 175, - 891, 710, 894, 180, 716, 999, + 548, 876, 581, 882, 973, 974, 975, 976, + 977, 978, 979, 980, 981, 982, 983, 984, + 985, 986, 987, 988, 989, 990, 991, 992, + 993, 994, 995, 996, 997, 998, 720, 887, + 175, 891, 710, 894, 180, 716, 999, } // m49Index gives indexes into fromM49 based on the three most significant bits @@ -1227,65 +1243,65 @@ var m49Index = [9]int16{ var fromM49 = [333]uint16{ // Entry 0 - 3F 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, - 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, - 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, - 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + 0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047, + 0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18, // Entry 40 - 7F - 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, - 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, - 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, - 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, - 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, - 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, - 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, - 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + 0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d, + 0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f, + 0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70, + 0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73, + 0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b, + 0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882, + 0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885, // Entry 80 - BF - 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, - 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, - 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, - 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, - 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, - 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, - 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, - 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + 0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e, + 0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f, + 0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad, + 0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba, + 0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce, + 0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6, + 0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de, + 0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df, // Entry C0 - FF - 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, - 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, - 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, - 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, - 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, - 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, - 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, - 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + 0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6, + 0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3, + 0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c, + 0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c, + 0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514, + 0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12, + 0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118, + 0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e, // Entry 100 - 13F - 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, - 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, - 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, - 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, - 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, - 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, - 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, - 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + 0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023, + 0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3, + 0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136, + 0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f, + 0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8, + 0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500, + 0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549, + 0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551, // Entry 140 - 17F - 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, - 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, + 0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559, + 0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66, } -// Size: 2014 bytes +// Size: 2128 bytes var variantIndex = map[string]uint8{ "1606nict": 0x0, "1694acad": 0x1, "1901": 0x2, "1959acad": 0x3, - "1994": 0x61, + "1994": 0x67, "1996": 0x4, "abl1943": 0x5, "akuapem": 0x6, - "alalc97": 0x63, + "alalc97": 0x69, "aluku": 0x7, "ao1990": 0x8, "aranes": 0x9, @@ -1299,94 +1315,100 @@ var variantIndex = map[string]uint8{ "barla": 0x11, "basiceng": 0x12, "bauddha": 0x13, - "biscayan": 0x14, - "biske": 0x5c, - "bohoric": 0x15, - "boont": 0x16, - "bornholm": 0x17, - "cisaup": 0x18, - "colb1945": 0x19, - "cornu": 0x1a, - "creiss": 0x1b, - "dajnko": 0x1c, - "ekavsk": 0x1d, - "emodeng": 0x1e, - "fonipa": 0x64, - "fonkirsh": 0x65, - "fonnapa": 0x66, - "fonupa": 0x67, - "fonxsamp": 0x68, - "gascon": 0x1f, - "grclass": 0x20, - "grital": 0x21, - "grmistr": 0x22, - "hepburn": 0x23, - "heploc": 0x62, - "hognorsk": 0x24, - "hsistemo": 0x25, - "ijekavsk": 0x26, - "itihasa": 0x27, - "ivanchov": 0x28, - "jauer": 0x29, - "jyutping": 0x2a, - "kkcor": 0x2b, - "kociewie": 0x2c, - "kscor": 0x2d, - "laukika": 0x2e, - "lemosin": 0x2f, - "lengadoc": 0x30, - "lipaw": 0x5d, - "luna1918": 0x31, - "metelko": 0x32, - "monoton": 0x33, - "ndyuka": 0x34, - "nedis": 0x35, - "newfound": 0x36, - "nicard": 0x37, - "njiva": 0x5e, - "nulik": 0x38, - "osojs": 0x5f, - "oxendict": 0x39, - "pahawh2": 0x3a, - "pahawh3": 0x3b, - "pahawh4": 0x3c, - "pamaka": 0x3d, - "peano": 0x3e, - "petr1708": 0x3f, - "pinyin": 0x40, - "polyton": 0x41, - "provenc": 0x42, - "puter": 0x43, - "rigik": 0x44, - "rozaj": 0x45, - "rumgr": 0x46, - "scotland": 0x47, - "scouse": 0x48, - "simple": 0x69, - "solba": 0x60, - "sotav": 0x49, - "spanglis": 0x4a, - "surmiran": 0x4b, - "sursilv": 0x4c, - "sutsilv": 0x4d, - "tarask": 0x4e, - "tongyong": 0x4f, - "tunumiit": 0x50, - "uccor": 0x51, - "ucrcor": 0x52, - "ulster": 0x53, - "unifon": 0x54, - "vaidika": 0x55, - "valencia": 0x56, - "vallader": 0x57, - "vecdruka": 0x58, - "vivaraup": 0x59, - "wadegile": 0x5a, - "xsistemo": 0x5b, + "bciav": 0x14, + "bcizbl": 0x15, + "biscayan": 0x16, + "biske": 0x62, + "bohoric": 0x17, + "boont": 0x18, + "bornholm": 0x19, + "cisaup": 0x1a, + "colb1945": 0x1b, + "cornu": 0x1c, + "creiss": 0x1d, + "dajnko": 0x1e, + "ekavsk": 0x1f, + "emodeng": 0x20, + "fonipa": 0x6a, + "fonkirsh": 0x6b, + "fonnapa": 0x6c, + "fonupa": 0x6d, + "fonxsamp": 0x6e, + "gallo": 0x21, + "gascon": 0x22, + "grclass": 0x23, + "grital": 0x24, + "grmistr": 0x25, + "hepburn": 0x26, + "heploc": 0x68, + "hognorsk": 0x27, + "hsistemo": 0x28, + "ijekavsk": 0x29, + "itihasa": 0x2a, + "ivanchov": 0x2b, + "jauer": 0x2c, + "jyutping": 0x2d, + "kkcor": 0x2e, + "kociewie": 0x2f, + "kscor": 0x30, + "laukika": 0x31, + "lemosin": 0x32, + "lengadoc": 0x33, + "lipaw": 0x63, + "ltg1929": 0x34, + "ltg2007": 0x35, + "luna1918": 0x36, + "metelko": 0x37, + "monoton": 0x38, + "ndyuka": 0x39, + "nedis": 0x3a, + "newfound": 0x3b, + "nicard": 0x3c, + "njiva": 0x64, + "nulik": 0x3d, + "osojs": 0x65, + "oxendict": 0x3e, + "pahawh2": 0x3f, + "pahawh3": 0x40, + "pahawh4": 0x41, + "pamaka": 0x42, + "peano": 0x43, + "petr1708": 0x44, + "pinyin": 0x45, + "polyton": 0x46, + "provenc": 0x47, + "puter": 0x48, + "rigik": 0x49, + "rozaj": 0x4a, + "rumgr": 0x4b, + "scotland": 0x4c, + "scouse": 0x4d, + "simple": 0x6f, + "solba": 0x66, + "sotav": 0x4e, + "spanglis": 0x4f, + "surmiran": 0x50, + "sursilv": 0x51, + "sutsilv": 0x52, + "synnejyl": 0x53, + "tarask": 0x54, + "tongyong": 0x55, + "tunumiit": 0x56, + "uccor": 0x57, + "ucrcor": 0x58, + "ulster": 0x59, + "unifon": 0x5a, + "vaidika": 0x5b, + "valencia": 0x5c, + "vallader": 0x5d, + "vecdruka": 0x5e, + "vivaraup": 0x5f, + "wadegile": 0x60, + "xsistemo": 0x61, } // variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 99 +const variantNumSpecialized = 105 // nRegionGroups is the number of region groups. const nRegionGroups = 33 @@ -1398,151 +1420,151 @@ type likelyLangRegion struct { // likelyScript is a lookup table, indexed by scriptID, for the most likely // languages and regions given a script. -// Size: 1040 bytes, 260 elements -var likelyScript = [260]likelyLangRegion{ - 1: {lang: 0x14e, region: 0x84}, - 3: {lang: 0x2a2, region: 0x106}, - 4: {lang: 0x1f, region: 0x99}, - 5: {lang: 0x3a, region: 0x6b}, - 7: {lang: 0x3b, region: 0x9c}, +// Size: 1052 bytes, 263 elements +var likelyScript = [263]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x85}, + 3: {lang: 0x2a2, region: 0x107}, + 4: {lang: 0x1f, region: 0x9a}, + 5: {lang: 0x3a, region: 0x6c}, + 7: {lang: 0x3b, region: 0x9d}, 8: {lang: 0x1d7, region: 0x28}, - 9: {lang: 0x13, region: 0x9c}, - 10: {lang: 0x5b, region: 0x95}, + 9: {lang: 0x13, region: 0x9d}, + 10: {lang: 0x5b, region: 0x96}, 11: {lang: 0x60, region: 0x52}, - 12: {lang: 0xb9, region: 0xb4}, - 13: {lang: 0x63, region: 0x95}, + 12: {lang: 0xb9, region: 0xb5}, + 13: {lang: 0x63, region: 0x96}, 14: {lang: 0xa5, region: 0x35}, - 15: {lang: 0x3e9, region: 0x99}, - 17: {lang: 0x529, region: 0x12e}, - 18: {lang: 0x3b1, region: 0x99}, - 19: {lang: 0x15e, region: 0x78}, - 20: {lang: 0xc2, region: 0x95}, - 21: {lang: 0x9d, region: 0xe7}, + 15: {lang: 0x3e9, region: 0x9a}, + 17: {lang: 0x529, region: 0x12f}, + 18: {lang: 0x3b1, region: 0x9a}, + 19: {lang: 0x15e, region: 0x79}, + 20: {lang: 0xc2, region: 0x96}, + 21: {lang: 0x9d, region: 0xe8}, 22: {lang: 0xdb, region: 0x35}, 23: {lang: 0xf3, region: 0x49}, - 24: {lang: 0x4f0, region: 0x12b}, - 25: {lang: 0xe7, region: 0x13e}, - 26: {lang: 0xe5, region: 0x135}, - 29: {lang: 0xf1, region: 0x6b}, - 31: {lang: 0x1a0, region: 0x5d}, - 32: {lang: 0x3e2, region: 0x106}, - 34: {lang: 0x1be, region: 0x99}, - 38: {lang: 0x15e, region: 0x78}, - 41: {lang: 0x133, region: 0x6b}, + 24: {lang: 0x4f0, region: 0x12c}, + 25: {lang: 0xe7, region: 0x13f}, + 26: {lang: 0xe5, region: 0x136}, + 29: {lang: 0xf1, region: 0x6c}, + 31: {lang: 0x1a0, region: 0x5e}, + 32: {lang: 0x3e2, region: 0x107}, + 34: {lang: 0x1be, region: 0x9a}, + 38: {lang: 0x15e, region: 0x79}, + 41: {lang: 0x133, region: 0x6c}, 42: {lang: 0x431, region: 0x27}, - 44: {lang: 0x27, region: 0x6f}, - 46: {lang: 0x210, region: 0x7d}, + 44: {lang: 0x27, region: 0x70}, + 46: {lang: 0x210, region: 0x7e}, 47: {lang: 0xfe, region: 0x38}, - 49: {lang: 0x19b, region: 0x99}, - 50: {lang: 0x19e, region: 0x130}, - 51: {lang: 0x3e9, region: 0x99}, - 52: {lang: 0x136, region: 0x87}, - 53: {lang: 0x1a4, region: 0x99}, - 54: {lang: 0x39d, region: 0x99}, - 55: {lang: 0x529, region: 0x12e}, - 56: {lang: 0x254, region: 0xab}, + 49: {lang: 0x19b, region: 0x9a}, + 50: {lang: 0x19e, region: 0x131}, + 51: {lang: 0x3e9, region: 0x9a}, + 52: {lang: 0x136, region: 0x88}, + 53: {lang: 0x1a4, region: 0x9a}, + 54: {lang: 0x39d, region: 0x9a}, + 55: {lang: 0x529, region: 0x12f}, + 56: {lang: 0x254, region: 0xac}, 57: {lang: 0x529, region: 0x53}, - 58: {lang: 0x1cb, region: 0xe7}, + 58: {lang: 0x1cb, region: 0xe8}, 59: {lang: 0x529, region: 0x53}, - 60: {lang: 0x529, region: 0x12e}, - 61: {lang: 0x2fd, region: 0x9b}, - 62: {lang: 0x1bc, region: 0x97}, - 63: {lang: 0x200, region: 0xa2}, - 64: {lang: 0x1c5, region: 0x12b}, - 65: {lang: 0x1ca, region: 0xaf}, - 68: {lang: 0x1d5, region: 0x92}, - 70: {lang: 0x142, region: 0x9e}, - 71: {lang: 0x254, region: 0xab}, - 72: {lang: 0x20e, region: 0x95}, - 73: {lang: 0x200, region: 0xa2}, - 75: {lang: 0x135, region: 0xc4}, - 76: {lang: 0x200, region: 0xa2}, - 77: {lang: 0x3bb, region: 0xe8}, - 78: {lang: 0x24a, region: 0xa6}, - 79: {lang: 0x3fa, region: 0x99}, - 82: {lang: 0x251, region: 0x99}, - 83: {lang: 0x254, region: 0xab}, - 85: {lang: 0x88, region: 0x99}, - 86: {lang: 0x370, region: 0x123}, - 87: {lang: 0x2b8, region: 0xaf}, - 92: {lang: 0x29f, region: 0x99}, - 93: {lang: 0x2a8, region: 0x99}, - 94: {lang: 0x28f, region: 0x87}, - 95: {lang: 0x1a0, region: 0x87}, - 96: {lang: 0x2ac, region: 0x53}, - 98: {lang: 0x4f4, region: 0x12b}, - 99: {lang: 0x4f5, region: 0x12b}, - 100: {lang: 0x1be, region: 0x99}, - 102: {lang: 0x337, region: 0x9c}, - 103: {lang: 0x4f7, region: 0x53}, - 104: {lang: 0xa9, region: 0x53}, - 107: {lang: 0x2e8, region: 0x112}, - 108: {lang: 0x4f8, region: 0x10b}, - 109: {lang: 0x4f8, region: 0x10b}, - 110: {lang: 0x304, region: 0x99}, - 111: {lang: 0x31b, region: 0x99}, - 112: {lang: 0x30b, region: 0x53}, - 114: {lang: 0x31e, region: 0x35}, - 115: {lang: 0x30e, region: 0x99}, - 116: {lang: 0x414, region: 0xe8}, - 117: {lang: 0x331, region: 0xc4}, - 119: {lang: 0x4f9, region: 0x108}, - 120: {lang: 0x3b, region: 0xa1}, - 121: {lang: 0x353, region: 0xdb}, - 124: {lang: 0x2d0, region: 0x84}, - 125: {lang: 0x52a, region: 0x53}, - 126: {lang: 0x403, region: 0x96}, - 127: {lang: 0x3ee, region: 0x99}, - 128: {lang: 0x39b, region: 0xc5}, - 129: {lang: 0x395, region: 0x99}, - 130: {lang: 0x399, region: 0x135}, - 131: {lang: 0x429, region: 0x115}, - 133: {lang: 0x3b, region: 0x11c}, - 134: {lang: 0xfd, region: 0xc4}, - 137: {lang: 0x27d, region: 0x106}, - 138: {lang: 0x2c9, region: 0x53}, - 139: {lang: 0x39f, region: 0x9c}, - 140: {lang: 0x39f, region: 0x53}, - 142: {lang: 0x3ad, region: 0xb0}, - 144: {lang: 0x1c6, region: 0x53}, - 145: {lang: 0x4fd, region: 0x9c}, - 198: {lang: 0x3cb, region: 0x95}, - 201: {lang: 0x372, region: 0x10c}, - 202: {lang: 0x420, region: 0x97}, - 204: {lang: 0x4ff, region: 0x15e}, - 205: {lang: 0x3f0, region: 0x99}, - 206: {lang: 0x45, region: 0x135}, - 207: {lang: 0x139, region: 0x7b}, - 208: {lang: 0x3e9, region: 0x99}, - 210: {lang: 0x3e9, region: 0x99}, - 211: {lang: 0x3fa, region: 0x99}, - 212: {lang: 0x40c, region: 0xb3}, - 215: {lang: 0x433, region: 0x99}, - 216: {lang: 0xef, region: 0xc5}, - 217: {lang: 0x43e, region: 0x95}, - 218: {lang: 0x44d, region: 0x35}, - 219: {lang: 0x44e, region: 0x9b}, - 223: {lang: 0x45a, region: 0xe7}, - 224: {lang: 0x11a, region: 0x99}, - 225: {lang: 0x45e, region: 0x53}, - 226: {lang: 0x232, region: 0x53}, - 227: {lang: 0x450, region: 0x99}, - 228: {lang: 0x4a5, region: 0x53}, - 229: {lang: 0x9f, region: 0x13e}, - 230: {lang: 0x461, region: 0x99}, - 232: {lang: 0x528, region: 0xba}, - 233: {lang: 0x153, region: 0xe7}, - 234: {lang: 0x128, region: 0xcd}, - 235: {lang: 0x46b, region: 0x123}, - 236: {lang: 0xa9, region: 0x53}, - 237: {lang: 0x2ce, region: 0x99}, - 240: {lang: 0x4ad, region: 0x11c}, - 241: {lang: 0x4be, region: 0xb4}, - 244: {lang: 0x1ce, region: 0x99}, - 247: {lang: 0x3a9, region: 0x9c}, - 248: {lang: 0x22, region: 0x9b}, - 250: {lang: 0x1ea, region: 0x53}, - 251: {lang: 0xef, region: 0xc5}, + 60: {lang: 0x529, region: 0x12f}, + 61: {lang: 0x2fd, region: 0x9c}, + 62: {lang: 0x1bc, region: 0x98}, + 63: {lang: 0x200, region: 0xa3}, + 64: {lang: 0x1c5, region: 0x12c}, + 65: {lang: 0x1ca, region: 0xb0}, + 68: {lang: 0x1d5, region: 0x93}, + 70: {lang: 0x142, region: 0x9f}, + 71: {lang: 0x254, region: 0xac}, + 72: {lang: 0x20e, region: 0x96}, + 73: {lang: 0x200, region: 0xa3}, + 75: {lang: 0x135, region: 0xc5}, + 76: {lang: 0x200, region: 0xa3}, + 78: {lang: 0x3bb, region: 0xe9}, + 79: {lang: 0x24a, region: 0xa7}, + 80: {lang: 0x3fa, region: 0x9a}, + 83: {lang: 0x251, region: 0x9a}, + 84: {lang: 0x254, region: 0xac}, + 86: {lang: 0x88, region: 0x9a}, + 87: {lang: 0x370, region: 0x124}, + 88: {lang: 0x2b8, region: 0xb0}, + 93: {lang: 0x29f, region: 0x9a}, + 94: {lang: 0x2a8, region: 0x9a}, + 95: {lang: 0x28f, region: 0x88}, + 96: {lang: 0x1a0, region: 0x88}, + 97: {lang: 0x2ac, region: 0x53}, + 99: {lang: 0x4f4, region: 0x12c}, + 100: {lang: 0x4f5, region: 0x12c}, + 101: {lang: 0x1be, region: 0x9a}, + 103: {lang: 0x337, region: 0x9d}, + 104: {lang: 0x4f7, region: 0x53}, + 105: {lang: 0xa9, region: 0x53}, + 108: {lang: 0x2e8, region: 0x113}, + 109: {lang: 0x4f8, region: 0x10c}, + 110: {lang: 0x4f8, region: 0x10c}, + 111: {lang: 0x304, region: 0x9a}, + 112: {lang: 0x31b, region: 0x9a}, + 113: {lang: 0x30b, region: 0x53}, + 115: {lang: 0x31e, region: 0x35}, + 116: {lang: 0x30e, region: 0x9a}, + 117: {lang: 0x414, region: 0xe9}, + 118: {lang: 0x331, region: 0xc5}, + 121: {lang: 0x4f9, region: 0x109}, + 122: {lang: 0x3b, region: 0xa2}, + 123: {lang: 0x353, region: 0xdc}, + 126: {lang: 0x2d0, region: 0x85}, + 127: {lang: 0x52a, region: 0x53}, + 128: {lang: 0x403, region: 0x97}, + 129: {lang: 0x3ee, region: 0x9a}, + 130: {lang: 0x39b, region: 0xc6}, + 131: {lang: 0x395, region: 0x9a}, + 132: {lang: 0x399, region: 0x136}, + 133: {lang: 0x429, region: 0x116}, + 135: {lang: 0x3b, region: 0x11d}, + 136: {lang: 0xfd, region: 0xc5}, + 139: {lang: 0x27d, region: 0x107}, + 140: {lang: 0x2c9, region: 0x53}, + 141: {lang: 0x39f, region: 0x9d}, + 142: {lang: 0x39f, region: 0x53}, + 144: {lang: 0x3ad, region: 0xb1}, + 146: {lang: 0x1c6, region: 0x53}, + 147: {lang: 0x4fd, region: 0x9d}, + 200: {lang: 0x3cb, region: 0x96}, + 203: {lang: 0x372, region: 0x10d}, + 204: {lang: 0x420, region: 0x98}, + 206: {lang: 0x4ff, region: 0x15f}, + 207: {lang: 0x3f0, region: 0x9a}, + 208: {lang: 0x45, region: 0x136}, + 209: {lang: 0x139, region: 0x7c}, + 210: {lang: 0x3e9, region: 0x9a}, + 212: {lang: 0x3e9, region: 0x9a}, + 213: {lang: 0x3fa, region: 0x9a}, + 214: {lang: 0x40c, region: 0xb4}, + 217: {lang: 0x433, region: 0x9a}, + 218: {lang: 0xef, region: 0xc6}, + 219: {lang: 0x43e, region: 0x96}, + 221: {lang: 0x44d, region: 0x35}, + 222: {lang: 0x44e, region: 0x9c}, + 226: {lang: 0x45a, region: 0xe8}, + 227: {lang: 0x11a, region: 0x9a}, + 228: {lang: 0x45e, region: 0x53}, + 229: {lang: 0x232, region: 0x53}, + 230: {lang: 0x450, region: 0x9a}, + 231: {lang: 0x4a5, region: 0x53}, + 232: {lang: 0x9f, region: 0x13f}, + 233: {lang: 0x461, region: 0x9a}, + 235: {lang: 0x528, region: 0xbb}, + 236: {lang: 0x153, region: 0xe8}, + 237: {lang: 0x128, region: 0xce}, + 238: {lang: 0x46b, region: 0x124}, + 239: {lang: 0xa9, region: 0x53}, + 240: {lang: 0x2ce, region: 0x9a}, + 243: {lang: 0x4ad, region: 0x11d}, + 244: {lang: 0x4be, region: 0xb5}, + 247: {lang: 0x1ce, region: 0x9a}, + 250: {lang: 0x3a9, region: 0x9d}, + 251: {lang: 0x22, region: 0x9c}, + 253: {lang: 0x1ea, region: 0x53}, + 254: {lang: 0xef, region: 0xc6}, } type likelyScriptRegion struct { @@ -1557,1423 +1579,1423 @@ type likelyScriptRegion struct { // of the list in likelyLangList. // Size: 7980 bytes, 1330 elements var likelyLang = [1330]likelyScriptRegion{ - 0: {region: 0x135, script: 0x5a, flags: 0x0}, - 1: {region: 0x6f, script: 0x5a, flags: 0x0}, - 2: {region: 0x165, script: 0x5a, flags: 0x0}, - 3: {region: 0x165, script: 0x5a, flags: 0x0}, - 4: {region: 0x165, script: 0x5a, flags: 0x0}, - 5: {region: 0x7d, script: 0x20, flags: 0x0}, - 6: {region: 0x165, script: 0x5a, flags: 0x0}, - 7: {region: 0x165, script: 0x20, flags: 0x0}, - 8: {region: 0x80, script: 0x5a, flags: 0x0}, - 9: {region: 0x165, script: 0x5a, flags: 0x0}, - 10: {region: 0x165, script: 0x5a, flags: 0x0}, - 11: {region: 0x165, script: 0x5a, flags: 0x0}, - 12: {region: 0x95, script: 0x5a, flags: 0x0}, - 13: {region: 0x131, script: 0x5a, flags: 0x0}, - 14: {region: 0x80, script: 0x5a, flags: 0x0}, - 15: {region: 0x165, script: 0x5a, flags: 0x0}, - 16: {region: 0x165, script: 0x5a, flags: 0x0}, - 17: {region: 0x106, script: 0x20, flags: 0x0}, - 18: {region: 0x165, script: 0x5a, flags: 0x0}, - 19: {region: 0x9c, script: 0x9, flags: 0x0}, - 20: {region: 0x128, script: 0x5, flags: 0x0}, - 21: {region: 0x165, script: 0x5a, flags: 0x0}, - 22: {region: 0x161, script: 0x5a, flags: 0x0}, - 23: {region: 0x165, script: 0x5a, flags: 0x0}, - 24: {region: 0x165, script: 0x5a, flags: 0x0}, - 25: {region: 0x165, script: 0x5a, flags: 0x0}, - 26: {region: 0x165, script: 0x5a, flags: 0x0}, - 27: {region: 0x165, script: 0x5a, flags: 0x0}, - 28: {region: 0x52, script: 0x5a, flags: 0x0}, - 29: {region: 0x165, script: 0x5a, flags: 0x0}, - 30: {region: 0x165, script: 0x5a, flags: 0x0}, - 31: {region: 0x99, script: 0x4, flags: 0x0}, - 32: {region: 0x165, script: 0x5a, flags: 0x0}, - 33: {region: 0x80, script: 0x5a, flags: 0x0}, - 34: {region: 0x9b, script: 0xf8, flags: 0x0}, - 35: {region: 0x165, script: 0x5a, flags: 0x0}, - 36: {region: 0x165, script: 0x5a, flags: 0x0}, - 37: {region: 0x14d, script: 0x5a, flags: 0x0}, - 38: {region: 0x106, script: 0x20, flags: 0x0}, - 39: {region: 0x6f, script: 0x2c, flags: 0x0}, - 40: {region: 0x165, script: 0x5a, flags: 0x0}, - 41: {region: 0x165, script: 0x5a, flags: 0x0}, - 42: {region: 0xd6, script: 0x5a, flags: 0x0}, - 43: {region: 0x165, script: 0x5a, flags: 0x0}, - 45: {region: 0x165, script: 0x5a, flags: 0x0}, - 46: {region: 0x165, script: 0x5a, flags: 0x0}, - 47: {region: 0x165, script: 0x5a, flags: 0x0}, - 48: {region: 0x165, script: 0x5a, flags: 0x0}, - 49: {region: 0x165, script: 0x5a, flags: 0x0}, - 50: {region: 0x165, script: 0x5a, flags: 0x0}, - 51: {region: 0x95, script: 0x5a, flags: 0x0}, - 52: {region: 0x165, script: 0x5, flags: 0x0}, - 53: {region: 0x122, script: 0x5, flags: 0x0}, - 54: {region: 0x165, script: 0x5a, flags: 0x0}, - 55: {region: 0x165, script: 0x5a, flags: 0x0}, - 56: {region: 0x165, script: 0x5a, flags: 0x0}, - 57: {region: 0x165, script: 0x5a, flags: 0x0}, - 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 0: {region: 0x136, script: 0x5b, flags: 0x0}, + 1: {region: 0x70, script: 0x5b, flags: 0x0}, + 2: {region: 0x166, script: 0x5b, flags: 0x0}, + 3: {region: 0x166, script: 0x5b, flags: 0x0}, + 4: {region: 0x166, script: 0x5b, flags: 0x0}, + 5: {region: 0x7e, script: 0x20, flags: 0x0}, + 6: {region: 0x166, script: 0x5b, flags: 0x0}, + 7: {region: 0x166, script: 0x20, flags: 0x0}, + 8: {region: 0x81, script: 0x5b, flags: 0x0}, + 9: {region: 0x166, script: 0x5b, flags: 0x0}, + 10: {region: 0x166, script: 0x5b, flags: 0x0}, + 11: {region: 0x166, script: 0x5b, flags: 0x0}, + 12: {region: 0x96, script: 0x5b, flags: 0x0}, + 13: {region: 0x132, script: 0x5b, flags: 0x0}, + 14: {region: 0x81, script: 0x5b, flags: 0x0}, + 15: {region: 0x166, script: 0x5b, flags: 0x0}, + 16: {region: 0x166, script: 0x5b, flags: 0x0}, + 17: {region: 0x107, script: 0x20, flags: 0x0}, + 18: {region: 0x166, script: 0x5b, flags: 0x0}, + 19: {region: 0x9d, script: 0x9, flags: 0x0}, + 20: {region: 0x129, script: 0x5, flags: 0x0}, + 21: {region: 0x166, script: 0x5b, flags: 0x0}, + 22: {region: 0x162, script: 0x5b, flags: 0x0}, + 23: {region: 0x166, script: 0x5b, flags: 0x0}, + 24: {region: 0x166, script: 0x5b, flags: 0x0}, + 25: {region: 0x166, script: 0x5b, flags: 0x0}, + 26: {region: 0x166, script: 0x5b, flags: 0x0}, + 27: {region: 0x166, script: 0x5b, flags: 0x0}, + 28: {region: 0x52, script: 0x5b, flags: 0x0}, + 29: {region: 0x166, script: 0x5b, flags: 0x0}, + 30: {region: 0x166, script: 0x5b, flags: 0x0}, + 31: {region: 0x9a, script: 0x4, flags: 0x0}, + 32: {region: 0x166, script: 0x5b, flags: 0x0}, + 33: {region: 0x81, script: 0x5b, flags: 0x0}, + 34: {region: 0x9c, script: 0xfb, flags: 0x0}, + 35: {region: 0x166, script: 0x5b, flags: 0x0}, + 36: {region: 0x166, script: 0x5b, flags: 0x0}, + 37: {region: 0x14e, script: 0x5b, flags: 0x0}, + 38: {region: 0x107, script: 0x20, flags: 0x0}, + 39: {region: 0x70, script: 0x2c, flags: 0x0}, + 40: {region: 0x166, script: 0x5b, flags: 0x0}, + 41: {region: 0x166, script: 0x5b, flags: 0x0}, + 42: {region: 0xd7, script: 0x5b, flags: 0x0}, + 43: {region: 0x166, script: 0x5b, flags: 0x0}, + 45: {region: 0x166, script: 0x5b, flags: 0x0}, + 46: {region: 0x166, script: 0x5b, flags: 0x0}, + 47: {region: 0x166, script: 0x5b, flags: 0x0}, + 48: {region: 0x166, script: 0x5b, flags: 0x0}, + 49: {region: 0x166, script: 0x5b, flags: 0x0}, + 50: {region: 0x166, script: 0x5b, flags: 0x0}, + 51: {region: 0x96, script: 0x5b, flags: 0x0}, + 52: {region: 0x166, script: 0x5, flags: 0x0}, + 53: {region: 0x123, script: 0x5, flags: 0x0}, + 54: {region: 0x166, script: 0x5b, flags: 0x0}, + 55: {region: 0x166, script: 0x5b, flags: 0x0}, + 56: {region: 0x166, script: 0x5b, flags: 0x0}, + 57: {region: 0x166, script: 0x5b, flags: 0x0}, + 58: {region: 0x6c, script: 0x5, flags: 0x0}, 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x165, script: 0x5a, flags: 0x0}, - 61: {region: 0x51, script: 0x5a, flags: 0x0}, - 62: {region: 0x3f, script: 0x5a, flags: 0x0}, - 63: {region: 0x67, script: 0x5, flags: 0x0}, - 65: {region: 0xba, script: 0x5, flags: 0x0}, - 66: {region: 0x6b, script: 0x5, flags: 0x0}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0x12f, script: 0x5a, flags: 0x0}, - 69: {region: 0x135, script: 0xce, flags: 0x0}, - 70: {region: 0x165, script: 0x5a, flags: 0x0}, - 71: {region: 0x165, script: 0x5a, flags: 0x0}, - 72: {region: 0x6e, script: 0x5a, flags: 0x0}, - 73: {region: 0x165, script: 0x5a, flags: 0x0}, - 74: {region: 0x165, script: 0x5a, flags: 0x0}, - 75: {region: 0x49, script: 0x5a, flags: 0x0}, - 76: {region: 0x165, script: 0x5a, flags: 0x0}, - 77: {region: 0x106, script: 0x20, flags: 0x0}, - 78: {region: 0x165, script: 0x5, flags: 0x0}, - 79: {region: 0x165, script: 0x5a, flags: 0x0}, - 80: {region: 0x165, script: 0x5a, flags: 0x0}, - 81: {region: 0x165, script: 0x5a, flags: 0x0}, - 82: {region: 0x99, script: 0x22, flags: 0x0}, - 83: {region: 0x165, script: 0x5a, flags: 0x0}, - 84: {region: 0x165, script: 0x5a, flags: 0x0}, - 85: {region: 0x165, script: 0x5a, flags: 0x0}, - 86: {region: 0x3f, script: 0x5a, flags: 0x0}, - 87: {region: 0x165, script: 0x5a, flags: 0x0}, + 60: {region: 0x166, script: 0x5b, flags: 0x0}, + 61: {region: 0x51, script: 0x5b, flags: 0x0}, + 62: {region: 0x3f, script: 0x5b, flags: 0x0}, + 63: {region: 0x68, script: 0x5, flags: 0x0}, + 65: {region: 0xbb, script: 0x5, flags: 0x0}, + 66: {region: 0x6c, script: 0x5, flags: 0x0}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0x130, script: 0x5b, flags: 0x0}, + 69: {region: 0x136, script: 0xd0, flags: 0x0}, + 70: {region: 0x166, script: 0x5b, flags: 0x0}, + 71: {region: 0x166, script: 0x5b, flags: 0x0}, + 72: {region: 0x6f, script: 0x5b, flags: 0x0}, + 73: {region: 0x166, script: 0x5b, flags: 0x0}, + 74: {region: 0x166, script: 0x5b, flags: 0x0}, + 75: {region: 0x49, script: 0x5b, flags: 0x0}, + 76: {region: 0x166, script: 0x5b, flags: 0x0}, + 77: {region: 0x107, script: 0x20, flags: 0x0}, + 78: {region: 0x166, script: 0x5, flags: 0x0}, + 79: {region: 0x166, script: 0x5b, flags: 0x0}, + 80: {region: 0x166, script: 0x5b, flags: 0x0}, + 81: {region: 0x166, script: 0x5b, flags: 0x0}, + 82: {region: 0x9a, script: 0x22, flags: 0x0}, + 83: {region: 0x166, script: 0x5b, flags: 0x0}, + 84: {region: 0x166, script: 0x5b, flags: 0x0}, + 85: {region: 0x166, script: 0x5b, flags: 0x0}, + 86: {region: 0x3f, script: 0x5b, flags: 0x0}, + 87: {region: 0x166, script: 0x5b, flags: 0x0}, 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x106, script: 0x20, flags: 0x0}, - 90: {region: 0xe8, script: 0x5, flags: 0x0}, - 91: {region: 0x95, script: 0x5a, flags: 0x0}, - 92: {region: 0xdb, script: 0x22, flags: 0x0}, - 93: {region: 0x2e, script: 0x5a, flags: 0x0}, - 94: {region: 0x52, script: 0x5a, flags: 0x0}, - 95: {region: 0x165, script: 0x5a, flags: 0x0}, + 89: {region: 0x107, script: 0x20, flags: 0x0}, + 90: {region: 0xe9, script: 0x5, flags: 0x0}, + 91: {region: 0x96, script: 0x5b, flags: 0x0}, + 92: {region: 0xdc, script: 0x22, flags: 0x0}, + 93: {region: 0x2e, script: 0x5b, flags: 0x0}, + 94: {region: 0x52, script: 0x5b, flags: 0x0}, + 95: {region: 0x166, script: 0x5b, flags: 0x0}, 96: {region: 0x52, script: 0xb, flags: 0x0}, - 97: {region: 0x165, script: 0x5a, flags: 0x0}, - 98: {region: 0x165, script: 0x5a, flags: 0x0}, - 99: {region: 0x95, script: 0x5a, flags: 0x0}, - 100: {region: 0x165, script: 0x5a, flags: 0x0}, - 101: {region: 0x52, script: 0x5a, flags: 0x0}, - 102: {region: 0x165, script: 0x5a, flags: 0x0}, - 103: {region: 0x165, script: 0x5a, flags: 0x0}, - 104: {region: 0x165, script: 0x5a, flags: 0x0}, - 105: {region: 0x165, script: 0x5a, flags: 0x0}, - 106: {region: 0x4f, script: 0x5a, flags: 0x0}, - 107: {region: 0x165, script: 0x5a, flags: 0x0}, - 108: {region: 0x165, script: 0x5a, flags: 0x0}, - 109: {region: 0x165, script: 0x5a, flags: 0x0}, - 110: {region: 0x165, script: 0x2c, flags: 0x0}, - 111: {region: 0x165, script: 0x5a, flags: 0x0}, - 112: {region: 0x165, script: 0x5a, flags: 0x0}, + 97: {region: 0x166, script: 0x5b, flags: 0x0}, + 98: {region: 0x166, script: 0x5b, flags: 0x0}, + 99: {region: 0x96, script: 0x5b, flags: 0x0}, + 100: {region: 0x166, script: 0x5b, flags: 0x0}, + 101: {region: 0x52, script: 0x5b, flags: 0x0}, + 102: {region: 0x166, script: 0x5b, flags: 0x0}, + 103: {region: 0x166, script: 0x5b, flags: 0x0}, + 104: {region: 0x166, script: 0x5b, flags: 0x0}, + 105: {region: 0x166, script: 0x5b, flags: 0x0}, + 106: {region: 0x4f, script: 0x5b, flags: 0x0}, + 107: {region: 0x166, script: 0x5b, flags: 0x0}, + 108: {region: 0x166, script: 0x5b, flags: 0x0}, + 109: {region: 0x166, script: 0x5b, flags: 0x0}, + 110: {region: 0x166, script: 0x2c, flags: 0x0}, + 111: {region: 0x166, script: 0x5b, flags: 0x0}, + 112: {region: 0x166, script: 0x5b, flags: 0x0}, 113: {region: 0x47, script: 0x20, flags: 0x0}, - 114: {region: 0x165, script: 0x5a, flags: 0x0}, - 115: {region: 0x165, script: 0x5a, flags: 0x0}, - 116: {region: 0x10b, script: 0x5, flags: 0x0}, - 117: {region: 0x162, script: 0x5a, flags: 0x0}, - 118: {region: 0x165, script: 0x5a, flags: 0x0}, - 119: {region: 0x95, script: 0x5a, flags: 0x0}, - 120: {region: 0x165, script: 0x5a, flags: 0x0}, - 121: {region: 0x12f, script: 0x5a, flags: 0x0}, - 122: {region: 0x52, script: 0x5a, flags: 0x0}, - 123: {region: 0x99, script: 0xe3, flags: 0x0}, - 124: {region: 0xe8, script: 0x5, flags: 0x0}, - 125: {region: 0x99, script: 0x22, flags: 0x0}, + 114: {region: 0x166, script: 0x5b, flags: 0x0}, + 115: {region: 0x166, script: 0x5b, flags: 0x0}, + 116: {region: 0x10c, script: 0x5, flags: 0x0}, + 117: {region: 0x163, script: 0x5b, flags: 0x0}, + 118: {region: 0x166, script: 0x5b, flags: 0x0}, + 119: {region: 0x96, script: 0x5b, flags: 0x0}, + 120: {region: 0x166, script: 0x5b, flags: 0x0}, + 121: {region: 0x130, script: 0x5b, flags: 0x0}, + 122: {region: 0x52, script: 0x5b, flags: 0x0}, + 123: {region: 0x9a, script: 0xe6, flags: 0x0}, + 124: {region: 0xe9, script: 0x5, flags: 0x0}, + 125: {region: 0x9a, script: 0x22, flags: 0x0}, 126: {region: 0x38, script: 0x20, flags: 0x0}, - 127: {region: 0x99, script: 0x22, flags: 0x0}, - 128: {region: 0xe8, script: 0x5, flags: 0x0}, - 129: {region: 0x12b, script: 0x34, flags: 0x0}, - 131: {region: 0x99, script: 0x22, flags: 0x0}, - 132: {region: 0x165, script: 0x5a, flags: 0x0}, - 133: {region: 0x99, script: 0x22, flags: 0x0}, - 134: {region: 0xe7, script: 0x5a, flags: 0x0}, - 135: {region: 0x165, script: 0x5a, flags: 0x0}, - 136: {region: 0x99, script: 0x22, flags: 0x0}, - 137: {region: 0x165, script: 0x5a, flags: 0x0}, - 138: {region: 0x13f, script: 0x5a, flags: 0x0}, - 139: {region: 0x165, script: 0x5a, flags: 0x0}, - 140: {region: 0x165, script: 0x5a, flags: 0x0}, - 141: {region: 0xe7, script: 0x5a, flags: 0x0}, - 142: {region: 0x165, script: 0x5a, flags: 0x0}, - 143: {region: 0xd6, script: 0x5a, flags: 0x0}, - 144: {region: 0x165, script: 0x5a, flags: 0x0}, - 145: {region: 0x165, script: 0x5a, flags: 0x0}, - 146: {region: 0x165, script: 0x5a, flags: 0x0}, - 147: {region: 0x165, script: 0x2c, flags: 0x0}, - 148: {region: 0x99, script: 0x22, flags: 0x0}, - 149: {region: 0x95, script: 0x5a, flags: 0x0}, - 150: {region: 0x165, script: 0x5a, flags: 0x0}, - 151: {region: 0x165, script: 0x5a, flags: 0x0}, - 152: {region: 0x114, script: 0x5a, flags: 0x0}, - 153: {region: 0x165, script: 0x5a, flags: 0x0}, - 154: {region: 0x165, script: 0x5a, flags: 0x0}, - 155: {region: 0x52, script: 0x5a, flags: 0x0}, - 156: {region: 0x165, script: 0x5a, flags: 0x0}, - 157: {region: 0xe7, script: 0x5a, flags: 0x0}, - 158: {region: 0x165, script: 0x5a, flags: 0x0}, - 159: {region: 0x13e, script: 0xe5, flags: 0x0}, - 160: {region: 0xc3, script: 0x5a, flags: 0x0}, - 161: {region: 0x165, script: 0x5a, flags: 0x0}, - 162: {region: 0x165, script: 0x5a, flags: 0x0}, - 163: {region: 0xc3, script: 0x5a, flags: 0x0}, - 164: {region: 0x165, script: 0x5a, flags: 0x0}, + 127: {region: 0x9a, script: 0x22, flags: 0x0}, + 128: {region: 0xe9, script: 0x5, flags: 0x0}, + 129: {region: 0x12c, script: 0x34, flags: 0x0}, + 131: {region: 0x9a, script: 0x22, flags: 0x0}, + 132: {region: 0x166, script: 0x5b, flags: 0x0}, + 133: {region: 0x9a, script: 0x22, flags: 0x0}, + 134: {region: 0xe8, script: 0x5b, flags: 0x0}, + 135: {region: 0x166, script: 0x5b, flags: 0x0}, + 136: {region: 0x9a, script: 0x22, flags: 0x0}, + 137: {region: 0x166, script: 0x5b, flags: 0x0}, + 138: {region: 0x140, script: 0x5b, flags: 0x0}, + 139: {region: 0x166, script: 0x5b, flags: 0x0}, + 140: {region: 0x166, script: 0x5b, flags: 0x0}, + 141: {region: 0xe8, script: 0x5b, flags: 0x0}, + 142: {region: 0x166, script: 0x5b, flags: 0x0}, + 143: {region: 0xd7, script: 0x5b, flags: 0x0}, + 144: {region: 0x166, script: 0x5b, flags: 0x0}, + 145: {region: 0x166, script: 0x5b, flags: 0x0}, + 146: {region: 0x166, script: 0x5b, flags: 0x0}, + 147: {region: 0x166, script: 0x2c, flags: 0x0}, + 148: {region: 0x9a, script: 0x22, flags: 0x0}, + 149: {region: 0x96, script: 0x5b, flags: 0x0}, + 150: {region: 0x166, script: 0x5b, flags: 0x0}, + 151: {region: 0x166, script: 0x5b, flags: 0x0}, + 152: {region: 0x115, script: 0x5b, flags: 0x0}, + 153: {region: 0x166, script: 0x5b, flags: 0x0}, + 154: {region: 0x166, script: 0x5b, flags: 0x0}, + 155: {region: 0x52, script: 0x5b, flags: 0x0}, + 156: {region: 0x166, script: 0x5b, flags: 0x0}, + 157: {region: 0xe8, script: 0x5b, flags: 0x0}, + 158: {region: 0x166, script: 0x5b, flags: 0x0}, + 159: {region: 0x13f, script: 0xe8, flags: 0x0}, + 160: {region: 0xc4, script: 0x5b, flags: 0x0}, + 161: {region: 0x166, script: 0x5b, flags: 0x0}, + 162: {region: 0x166, script: 0x5b, flags: 0x0}, + 163: {region: 0xc4, script: 0x5b, flags: 0x0}, + 164: {region: 0x166, script: 0x5b, flags: 0x0}, 165: {region: 0x35, script: 0xe, flags: 0x0}, - 166: {region: 0x165, script: 0x5a, flags: 0x0}, - 167: {region: 0x165, script: 0x5a, flags: 0x0}, - 168: {region: 0x165, script: 0x5a, flags: 0x0}, - 169: {region: 0x53, script: 0xec, flags: 0x0}, - 170: {region: 0x165, script: 0x5a, flags: 0x0}, - 171: {region: 0x165, script: 0x5a, flags: 0x0}, - 172: {region: 0x165, script: 0x5a, flags: 0x0}, - 173: {region: 0x99, script: 0xe, flags: 0x0}, - 174: {region: 0x165, script: 0x5a, flags: 0x0}, - 175: {region: 0x9c, script: 0x5, flags: 0x0}, - 176: {region: 0x165, script: 0x5a, flags: 0x0}, - 177: {region: 0x4f, script: 0x5a, flags: 0x0}, - 178: {region: 0x78, script: 0x5a, flags: 0x0}, - 179: {region: 0x99, script: 0x22, flags: 0x0}, - 180: {region: 0xe8, script: 0x5, flags: 0x0}, - 181: {region: 0x99, script: 0x22, flags: 0x0}, - 182: {region: 0x165, script: 0x5a, flags: 0x0}, - 183: {region: 0x33, script: 0x5a, flags: 0x0}, - 184: {region: 0x165, script: 0x5a, flags: 0x0}, - 185: {region: 0xb4, script: 0xc, flags: 0x0}, - 186: {region: 0x52, script: 0x5a, flags: 0x0}, - 187: {region: 0x165, script: 0x2c, flags: 0x0}, - 188: {region: 0xe7, script: 0x5a, flags: 0x0}, - 189: {region: 0x165, script: 0x5a, flags: 0x0}, - 190: {region: 0xe8, script: 0x22, flags: 0x0}, - 191: {region: 0x106, script: 0x20, flags: 0x0}, - 192: {region: 0x15f, script: 0x5a, flags: 0x0}, - 193: {region: 0x165, script: 0x5a, flags: 0x0}, - 194: {region: 0x95, script: 0x5a, flags: 0x0}, - 195: {region: 0x165, script: 0x5a, flags: 0x0}, - 196: {region: 0x52, script: 0x5a, flags: 0x0}, - 197: {region: 0x165, script: 0x5a, flags: 0x0}, - 198: {region: 0x165, script: 0x5a, flags: 0x0}, - 199: {region: 0x165, script: 0x5a, flags: 0x0}, - 200: {region: 0x86, script: 0x5a, flags: 0x0}, - 201: {region: 0x165, script: 0x5a, flags: 0x0}, - 202: {region: 0x165, script: 0x5a, flags: 0x0}, - 203: {region: 0x165, script: 0x5a, flags: 0x0}, - 204: {region: 0x165, script: 0x5a, flags: 0x0}, - 205: {region: 0x6d, script: 0x2c, flags: 0x0}, - 206: {region: 0x165, script: 0x5a, flags: 0x0}, - 207: {region: 0x165, script: 0x5a, flags: 0x0}, - 208: {region: 0x52, script: 0x5a, flags: 0x0}, - 209: {region: 0x165, script: 0x5a, flags: 0x0}, - 210: {region: 0x165, script: 0x5a, flags: 0x0}, - 211: {region: 0xc3, script: 0x5a, flags: 0x0}, - 212: {region: 0x165, script: 0x5a, flags: 0x0}, - 213: {region: 0x165, script: 0x5a, flags: 0x0}, - 214: {region: 0x165, script: 0x5a, flags: 0x0}, - 215: {region: 0x6e, script: 0x5a, flags: 0x0}, - 216: {region: 0x165, script: 0x5a, flags: 0x0}, - 217: {region: 0x165, script: 0x5a, flags: 0x0}, - 218: {region: 0xd6, script: 0x5a, flags: 0x0}, + 166: {region: 0x166, script: 0x5b, flags: 0x0}, + 167: {region: 0x166, script: 0x5b, flags: 0x0}, + 168: {region: 0x166, script: 0x5b, flags: 0x0}, + 169: {region: 0x53, script: 0xef, flags: 0x0}, + 170: {region: 0x166, script: 0x5b, flags: 0x0}, + 171: {region: 0x166, script: 0x5b, flags: 0x0}, + 172: {region: 0x166, script: 0x5b, flags: 0x0}, + 173: {region: 0x9a, script: 0xe, flags: 0x0}, + 174: {region: 0x166, script: 0x5b, flags: 0x0}, + 175: {region: 0x9d, script: 0x5, flags: 0x0}, + 176: {region: 0x166, script: 0x5b, flags: 0x0}, + 177: {region: 0x4f, script: 0x5b, flags: 0x0}, + 178: {region: 0x79, script: 0x5b, flags: 0x0}, + 179: {region: 0x9a, script: 0x22, flags: 0x0}, + 180: {region: 0xe9, script: 0x5, flags: 0x0}, + 181: {region: 0x9a, script: 0x22, flags: 0x0}, + 182: {region: 0x166, script: 0x5b, flags: 0x0}, + 183: {region: 0x33, script: 0x5b, flags: 0x0}, + 184: {region: 0x166, script: 0x5b, flags: 0x0}, + 185: {region: 0xb5, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x5b, flags: 0x0}, + 187: {region: 0x166, script: 0x2c, flags: 0x0}, + 188: {region: 0xe8, script: 0x5b, flags: 0x0}, + 189: {region: 0x166, script: 0x5b, flags: 0x0}, + 190: {region: 0xe9, script: 0x22, flags: 0x0}, + 191: {region: 0x107, script: 0x20, flags: 0x0}, + 192: {region: 0x160, script: 0x5b, flags: 0x0}, + 193: {region: 0x166, script: 0x5b, flags: 0x0}, + 194: {region: 0x96, script: 0x5b, flags: 0x0}, + 195: {region: 0x166, script: 0x5b, flags: 0x0}, + 196: {region: 0x52, script: 0x5b, flags: 0x0}, + 197: {region: 0x166, script: 0x5b, flags: 0x0}, + 198: {region: 0x166, script: 0x5b, flags: 0x0}, + 199: {region: 0x166, script: 0x5b, flags: 0x0}, + 200: {region: 0x87, script: 0x5b, flags: 0x0}, + 201: {region: 0x166, script: 0x5b, flags: 0x0}, + 202: {region: 0x166, script: 0x5b, flags: 0x0}, + 203: {region: 0x166, script: 0x5b, flags: 0x0}, + 204: {region: 0x166, script: 0x5b, flags: 0x0}, + 205: {region: 0x6e, script: 0x2c, flags: 0x0}, + 206: {region: 0x166, script: 0x5b, flags: 0x0}, + 207: {region: 0x166, script: 0x5b, flags: 0x0}, + 208: {region: 0x52, script: 0x5b, flags: 0x0}, + 209: {region: 0x166, script: 0x5b, flags: 0x0}, + 210: {region: 0x166, script: 0x5b, flags: 0x0}, + 211: {region: 0xc4, script: 0x5b, flags: 0x0}, + 212: {region: 0x166, script: 0x5b, flags: 0x0}, + 213: {region: 0x166, script: 0x5b, flags: 0x0}, + 214: {region: 0x166, script: 0x5b, flags: 0x0}, + 215: {region: 0x6f, script: 0x5b, flags: 0x0}, + 216: {region: 0x166, script: 0x5b, flags: 0x0}, + 217: {region: 0x166, script: 0x5b, flags: 0x0}, + 218: {region: 0xd7, script: 0x5b, flags: 0x0}, 219: {region: 0x35, script: 0x16, flags: 0x0}, - 220: {region: 0x106, script: 0x20, flags: 0x0}, - 221: {region: 0xe7, script: 0x5a, flags: 0x0}, - 222: {region: 0x165, script: 0x5a, flags: 0x0}, - 223: {region: 0x131, script: 0x5a, flags: 0x0}, - 224: {region: 0x8a, script: 0x5a, flags: 0x0}, - 225: {region: 0x75, script: 0x5a, flags: 0x0}, - 226: {region: 0x106, script: 0x20, flags: 0x0}, - 227: {region: 0x135, script: 0x5a, flags: 0x0}, - 228: {region: 0x49, script: 0x5a, flags: 0x0}, - 229: {region: 0x135, script: 0x1a, flags: 0x0}, - 230: {region: 0xa6, script: 0x5, flags: 0x0}, - 231: {region: 0x13e, script: 0x19, flags: 0x0}, - 232: {region: 0x165, script: 0x5a, flags: 0x0}, - 233: {region: 0x9b, script: 0x5, flags: 0x0}, - 234: {region: 0x165, script: 0x5a, flags: 0x0}, - 235: {region: 0x165, script: 0x5a, flags: 0x0}, - 236: {region: 0x165, script: 0x5a, flags: 0x0}, - 237: {region: 0x165, script: 0x5a, flags: 0x0}, - 238: {region: 0x165, script: 0x5a, flags: 0x0}, - 239: {region: 0xc5, script: 0xd8, flags: 0x0}, - 240: {region: 0x78, script: 0x5a, flags: 0x0}, - 241: {region: 0x6b, script: 0x1d, flags: 0x0}, - 242: {region: 0xe7, script: 0x5a, flags: 0x0}, + 220: {region: 0x107, script: 0x20, flags: 0x0}, + 221: {region: 0xe8, script: 0x5b, flags: 0x0}, + 222: {region: 0x166, script: 0x5b, flags: 0x0}, + 223: {region: 0x132, script: 0x5b, flags: 0x0}, + 224: {region: 0x8b, script: 0x5b, flags: 0x0}, + 225: {region: 0x76, script: 0x5b, flags: 0x0}, + 226: {region: 0x107, script: 0x20, flags: 0x0}, + 227: {region: 0x136, script: 0x5b, flags: 0x0}, + 228: {region: 0x49, script: 0x5b, flags: 0x0}, + 229: {region: 0x136, script: 0x1a, flags: 0x0}, + 230: {region: 0xa7, script: 0x5, flags: 0x0}, + 231: {region: 0x13f, script: 0x19, flags: 0x0}, + 232: {region: 0x166, script: 0x5b, flags: 0x0}, + 233: {region: 0x9c, script: 0x5, flags: 0x0}, + 234: {region: 0x166, script: 0x5b, flags: 0x0}, + 235: {region: 0x166, script: 0x5b, flags: 0x0}, + 236: {region: 0x166, script: 0x5b, flags: 0x0}, + 237: {region: 0x166, script: 0x5b, flags: 0x0}, + 238: {region: 0x166, script: 0x5b, flags: 0x0}, + 239: {region: 0xc6, script: 0xda, flags: 0x0}, + 240: {region: 0x79, script: 0x5b, flags: 0x0}, + 241: {region: 0x6c, script: 0x1d, flags: 0x0}, + 242: {region: 0xe8, script: 0x5b, flags: 0x0}, 243: {region: 0x49, script: 0x17, flags: 0x0}, - 244: {region: 0x130, script: 0x20, flags: 0x0}, + 244: {region: 0x131, script: 0x20, flags: 0x0}, 245: {region: 0x49, script: 0x17, flags: 0x0}, 246: {region: 0x49, script: 0x17, flags: 0x0}, 247: {region: 0x49, script: 0x17, flags: 0x0}, 248: {region: 0x49, script: 0x17, flags: 0x0}, - 249: {region: 0x10a, script: 0x5a, flags: 0x0}, - 250: {region: 0x5e, script: 0x5a, flags: 0x0}, - 251: {region: 0xe9, script: 0x5a, flags: 0x0}, + 249: {region: 0x10b, script: 0x5b, flags: 0x0}, + 250: {region: 0x5f, script: 0x5b, flags: 0x0}, + 251: {region: 0xea, script: 0x5b, flags: 0x0}, 252: {region: 0x49, script: 0x17, flags: 0x0}, - 253: {region: 0xc4, script: 0x86, flags: 0x0}, + 253: {region: 0xc5, script: 0x88, flags: 0x0}, 254: {region: 0x8, script: 0x2, flags: 0x1}, - 255: {region: 0x106, script: 0x20, flags: 0x0}, - 256: {region: 0x7b, script: 0x5a, flags: 0x0}, - 257: {region: 0x63, script: 0x5a, flags: 0x0}, - 258: {region: 0x165, script: 0x5a, flags: 0x0}, - 259: {region: 0x165, script: 0x5a, flags: 0x0}, - 260: {region: 0x165, script: 0x5a, flags: 0x0}, - 261: {region: 0x165, script: 0x5a, flags: 0x0}, - 262: {region: 0x135, script: 0x5a, flags: 0x0}, - 263: {region: 0x106, script: 0x20, flags: 0x0}, - 264: {region: 0xa4, script: 0x5a, flags: 0x0}, - 265: {region: 0x165, script: 0x5a, flags: 0x0}, - 266: {region: 0x165, script: 0x5a, flags: 0x0}, - 267: {region: 0x99, script: 0x5, flags: 0x0}, - 268: {region: 0x165, script: 0x5a, flags: 0x0}, - 269: {region: 0x60, script: 0x5a, flags: 0x0}, - 270: {region: 0x165, script: 0x5a, flags: 0x0}, - 271: {region: 0x49, script: 0x5a, flags: 0x0}, - 272: {region: 0x165, script: 0x5a, flags: 0x0}, - 273: {region: 0x165, script: 0x5a, flags: 0x0}, - 274: {region: 0x165, script: 0x5a, flags: 0x0}, - 275: {region: 0x165, script: 0x5, flags: 0x0}, - 276: {region: 0x49, script: 0x5a, flags: 0x0}, - 277: {region: 0x165, script: 0x5a, flags: 0x0}, - 278: {region: 0x165, script: 0x5a, flags: 0x0}, - 279: {region: 0xd4, script: 0x5a, flags: 0x0}, - 280: {region: 0x4f, script: 0x5a, flags: 0x0}, - 281: {region: 0x165, script: 0x5a, flags: 0x0}, - 282: {region: 0x99, script: 0x5, flags: 0x0}, - 283: {region: 0x165, script: 0x5a, flags: 0x0}, - 284: {region: 0x165, script: 0x5a, flags: 0x0}, - 285: {region: 0x165, script: 0x5a, flags: 0x0}, - 286: {region: 0x165, script: 0x2c, flags: 0x0}, - 287: {region: 0x60, script: 0x5a, flags: 0x0}, - 288: {region: 0xc3, script: 0x5a, flags: 0x0}, - 289: {region: 0xd0, script: 0x5a, flags: 0x0}, - 290: {region: 0x165, script: 0x5a, flags: 0x0}, - 291: {region: 0xdb, script: 0x22, flags: 0x0}, - 292: {region: 0x52, script: 0x5a, flags: 0x0}, - 293: {region: 0x165, script: 0x5a, flags: 0x0}, - 294: {region: 0x165, script: 0x5a, flags: 0x0}, - 295: {region: 0x165, script: 0x5a, flags: 0x0}, - 296: {region: 0xcd, script: 0xea, flags: 0x0}, - 297: {region: 0x165, script: 0x5a, flags: 0x0}, - 298: {region: 0x165, script: 0x5a, flags: 0x0}, - 299: {region: 0x114, script: 0x5a, flags: 0x0}, - 300: {region: 0x37, script: 0x5a, flags: 0x0}, - 301: {region: 0x43, script: 0xec, flags: 0x0}, - 302: {region: 0x165, script: 0x5a, flags: 0x0}, - 303: {region: 0xa4, script: 0x5a, flags: 0x0}, - 304: {region: 0x80, script: 0x5a, flags: 0x0}, - 305: {region: 0xd6, script: 0x5a, flags: 0x0}, - 306: {region: 0x9e, script: 0x5a, flags: 0x0}, - 307: {region: 0x6b, script: 0x29, flags: 0x0}, - 308: {region: 0x165, script: 0x5a, flags: 0x0}, - 309: {region: 0xc4, script: 0x4b, flags: 0x0}, - 310: {region: 0x87, script: 0x34, flags: 0x0}, - 311: {region: 0x165, script: 0x5a, flags: 0x0}, - 312: {region: 0x165, script: 0x5a, flags: 0x0}, + 255: {region: 0x107, script: 0x20, flags: 0x0}, + 256: {region: 0x7c, script: 0x5b, flags: 0x0}, + 257: {region: 0x64, script: 0x5b, flags: 0x0}, + 258: {region: 0x166, script: 0x5b, flags: 0x0}, + 259: {region: 0x166, script: 0x5b, flags: 0x0}, + 260: {region: 0x166, script: 0x5b, flags: 0x0}, + 261: {region: 0x166, script: 0x5b, flags: 0x0}, + 262: {region: 0x136, script: 0x5b, flags: 0x0}, + 263: {region: 0x107, script: 0x20, flags: 0x0}, + 264: {region: 0xa5, script: 0x5b, flags: 0x0}, + 265: {region: 0x166, script: 0x5b, flags: 0x0}, + 266: {region: 0x166, script: 0x5b, flags: 0x0}, + 267: {region: 0x9a, script: 0x5, flags: 0x0}, + 268: {region: 0x166, script: 0x5b, flags: 0x0}, + 269: {region: 0x61, script: 0x5b, flags: 0x0}, + 270: {region: 0x166, script: 0x5b, flags: 0x0}, + 271: {region: 0x49, script: 0x5b, flags: 0x0}, + 272: {region: 0x166, script: 0x5b, flags: 0x0}, + 273: {region: 0x166, script: 0x5b, flags: 0x0}, + 274: {region: 0x166, script: 0x5b, flags: 0x0}, + 275: {region: 0x166, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x5b, flags: 0x0}, + 277: {region: 0x166, script: 0x5b, flags: 0x0}, + 278: {region: 0x166, script: 0x5b, flags: 0x0}, + 279: {region: 0xd5, script: 0x5b, flags: 0x0}, + 280: {region: 0x4f, script: 0x5b, flags: 0x0}, + 281: {region: 0x166, script: 0x5b, flags: 0x0}, + 282: {region: 0x9a, script: 0x5, flags: 0x0}, + 283: {region: 0x166, script: 0x5b, flags: 0x0}, + 284: {region: 0x166, script: 0x5b, flags: 0x0}, + 285: {region: 0x166, script: 0x5b, flags: 0x0}, + 286: {region: 0x166, script: 0x2c, flags: 0x0}, + 287: {region: 0x61, script: 0x5b, flags: 0x0}, + 288: {region: 0xc4, script: 0x5b, flags: 0x0}, + 289: {region: 0xd1, script: 0x5b, flags: 0x0}, + 290: {region: 0x166, script: 0x5b, flags: 0x0}, + 291: {region: 0xdc, script: 0x22, flags: 0x0}, + 292: {region: 0x52, script: 0x5b, flags: 0x0}, + 293: {region: 0x166, script: 0x5b, flags: 0x0}, + 294: {region: 0x166, script: 0x5b, flags: 0x0}, + 295: {region: 0x166, script: 0x5b, flags: 0x0}, + 296: {region: 0xce, script: 0xed, flags: 0x0}, + 297: {region: 0x166, script: 0x5b, flags: 0x0}, + 298: {region: 0x166, script: 0x5b, flags: 0x0}, + 299: {region: 0x115, script: 0x5b, flags: 0x0}, + 300: {region: 0x37, script: 0x5b, flags: 0x0}, + 301: {region: 0x43, script: 0xef, flags: 0x0}, + 302: {region: 0x166, script: 0x5b, flags: 0x0}, + 303: {region: 0xa5, script: 0x5b, flags: 0x0}, + 304: {region: 0x81, script: 0x5b, flags: 0x0}, + 305: {region: 0xd7, script: 0x5b, flags: 0x0}, + 306: {region: 0x9f, script: 0x5b, flags: 0x0}, + 307: {region: 0x6c, script: 0x29, flags: 0x0}, + 308: {region: 0x166, script: 0x5b, flags: 0x0}, + 309: {region: 0xc5, script: 0x4b, flags: 0x0}, + 310: {region: 0x88, script: 0x34, flags: 0x0}, + 311: {region: 0x166, script: 0x5b, flags: 0x0}, + 312: {region: 0x166, script: 0x5b, flags: 0x0}, 313: {region: 0xa, script: 0x2, flags: 0x1}, - 314: {region: 0x165, script: 0x5a, flags: 0x0}, - 315: {region: 0x165, script: 0x5a, flags: 0x0}, - 316: {region: 0x1, script: 0x5a, flags: 0x0}, - 317: {region: 0x165, script: 0x5a, flags: 0x0}, - 318: {region: 0x6e, script: 0x5a, flags: 0x0}, - 319: {region: 0x135, script: 0x5a, flags: 0x0}, - 320: {region: 0x6a, script: 0x5a, flags: 0x0}, - 321: {region: 0x165, script: 0x5a, flags: 0x0}, - 322: {region: 0x9e, script: 0x46, flags: 0x0}, - 323: {region: 0x165, script: 0x5a, flags: 0x0}, - 324: {region: 0x165, script: 0x5a, flags: 0x0}, - 325: {region: 0x6e, script: 0x5a, flags: 0x0}, - 326: {region: 0x52, script: 0x5a, flags: 0x0}, - 327: {region: 0x6e, script: 0x5a, flags: 0x0}, - 328: {region: 0x9c, script: 0x5, flags: 0x0}, - 329: {region: 0x165, script: 0x5a, flags: 0x0}, - 330: {region: 0x165, script: 0x5a, flags: 0x0}, - 331: {region: 0x165, script: 0x5a, flags: 0x0}, - 332: {region: 0x165, script: 0x5a, flags: 0x0}, - 333: {region: 0x86, script: 0x5a, flags: 0x0}, + 314: {region: 0x166, script: 0x5b, flags: 0x0}, + 315: {region: 0x166, script: 0x5b, flags: 0x0}, + 316: {region: 0x1, script: 0x5b, flags: 0x0}, + 317: {region: 0x166, script: 0x5b, flags: 0x0}, + 318: {region: 0x6f, script: 0x5b, flags: 0x0}, + 319: {region: 0x136, script: 0x5b, flags: 0x0}, + 320: {region: 0x6b, script: 0x5b, flags: 0x0}, + 321: {region: 0x166, script: 0x5b, flags: 0x0}, + 322: {region: 0x9f, script: 0x46, flags: 0x0}, + 323: {region: 0x166, script: 0x5b, flags: 0x0}, + 324: {region: 0x166, script: 0x5b, flags: 0x0}, + 325: {region: 0x6f, script: 0x5b, flags: 0x0}, + 326: {region: 0x52, script: 0x5b, flags: 0x0}, + 327: {region: 0x6f, script: 0x5b, flags: 0x0}, + 328: {region: 0x9d, script: 0x5, flags: 0x0}, + 329: {region: 0x166, script: 0x5b, flags: 0x0}, + 330: {region: 0x166, script: 0x5b, flags: 0x0}, + 331: {region: 0x166, script: 0x5b, flags: 0x0}, + 332: {region: 0x166, script: 0x5b, flags: 0x0}, + 333: {region: 0x87, script: 0x5b, flags: 0x0}, 334: {region: 0xc, script: 0x2, flags: 0x1}, - 335: {region: 0x165, script: 0x5a, flags: 0x0}, - 336: {region: 0xc3, script: 0x5a, flags: 0x0}, - 337: {region: 0x72, script: 0x5a, flags: 0x0}, - 338: {region: 0x10b, script: 0x5, flags: 0x0}, - 339: {region: 0xe7, script: 0x5a, flags: 0x0}, - 340: {region: 0x10c, script: 0x5a, flags: 0x0}, - 341: {region: 0x73, script: 0x5a, flags: 0x0}, - 342: {region: 0x165, script: 0x5a, flags: 0x0}, - 343: {region: 0x165, script: 0x5a, flags: 0x0}, - 344: {region: 0x76, script: 0x5a, flags: 0x0}, - 345: {region: 0x165, script: 0x5a, flags: 0x0}, - 346: {region: 0x3b, script: 0x5a, flags: 0x0}, - 347: {region: 0x165, script: 0x5a, flags: 0x0}, - 348: {region: 0x165, script: 0x5a, flags: 0x0}, - 349: {region: 0x165, script: 0x5a, flags: 0x0}, - 350: {region: 0x78, script: 0x5a, flags: 0x0}, - 351: {region: 0x135, script: 0x5a, flags: 0x0}, - 352: {region: 0x78, script: 0x5a, flags: 0x0}, - 353: {region: 0x60, script: 0x5a, flags: 0x0}, - 354: {region: 0x60, script: 0x5a, flags: 0x0}, + 335: {region: 0x166, script: 0x5b, flags: 0x0}, + 336: {region: 0xc4, script: 0x5b, flags: 0x0}, + 337: {region: 0x73, script: 0x5b, flags: 0x0}, + 338: {region: 0x10c, script: 0x5, flags: 0x0}, + 339: {region: 0xe8, script: 0x5b, flags: 0x0}, + 340: {region: 0x10d, script: 0x5b, flags: 0x0}, + 341: {region: 0x74, script: 0x5b, flags: 0x0}, + 342: {region: 0x166, script: 0x5b, flags: 0x0}, + 343: {region: 0x166, script: 0x5b, flags: 0x0}, + 344: {region: 0x77, script: 0x5b, flags: 0x0}, + 345: {region: 0x166, script: 0x5b, flags: 0x0}, + 346: {region: 0x3b, script: 0x5b, flags: 0x0}, + 347: {region: 0x166, script: 0x5b, flags: 0x0}, + 348: {region: 0x166, script: 0x5b, flags: 0x0}, + 349: {region: 0x166, script: 0x5b, flags: 0x0}, + 350: {region: 0x79, script: 0x5b, flags: 0x0}, + 351: {region: 0x136, script: 0x5b, flags: 0x0}, + 352: {region: 0x79, script: 0x5b, flags: 0x0}, + 353: {region: 0x61, script: 0x5b, flags: 0x0}, + 354: {region: 0x61, script: 0x5b, flags: 0x0}, 355: {region: 0x52, script: 0x5, flags: 0x0}, - 356: {region: 0x140, script: 0x5a, flags: 0x0}, - 357: {region: 0x165, script: 0x5a, flags: 0x0}, - 358: {region: 0x84, script: 0x5a, flags: 0x0}, - 359: {region: 0x165, script: 0x5a, flags: 0x0}, - 360: {region: 0xd4, script: 0x5a, flags: 0x0}, - 361: {region: 0x9e, script: 0x5a, flags: 0x0}, - 362: {region: 0xd6, script: 0x5a, flags: 0x0}, - 363: {region: 0x165, script: 0x5a, flags: 0x0}, - 364: {region: 0x10b, script: 0x5a, flags: 0x0}, - 365: {region: 0xd9, script: 0x5a, flags: 0x0}, - 366: {region: 0x96, script: 0x5a, flags: 0x0}, - 367: {region: 0x80, script: 0x5a, flags: 0x0}, - 368: {region: 0x165, script: 0x5a, flags: 0x0}, - 369: {region: 0xbc, script: 0x5a, flags: 0x0}, - 370: {region: 0x165, script: 0x5a, flags: 0x0}, - 371: {region: 0x165, script: 0x5a, flags: 0x0}, - 372: {region: 0x165, script: 0x5a, flags: 0x0}, + 356: {region: 0x141, script: 0x5b, flags: 0x0}, + 357: {region: 0x166, script: 0x5b, flags: 0x0}, + 358: {region: 0x85, script: 0x5b, flags: 0x0}, + 359: {region: 0x166, script: 0x5b, flags: 0x0}, + 360: {region: 0xd5, script: 0x5b, flags: 0x0}, + 361: {region: 0x9f, script: 0x5b, flags: 0x0}, + 362: {region: 0xd7, script: 0x5b, flags: 0x0}, + 363: {region: 0x166, script: 0x5b, flags: 0x0}, + 364: {region: 0x10c, script: 0x5b, flags: 0x0}, + 365: {region: 0xda, script: 0x5b, flags: 0x0}, + 366: {region: 0x97, script: 0x5b, flags: 0x0}, + 367: {region: 0x81, script: 0x5b, flags: 0x0}, + 368: {region: 0x166, script: 0x5b, flags: 0x0}, + 369: {region: 0xbd, script: 0x5b, flags: 0x0}, + 370: {region: 0x166, script: 0x5b, flags: 0x0}, + 371: {region: 0x166, script: 0x5b, flags: 0x0}, + 372: {region: 0x166, script: 0x5b, flags: 0x0}, 373: {region: 0x53, script: 0x3b, flags: 0x0}, - 374: {region: 0x165, script: 0x5a, flags: 0x0}, - 375: {region: 0x95, script: 0x5a, flags: 0x0}, - 376: {region: 0x165, script: 0x5a, flags: 0x0}, - 377: {region: 0x165, script: 0x5a, flags: 0x0}, - 378: {region: 0x99, script: 0x22, flags: 0x0}, - 379: {region: 0x165, script: 0x5a, flags: 0x0}, - 380: {region: 0x9c, script: 0x5, flags: 0x0}, - 381: {region: 0x7e, script: 0x5a, flags: 0x0}, - 382: {region: 0x7b, script: 0x5a, flags: 0x0}, - 383: {region: 0x165, script: 0x5a, flags: 0x0}, - 384: {region: 0x165, script: 0x5a, flags: 0x0}, - 385: {region: 0x165, script: 0x5a, flags: 0x0}, - 386: {region: 0x165, script: 0x5a, flags: 0x0}, - 387: {region: 0x165, script: 0x5a, flags: 0x0}, - 388: {region: 0x165, script: 0x5a, flags: 0x0}, - 389: {region: 0x6f, script: 0x2c, flags: 0x0}, - 390: {region: 0x165, script: 0x5a, flags: 0x0}, - 391: {region: 0xdb, script: 0x22, flags: 0x0}, - 392: {region: 0x165, script: 0x5a, flags: 0x0}, - 393: {region: 0xa7, script: 0x5a, flags: 0x0}, - 394: {region: 0x165, script: 0x5a, flags: 0x0}, - 395: {region: 0xe8, script: 0x5, flags: 0x0}, - 396: {region: 0x165, script: 0x5a, flags: 0x0}, - 397: {region: 0xe8, script: 0x5, flags: 0x0}, - 398: {region: 0x165, script: 0x5a, flags: 0x0}, - 399: {region: 0x165, script: 0x5a, flags: 0x0}, - 400: {region: 0x6e, script: 0x5a, flags: 0x0}, - 401: {region: 0x9c, script: 0x5, flags: 0x0}, - 402: {region: 0x165, script: 0x5a, flags: 0x0}, - 403: {region: 0x165, script: 0x2c, flags: 0x0}, - 404: {region: 0xf1, script: 0x5a, flags: 0x0}, - 405: {region: 0x165, script: 0x5a, flags: 0x0}, - 406: {region: 0x165, script: 0x5a, flags: 0x0}, - 407: {region: 0x165, script: 0x5a, flags: 0x0}, - 408: {region: 0x165, script: 0x2c, flags: 0x0}, - 409: {region: 0x165, script: 0x5a, flags: 0x0}, - 410: {region: 0x99, script: 0x22, flags: 0x0}, - 411: {region: 0x99, script: 0xe6, flags: 0x0}, - 412: {region: 0x95, script: 0x5a, flags: 0x0}, - 413: {region: 0xd9, script: 0x5a, flags: 0x0}, - 414: {region: 0x130, script: 0x32, flags: 0x0}, - 415: {region: 0x165, script: 0x5a, flags: 0x0}, + 374: {region: 0x166, script: 0x5b, flags: 0x0}, + 375: {region: 0x96, script: 0x5b, flags: 0x0}, + 376: {region: 0x166, script: 0x5b, flags: 0x0}, + 377: {region: 0x166, script: 0x5b, flags: 0x0}, + 378: {region: 0x9a, script: 0x22, flags: 0x0}, + 379: {region: 0x166, script: 0x5b, flags: 0x0}, + 380: {region: 0x9d, script: 0x5, flags: 0x0}, + 381: {region: 0x7f, script: 0x5b, flags: 0x0}, + 382: {region: 0x7c, script: 0x5b, flags: 0x0}, + 383: {region: 0x166, script: 0x5b, flags: 0x0}, + 384: {region: 0x166, script: 0x5b, flags: 0x0}, + 385: {region: 0x166, script: 0x5b, flags: 0x0}, + 386: {region: 0x166, script: 0x5b, flags: 0x0}, + 387: {region: 0x166, script: 0x5b, flags: 0x0}, + 388: {region: 0x166, script: 0x5b, flags: 0x0}, + 389: {region: 0x70, script: 0x2c, flags: 0x0}, + 390: {region: 0x166, script: 0x5b, flags: 0x0}, + 391: {region: 0xdc, script: 0x22, flags: 0x0}, + 392: {region: 0x166, script: 0x5b, flags: 0x0}, + 393: {region: 0xa8, script: 0x5b, flags: 0x0}, + 394: {region: 0x166, script: 0x5b, flags: 0x0}, + 395: {region: 0xe9, script: 0x5, flags: 0x0}, + 396: {region: 0x166, script: 0x5b, flags: 0x0}, + 397: {region: 0xe9, script: 0x5, flags: 0x0}, + 398: {region: 0x166, script: 0x5b, flags: 0x0}, + 399: {region: 0x166, script: 0x5b, flags: 0x0}, + 400: {region: 0x6f, script: 0x5b, flags: 0x0}, + 401: {region: 0x9d, script: 0x5, flags: 0x0}, + 402: {region: 0x166, script: 0x5b, flags: 0x0}, + 403: {region: 0x166, script: 0x2c, flags: 0x0}, + 404: {region: 0xf2, script: 0x5b, flags: 0x0}, + 405: {region: 0x166, script: 0x5b, flags: 0x0}, + 406: {region: 0x166, script: 0x5b, flags: 0x0}, + 407: {region: 0x166, script: 0x5b, flags: 0x0}, + 408: {region: 0x166, script: 0x2c, flags: 0x0}, + 409: {region: 0x166, script: 0x5b, flags: 0x0}, + 410: {region: 0x9a, script: 0x22, flags: 0x0}, + 411: {region: 0x9a, script: 0xe9, flags: 0x0}, + 412: {region: 0x96, script: 0x5b, flags: 0x0}, + 413: {region: 0xda, script: 0x5b, flags: 0x0}, + 414: {region: 0x131, script: 0x32, flags: 0x0}, + 415: {region: 0x166, script: 0x5b, flags: 0x0}, 416: {region: 0xe, script: 0x2, flags: 0x1}, - 417: {region: 0x99, script: 0xe, flags: 0x0}, - 418: {region: 0x165, script: 0x5a, flags: 0x0}, - 419: {region: 0x4e, script: 0x5a, flags: 0x0}, - 420: {region: 0x99, script: 0x35, flags: 0x0}, - 421: {region: 0x41, script: 0x5a, flags: 0x0}, - 422: {region: 0x54, script: 0x5a, flags: 0x0}, - 423: {region: 0x165, script: 0x5a, flags: 0x0}, - 424: {region: 0x80, script: 0x5a, flags: 0x0}, - 425: {region: 0x165, script: 0x5a, flags: 0x0}, - 426: {region: 0x165, script: 0x5a, flags: 0x0}, - 427: {region: 0xa4, script: 0x5a, flags: 0x0}, - 428: {region: 0x98, script: 0x5a, flags: 0x0}, - 429: {region: 0x165, script: 0x5a, flags: 0x0}, - 430: {region: 0xdb, script: 0x22, flags: 0x0}, - 431: {region: 0x165, script: 0x5a, flags: 0x0}, - 432: {region: 0x165, script: 0x5, flags: 0x0}, - 433: {region: 0x49, script: 0x5a, flags: 0x0}, - 434: {region: 0x165, script: 0x5, flags: 0x0}, - 435: {region: 0x165, script: 0x5a, flags: 0x0}, + 417: {region: 0x9a, script: 0xe, flags: 0x0}, + 418: {region: 0x166, script: 0x5b, flags: 0x0}, + 419: {region: 0x4e, script: 0x5b, flags: 0x0}, + 420: {region: 0x9a, script: 0x35, flags: 0x0}, + 421: {region: 0x41, script: 0x5b, flags: 0x0}, + 422: {region: 0x54, script: 0x5b, flags: 0x0}, + 423: {region: 0x166, script: 0x5b, flags: 0x0}, + 424: {region: 0x81, script: 0x5b, flags: 0x0}, + 425: {region: 0x166, script: 0x5b, flags: 0x0}, + 426: {region: 0x166, script: 0x5b, flags: 0x0}, + 427: {region: 0xa5, script: 0x5b, flags: 0x0}, + 428: {region: 0x99, script: 0x5b, flags: 0x0}, + 429: {region: 0x166, script: 0x5b, flags: 0x0}, + 430: {region: 0xdc, script: 0x22, flags: 0x0}, + 431: {region: 0x166, script: 0x5b, flags: 0x0}, + 432: {region: 0x166, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x5b, flags: 0x0}, + 434: {region: 0x166, script: 0x5, flags: 0x0}, + 435: {region: 0x166, script: 0x5b, flags: 0x0}, 436: {region: 0x10, script: 0x3, flags: 0x1}, - 437: {region: 0x165, script: 0x5a, flags: 0x0}, + 437: {region: 0x166, script: 0x5b, flags: 0x0}, 438: {region: 0x53, script: 0x3b, flags: 0x0}, - 439: {region: 0x165, script: 0x5a, flags: 0x0}, - 440: {region: 0x135, script: 0x5a, flags: 0x0}, + 439: {region: 0x166, script: 0x5b, flags: 0x0}, + 440: {region: 0x136, script: 0x5b, flags: 0x0}, 441: {region: 0x24, script: 0x5, flags: 0x0}, - 442: {region: 0x165, script: 0x5a, flags: 0x0}, - 443: {region: 0x165, script: 0x2c, flags: 0x0}, - 444: {region: 0x97, script: 0x3e, flags: 0x0}, - 445: {region: 0x165, script: 0x5a, flags: 0x0}, - 446: {region: 0x99, script: 0x22, flags: 0x0}, - 447: {region: 0x165, script: 0x5a, flags: 0x0}, - 448: {region: 0x73, script: 0x5a, flags: 0x0}, - 449: {region: 0x165, script: 0x5a, flags: 0x0}, - 450: {region: 0x165, script: 0x5a, flags: 0x0}, - 451: {region: 0xe7, script: 0x5a, flags: 0x0}, - 452: {region: 0x165, script: 0x5a, flags: 0x0}, - 453: {region: 0x12b, script: 0x40, flags: 0x0}, - 454: {region: 0x53, script: 0x90, flags: 0x0}, - 455: {region: 0x165, script: 0x5a, flags: 0x0}, - 456: {region: 0xe8, script: 0x5, flags: 0x0}, - 457: {region: 0x99, script: 0x22, flags: 0x0}, - 458: {region: 0xaf, script: 0x41, flags: 0x0}, - 459: {region: 0xe7, script: 0x5a, flags: 0x0}, - 460: {region: 0xe8, script: 0x5, flags: 0x0}, - 461: {region: 0xe6, script: 0x5a, flags: 0x0}, - 462: {region: 0x99, script: 0x22, flags: 0x0}, - 463: {region: 0x99, script: 0x22, flags: 0x0}, - 464: {region: 0x165, script: 0x5a, flags: 0x0}, - 465: {region: 0x90, script: 0x5a, flags: 0x0}, - 466: {region: 0x60, script: 0x5a, flags: 0x0}, + 442: {region: 0x166, script: 0x5b, flags: 0x0}, + 443: {region: 0x166, script: 0x2c, flags: 0x0}, + 444: {region: 0x98, script: 0x3e, flags: 0x0}, + 445: {region: 0x166, script: 0x5b, flags: 0x0}, + 446: {region: 0x9a, script: 0x22, flags: 0x0}, + 447: {region: 0x166, script: 0x5b, flags: 0x0}, + 448: {region: 0x74, script: 0x5b, flags: 0x0}, + 449: {region: 0x166, script: 0x5b, flags: 0x0}, + 450: {region: 0x166, script: 0x5b, flags: 0x0}, + 451: {region: 0xe8, script: 0x5b, flags: 0x0}, + 452: {region: 0x166, script: 0x5b, flags: 0x0}, + 453: {region: 0x12c, script: 0x40, flags: 0x0}, + 454: {region: 0x53, script: 0x92, flags: 0x0}, + 455: {region: 0x166, script: 0x5b, flags: 0x0}, + 456: {region: 0xe9, script: 0x5, flags: 0x0}, + 457: {region: 0x9a, script: 0x22, flags: 0x0}, + 458: {region: 0xb0, script: 0x41, flags: 0x0}, + 459: {region: 0xe8, script: 0x5b, flags: 0x0}, + 460: {region: 0xe9, script: 0x5, flags: 0x0}, + 461: {region: 0xe7, script: 0x5b, flags: 0x0}, + 462: {region: 0x9a, script: 0x22, flags: 0x0}, + 463: {region: 0x9a, script: 0x22, flags: 0x0}, + 464: {region: 0x166, script: 0x5b, flags: 0x0}, + 465: {region: 0x91, script: 0x5b, flags: 0x0}, + 466: {region: 0x61, script: 0x5b, flags: 0x0}, 467: {region: 0x53, script: 0x3b, flags: 0x0}, - 468: {region: 0x91, script: 0x5a, flags: 0x0}, - 469: {region: 0x92, script: 0x5a, flags: 0x0}, - 470: {region: 0x165, script: 0x5a, flags: 0x0}, + 468: {region: 0x92, script: 0x5b, flags: 0x0}, + 469: {region: 0x93, script: 0x5b, flags: 0x0}, + 470: {region: 0x166, script: 0x5b, flags: 0x0}, 471: {region: 0x28, script: 0x8, flags: 0x0}, - 472: {region: 0xd2, script: 0x5a, flags: 0x0}, - 473: {region: 0x78, script: 0x5a, flags: 0x0}, - 474: {region: 0x165, script: 0x5a, flags: 0x0}, - 475: {region: 0x165, script: 0x5a, flags: 0x0}, - 476: {region: 0xd0, script: 0x5a, flags: 0x0}, - 477: {region: 0xd6, script: 0x5a, flags: 0x0}, - 478: {region: 0x165, script: 0x5a, flags: 0x0}, - 479: {region: 0x165, script: 0x5a, flags: 0x0}, - 480: {region: 0x165, script: 0x5a, flags: 0x0}, - 481: {region: 0x95, script: 0x5a, flags: 0x0}, - 482: {region: 0x165, script: 0x5a, flags: 0x0}, - 483: {region: 0x165, script: 0x5a, flags: 0x0}, - 484: {region: 0x165, script: 0x5a, flags: 0x0}, - 486: {region: 0x122, script: 0x5a, flags: 0x0}, - 487: {region: 0xd6, script: 0x5a, flags: 0x0}, - 488: {region: 0x165, script: 0x5a, flags: 0x0}, - 489: {region: 0x165, script: 0x5a, flags: 0x0}, - 490: {region: 0x53, script: 0xfa, flags: 0x0}, - 491: {region: 0x165, script: 0x5a, flags: 0x0}, - 492: {region: 0x135, script: 0x5a, flags: 0x0}, - 493: {region: 0x165, script: 0x5a, flags: 0x0}, - 494: {region: 0x49, script: 0x5a, flags: 0x0}, - 495: {region: 0x165, script: 0x5a, flags: 0x0}, - 496: {region: 0x165, script: 0x5a, flags: 0x0}, - 497: {region: 0xe7, script: 0x5a, flags: 0x0}, - 498: {region: 0x165, script: 0x5a, flags: 0x0}, - 499: {region: 0x95, script: 0x5a, flags: 0x0}, - 500: {region: 0x106, script: 0x20, flags: 0x0}, - 501: {region: 0x1, script: 0x5a, flags: 0x0}, - 502: {region: 0x165, script: 0x5a, flags: 0x0}, - 503: {region: 0x165, script: 0x5a, flags: 0x0}, - 504: {region: 0x9d, script: 0x5a, flags: 0x0}, - 505: {region: 0x9e, script: 0x5a, flags: 0x0}, + 472: {region: 0xd3, script: 0x5b, flags: 0x0}, + 473: {region: 0x79, script: 0x5b, flags: 0x0}, + 474: {region: 0x166, script: 0x5b, flags: 0x0}, + 475: {region: 0x166, script: 0x5b, flags: 0x0}, + 476: {region: 0xd1, script: 0x5b, flags: 0x0}, + 477: {region: 0xd7, script: 0x5b, flags: 0x0}, + 478: {region: 0x166, script: 0x5b, flags: 0x0}, + 479: {region: 0x166, script: 0x5b, flags: 0x0}, + 480: {region: 0x166, script: 0x5b, flags: 0x0}, + 481: {region: 0x96, script: 0x5b, flags: 0x0}, + 482: {region: 0x166, script: 0x5b, flags: 0x0}, + 483: {region: 0x166, script: 0x5b, flags: 0x0}, + 484: {region: 0x166, script: 0x5b, flags: 0x0}, + 486: {region: 0x123, script: 0x5b, flags: 0x0}, + 487: {region: 0xd7, script: 0x5b, flags: 0x0}, + 488: {region: 0x166, script: 0x5b, flags: 0x0}, + 489: {region: 0x166, script: 0x5b, flags: 0x0}, + 490: {region: 0x53, script: 0xfd, flags: 0x0}, + 491: {region: 0x166, script: 0x5b, flags: 0x0}, + 492: {region: 0x136, script: 0x5b, flags: 0x0}, + 493: {region: 0x166, script: 0x5b, flags: 0x0}, + 494: {region: 0x49, script: 0x5b, flags: 0x0}, + 495: {region: 0x166, script: 0x5b, flags: 0x0}, + 496: {region: 0x166, script: 0x5b, flags: 0x0}, + 497: {region: 0xe8, script: 0x5b, flags: 0x0}, + 498: {region: 0x166, script: 0x5b, flags: 0x0}, + 499: {region: 0x96, script: 0x5b, flags: 0x0}, + 500: {region: 0x107, script: 0x20, flags: 0x0}, + 501: {region: 0x1, script: 0x5b, flags: 0x0}, + 502: {region: 0x166, script: 0x5b, flags: 0x0}, + 503: {region: 0x166, script: 0x5b, flags: 0x0}, + 504: {region: 0x9e, script: 0x5b, flags: 0x0}, + 505: {region: 0x9f, script: 0x5b, flags: 0x0}, 506: {region: 0x49, script: 0x17, flags: 0x0}, - 507: {region: 0x97, script: 0x3e, flags: 0x0}, - 508: {region: 0x165, script: 0x5a, flags: 0x0}, - 509: {region: 0x165, script: 0x5a, flags: 0x0}, - 510: {region: 0x106, script: 0x5a, flags: 0x0}, - 511: {region: 0x165, script: 0x5a, flags: 0x0}, - 512: {region: 0xa2, script: 0x49, flags: 0x0}, - 513: {region: 0x165, script: 0x5a, flags: 0x0}, - 514: {region: 0xa0, script: 0x5a, flags: 0x0}, - 515: {region: 0x1, script: 0x5a, flags: 0x0}, - 516: {region: 0x165, script: 0x5a, flags: 0x0}, - 517: {region: 0x165, script: 0x5a, flags: 0x0}, - 518: {region: 0x165, script: 0x5a, flags: 0x0}, - 519: {region: 0x52, script: 0x5a, flags: 0x0}, - 520: {region: 0x130, script: 0x3e, flags: 0x0}, - 521: {region: 0x165, script: 0x5a, flags: 0x0}, - 522: {region: 0x12f, script: 0x5a, flags: 0x0}, - 523: {region: 0xdb, script: 0x22, flags: 0x0}, - 524: {region: 0x165, script: 0x5a, flags: 0x0}, - 525: {region: 0x63, script: 0x5a, flags: 0x0}, - 526: {region: 0x95, script: 0x5a, flags: 0x0}, - 527: {region: 0x95, script: 0x5a, flags: 0x0}, - 528: {region: 0x7d, script: 0x2e, flags: 0x0}, - 529: {region: 0x137, script: 0x20, flags: 0x0}, - 530: {region: 0x67, script: 0x5a, flags: 0x0}, - 531: {region: 0xc4, script: 0x5a, flags: 0x0}, - 532: {region: 0x165, script: 0x5a, flags: 0x0}, - 533: {region: 0x165, script: 0x5a, flags: 0x0}, - 534: {region: 0xd6, script: 0x5a, flags: 0x0}, - 535: {region: 0xa4, script: 0x5a, flags: 0x0}, - 536: {region: 0xc3, script: 0x5a, flags: 0x0}, - 537: {region: 0x106, script: 0x20, flags: 0x0}, - 538: {region: 0x165, script: 0x5a, flags: 0x0}, - 539: {region: 0x165, script: 0x5a, flags: 0x0}, - 540: {region: 0x165, script: 0x5a, flags: 0x0}, - 541: {region: 0x165, script: 0x5a, flags: 0x0}, - 542: {region: 0xd4, script: 0x5, flags: 0x0}, - 543: {region: 0xd6, script: 0x5a, flags: 0x0}, - 544: {region: 0x164, script: 0x5a, flags: 0x0}, - 545: {region: 0x165, script: 0x5a, flags: 0x0}, - 546: {region: 0x165, script: 0x5a, flags: 0x0}, - 547: {region: 0x12f, script: 0x5a, flags: 0x0}, - 548: {region: 0x122, script: 0x5, flags: 0x0}, - 549: {region: 0x165, script: 0x5a, flags: 0x0}, - 550: {region: 0x123, script: 0xeb, flags: 0x0}, - 551: {region: 0x5a, script: 0x5a, flags: 0x0}, - 552: {region: 0x52, script: 0x5a, flags: 0x0}, - 553: {region: 0x165, script: 0x5a, flags: 0x0}, - 554: {region: 0x4f, script: 0x5a, flags: 0x0}, - 555: {region: 0x99, script: 0x22, flags: 0x0}, - 556: {region: 0x99, script: 0x22, flags: 0x0}, - 557: {region: 0x4b, script: 0x5a, flags: 0x0}, - 558: {region: 0x95, script: 0x5a, flags: 0x0}, - 559: {region: 0x165, script: 0x5a, flags: 0x0}, - 560: {region: 0x41, script: 0x5a, flags: 0x0}, - 561: {region: 0x99, script: 0x5a, flags: 0x0}, - 562: {region: 0x53, script: 0xe2, flags: 0x0}, - 563: {region: 0x99, script: 0x22, flags: 0x0}, - 564: {region: 0xc3, script: 0x5a, flags: 0x0}, - 565: {region: 0x165, script: 0x5a, flags: 0x0}, - 566: {region: 0x99, script: 0x75, flags: 0x0}, - 567: {region: 0xe8, script: 0x5, flags: 0x0}, - 568: {region: 0x165, script: 0x5a, flags: 0x0}, - 569: {region: 0xa4, script: 0x5a, flags: 0x0}, - 570: {region: 0x165, script: 0x5a, flags: 0x0}, - 571: {region: 0x12b, script: 0x5a, flags: 0x0}, - 572: {region: 0x165, script: 0x5a, flags: 0x0}, - 573: {region: 0xd2, script: 0x5a, flags: 0x0}, - 574: {region: 0x165, script: 0x5a, flags: 0x0}, - 575: {region: 0xaf, script: 0x57, flags: 0x0}, - 576: {region: 0x165, script: 0x5a, flags: 0x0}, - 577: {region: 0x165, script: 0x5a, flags: 0x0}, + 507: {region: 0x98, script: 0x3e, flags: 0x0}, + 508: {region: 0x166, script: 0x5b, flags: 0x0}, + 509: {region: 0x166, script: 0x5b, flags: 0x0}, + 510: {region: 0x107, script: 0x5b, flags: 0x0}, + 511: {region: 0x166, script: 0x5b, flags: 0x0}, + 512: {region: 0xa3, script: 0x49, flags: 0x0}, + 513: {region: 0x166, script: 0x5b, flags: 0x0}, + 514: {region: 0xa1, script: 0x5b, flags: 0x0}, + 515: {region: 0x1, script: 0x5b, flags: 0x0}, + 516: {region: 0x166, script: 0x5b, flags: 0x0}, + 517: {region: 0x166, script: 0x5b, flags: 0x0}, + 518: {region: 0x166, script: 0x5b, flags: 0x0}, + 519: {region: 0x52, script: 0x5b, flags: 0x0}, + 520: {region: 0x131, script: 0x3e, flags: 0x0}, + 521: {region: 0x166, script: 0x5b, flags: 0x0}, + 522: {region: 0x130, script: 0x5b, flags: 0x0}, + 523: {region: 0xdc, script: 0x22, flags: 0x0}, + 524: {region: 0x166, script: 0x5b, flags: 0x0}, + 525: {region: 0x64, script: 0x5b, flags: 0x0}, + 526: {region: 0x96, script: 0x5b, flags: 0x0}, + 527: {region: 0x96, script: 0x5b, flags: 0x0}, + 528: {region: 0x7e, script: 0x2e, flags: 0x0}, + 529: {region: 0x138, script: 0x20, flags: 0x0}, + 530: {region: 0x68, script: 0x5b, flags: 0x0}, + 531: {region: 0xc5, script: 0x5b, flags: 0x0}, + 532: {region: 0x166, script: 0x5b, flags: 0x0}, + 533: {region: 0x166, script: 0x5b, flags: 0x0}, + 534: {region: 0xd7, script: 0x5b, flags: 0x0}, + 535: {region: 0xa5, script: 0x5b, flags: 0x0}, + 536: {region: 0xc4, script: 0x5b, flags: 0x0}, + 537: {region: 0x107, script: 0x20, flags: 0x0}, + 538: {region: 0x166, script: 0x5b, flags: 0x0}, + 539: {region: 0x166, script: 0x5b, flags: 0x0}, + 540: {region: 0x166, script: 0x5b, flags: 0x0}, + 541: {region: 0x166, script: 0x5b, flags: 0x0}, + 542: {region: 0xd5, script: 0x5, flags: 0x0}, + 543: {region: 0xd7, script: 0x5b, flags: 0x0}, + 544: {region: 0x165, script: 0x5b, flags: 0x0}, + 545: {region: 0x166, script: 0x5b, flags: 0x0}, + 546: {region: 0x166, script: 0x5b, flags: 0x0}, + 547: {region: 0x130, script: 0x5b, flags: 0x0}, + 548: {region: 0x123, script: 0x5, flags: 0x0}, + 549: {region: 0x166, script: 0x5b, flags: 0x0}, + 550: {region: 0x124, script: 0xee, flags: 0x0}, + 551: {region: 0x5b, script: 0x5b, flags: 0x0}, + 552: {region: 0x52, script: 0x5b, flags: 0x0}, + 553: {region: 0x166, script: 0x5b, flags: 0x0}, + 554: {region: 0x4f, script: 0x5b, flags: 0x0}, + 555: {region: 0x9a, script: 0x22, flags: 0x0}, + 556: {region: 0x9a, script: 0x22, flags: 0x0}, + 557: {region: 0x4b, script: 0x5b, flags: 0x0}, + 558: {region: 0x96, script: 0x5b, flags: 0x0}, + 559: {region: 0x166, script: 0x5b, flags: 0x0}, + 560: {region: 0x41, script: 0x5b, flags: 0x0}, + 561: {region: 0x9a, script: 0x5b, flags: 0x0}, + 562: {region: 0x53, script: 0xe5, flags: 0x0}, + 563: {region: 0x9a, script: 0x22, flags: 0x0}, + 564: {region: 0xc4, script: 0x5b, flags: 0x0}, + 565: {region: 0x166, script: 0x5b, flags: 0x0}, + 566: {region: 0x9a, script: 0x76, flags: 0x0}, + 567: {region: 0xe9, script: 0x5, flags: 0x0}, + 568: {region: 0x166, script: 0x5b, flags: 0x0}, + 569: {region: 0xa5, script: 0x5b, flags: 0x0}, + 570: {region: 0x166, script: 0x5b, flags: 0x0}, + 571: {region: 0x12c, script: 0x5b, flags: 0x0}, + 572: {region: 0x166, script: 0x5b, flags: 0x0}, + 573: {region: 0xd3, script: 0x5b, flags: 0x0}, + 574: {region: 0x166, script: 0x5b, flags: 0x0}, + 575: {region: 0xb0, script: 0x58, flags: 0x0}, + 576: {region: 0x166, script: 0x5b, flags: 0x0}, + 577: {region: 0x166, script: 0x5b, flags: 0x0}, 578: {region: 0x13, script: 0x6, flags: 0x1}, - 579: {region: 0x165, script: 0x5a, flags: 0x0}, - 580: {region: 0x52, script: 0x5a, flags: 0x0}, - 581: {region: 0x82, script: 0x5a, flags: 0x0}, - 582: {region: 0xa4, script: 0x5a, flags: 0x0}, - 583: {region: 0x165, script: 0x5a, flags: 0x0}, - 584: {region: 0x165, script: 0x5a, flags: 0x0}, - 585: {region: 0x165, script: 0x5a, flags: 0x0}, - 586: {region: 0xa6, script: 0x4e, flags: 0x0}, - 587: {region: 0x2a, script: 0x5a, flags: 0x0}, - 588: {region: 0x165, script: 0x5a, flags: 0x0}, - 589: {region: 0x165, script: 0x5a, flags: 0x0}, - 590: {region: 0x165, script: 0x5a, flags: 0x0}, - 591: {region: 0x165, script: 0x5a, flags: 0x0}, - 592: {region: 0x165, script: 0x5a, flags: 0x0}, - 593: {region: 0x99, script: 0x52, flags: 0x0}, - 594: {region: 0x8b, script: 0x5a, flags: 0x0}, - 595: {region: 0x165, script: 0x5a, flags: 0x0}, - 596: {region: 0xab, script: 0x53, flags: 0x0}, - 597: {region: 0x106, script: 0x20, flags: 0x0}, - 598: {region: 0x99, script: 0x22, flags: 0x0}, - 599: {region: 0x165, script: 0x5a, flags: 0x0}, - 600: {region: 0x75, script: 0x5a, flags: 0x0}, - 601: {region: 0x165, script: 0x5a, flags: 0x0}, - 602: {region: 0xb4, script: 0x5a, flags: 0x0}, - 603: {region: 0x165, script: 0x5a, flags: 0x0}, - 604: {region: 0x165, script: 0x5a, flags: 0x0}, - 605: {region: 0x165, script: 0x5a, flags: 0x0}, - 606: {region: 0x165, script: 0x5a, flags: 0x0}, - 607: {region: 0x165, script: 0x5a, flags: 0x0}, - 608: {region: 0x165, script: 0x5a, flags: 0x0}, - 609: {region: 0x165, script: 0x5a, flags: 0x0}, - 610: {region: 0x165, script: 0x2c, flags: 0x0}, - 611: {region: 0x165, script: 0x5a, flags: 0x0}, - 612: {region: 0x106, script: 0x20, flags: 0x0}, - 613: {region: 0x112, script: 0x5a, flags: 0x0}, - 614: {region: 0xe7, script: 0x5a, flags: 0x0}, - 615: {region: 0x106, script: 0x5a, flags: 0x0}, - 616: {region: 0x165, script: 0x5a, flags: 0x0}, - 617: {region: 0x99, script: 0x22, flags: 0x0}, - 618: {region: 0x99, script: 0x5, flags: 0x0}, - 619: {region: 0x12f, script: 0x5a, flags: 0x0}, - 620: {region: 0x165, script: 0x5a, flags: 0x0}, - 621: {region: 0x52, script: 0x5a, flags: 0x0}, - 622: {region: 0x60, script: 0x5a, flags: 0x0}, - 623: {region: 0x165, script: 0x5a, flags: 0x0}, - 624: {region: 0x165, script: 0x5a, flags: 0x0}, - 625: {region: 0x165, script: 0x2c, flags: 0x0}, - 626: {region: 0x165, script: 0x5a, flags: 0x0}, - 627: {region: 0x165, script: 0x5a, flags: 0x0}, + 579: {region: 0x166, script: 0x5b, flags: 0x0}, + 580: {region: 0x52, script: 0x5b, flags: 0x0}, + 581: {region: 0x83, script: 0x5b, flags: 0x0}, + 582: {region: 0xa5, script: 0x5b, flags: 0x0}, + 583: {region: 0x166, script: 0x5b, flags: 0x0}, + 584: {region: 0x166, script: 0x5b, flags: 0x0}, + 585: {region: 0x166, script: 0x5b, flags: 0x0}, + 586: {region: 0xa7, script: 0x4f, flags: 0x0}, + 587: {region: 0x2a, script: 0x5b, flags: 0x0}, + 588: {region: 0x166, script: 0x5b, flags: 0x0}, + 589: {region: 0x166, script: 0x5b, flags: 0x0}, + 590: {region: 0x166, script: 0x5b, flags: 0x0}, + 591: {region: 0x166, script: 0x5b, flags: 0x0}, + 592: {region: 0x166, script: 0x5b, flags: 0x0}, + 593: {region: 0x9a, script: 0x53, flags: 0x0}, + 594: {region: 0x8c, script: 0x5b, flags: 0x0}, + 595: {region: 0x166, script: 0x5b, flags: 0x0}, + 596: {region: 0xac, script: 0x54, flags: 0x0}, + 597: {region: 0x107, script: 0x20, flags: 0x0}, + 598: {region: 0x9a, script: 0x22, flags: 0x0}, + 599: {region: 0x166, script: 0x5b, flags: 0x0}, + 600: {region: 0x76, script: 0x5b, flags: 0x0}, + 601: {region: 0x166, script: 0x5b, flags: 0x0}, + 602: {region: 0xb5, script: 0x5b, flags: 0x0}, + 603: {region: 0x166, script: 0x5b, flags: 0x0}, + 604: {region: 0x166, script: 0x5b, flags: 0x0}, + 605: {region: 0x166, script: 0x5b, flags: 0x0}, + 606: {region: 0x166, script: 0x5b, flags: 0x0}, + 607: {region: 0x166, script: 0x5b, flags: 0x0}, + 608: {region: 0x166, script: 0x5b, flags: 0x0}, + 609: {region: 0x166, script: 0x5b, flags: 0x0}, + 610: {region: 0x166, script: 0x2c, flags: 0x0}, + 611: {region: 0x166, script: 0x5b, flags: 0x0}, + 612: {region: 0x107, script: 0x20, flags: 0x0}, + 613: {region: 0x113, script: 0x5b, flags: 0x0}, + 614: {region: 0xe8, script: 0x5b, flags: 0x0}, + 615: {region: 0x107, script: 0x5b, flags: 0x0}, + 616: {region: 0x166, script: 0x5b, flags: 0x0}, + 617: {region: 0x9a, script: 0x22, flags: 0x0}, + 618: {region: 0x9a, script: 0x5, flags: 0x0}, + 619: {region: 0x130, script: 0x5b, flags: 0x0}, + 620: {region: 0x166, script: 0x5b, flags: 0x0}, + 621: {region: 0x52, script: 0x5b, flags: 0x0}, + 622: {region: 0x61, script: 0x5b, flags: 0x0}, + 623: {region: 0x166, script: 0x5b, flags: 0x0}, + 624: {region: 0x166, script: 0x5b, flags: 0x0}, + 625: {region: 0x166, script: 0x2c, flags: 0x0}, + 626: {region: 0x166, script: 0x5b, flags: 0x0}, + 627: {region: 0x166, script: 0x5b, flags: 0x0}, 628: {region: 0x19, script: 0x3, flags: 0x1}, - 629: {region: 0x165, script: 0x5a, flags: 0x0}, - 630: {region: 0x165, script: 0x5a, flags: 0x0}, - 631: {region: 0x165, script: 0x5a, flags: 0x0}, - 632: {region: 0x165, script: 0x5a, flags: 0x0}, - 633: {region: 0x106, script: 0x20, flags: 0x0}, - 634: {region: 0x165, script: 0x5a, flags: 0x0}, - 635: {region: 0x165, script: 0x5a, flags: 0x0}, - 636: {region: 0x165, script: 0x5a, flags: 0x0}, - 637: {region: 0x106, script: 0x20, flags: 0x0}, - 638: {region: 0x165, script: 0x5a, flags: 0x0}, - 639: {region: 0x95, script: 0x5a, flags: 0x0}, - 640: {region: 0xe8, script: 0x5, flags: 0x0}, - 641: {region: 0x7b, script: 0x5a, flags: 0x0}, - 642: {region: 0x165, script: 0x5a, flags: 0x0}, - 643: {region: 0x165, script: 0x5a, flags: 0x0}, - 644: {region: 0x165, script: 0x5a, flags: 0x0}, - 645: {region: 0x165, script: 0x2c, flags: 0x0}, - 646: {region: 0x123, script: 0xeb, flags: 0x0}, - 647: {region: 0xe8, script: 0x5, flags: 0x0}, - 648: {region: 0x165, script: 0x5a, flags: 0x0}, - 649: {region: 0x165, script: 0x5a, flags: 0x0}, + 629: {region: 0x166, script: 0x5b, flags: 0x0}, + 630: {region: 0x166, script: 0x5b, flags: 0x0}, + 631: {region: 0x166, script: 0x5b, flags: 0x0}, + 632: {region: 0x166, script: 0x5b, flags: 0x0}, + 633: {region: 0x107, script: 0x20, flags: 0x0}, + 634: {region: 0x166, script: 0x5b, flags: 0x0}, + 635: {region: 0x166, script: 0x5b, flags: 0x0}, + 636: {region: 0x166, script: 0x5b, flags: 0x0}, + 637: {region: 0x107, script: 0x20, flags: 0x0}, + 638: {region: 0x166, script: 0x5b, flags: 0x0}, + 639: {region: 0x96, script: 0x5b, flags: 0x0}, + 640: {region: 0xe9, script: 0x5, flags: 0x0}, + 641: {region: 0x7c, script: 0x5b, flags: 0x0}, + 642: {region: 0x166, script: 0x5b, flags: 0x0}, + 643: {region: 0x166, script: 0x5b, flags: 0x0}, + 644: {region: 0x166, script: 0x5b, flags: 0x0}, + 645: {region: 0x166, script: 0x2c, flags: 0x0}, + 646: {region: 0x124, script: 0xee, flags: 0x0}, + 647: {region: 0xe9, script: 0x5, flags: 0x0}, + 648: {region: 0x166, script: 0x5b, flags: 0x0}, + 649: {region: 0x166, script: 0x5b, flags: 0x0}, 650: {region: 0x1c, script: 0x5, flags: 0x1}, - 651: {region: 0x165, script: 0x5a, flags: 0x0}, - 652: {region: 0x165, script: 0x5a, flags: 0x0}, - 653: {region: 0x165, script: 0x5a, flags: 0x0}, - 654: {region: 0x138, script: 0x5a, flags: 0x0}, - 655: {region: 0x87, script: 0x5e, flags: 0x0}, - 656: {region: 0x97, script: 0x3e, flags: 0x0}, - 657: {region: 0x12f, script: 0x5a, flags: 0x0}, - 658: {region: 0xe8, script: 0x5, flags: 0x0}, - 659: {region: 0x131, script: 0x5a, flags: 0x0}, - 660: {region: 0x165, script: 0x5a, flags: 0x0}, - 661: {region: 0xb7, script: 0x5a, flags: 0x0}, - 662: {region: 0x106, script: 0x20, flags: 0x0}, - 663: {region: 0x165, script: 0x5a, flags: 0x0}, - 664: {region: 0x95, script: 0x5a, flags: 0x0}, - 665: {region: 0x165, script: 0x5a, flags: 0x0}, - 666: {region: 0x53, script: 0xeb, flags: 0x0}, - 667: {region: 0x165, script: 0x5a, flags: 0x0}, - 668: {region: 0x165, script: 0x5a, flags: 0x0}, - 669: {region: 0x165, script: 0x5a, flags: 0x0}, - 670: {region: 0x165, script: 0x5a, flags: 0x0}, - 671: {region: 0x99, script: 0x5c, flags: 0x0}, - 672: {region: 0x165, script: 0x5a, flags: 0x0}, - 673: {region: 0x165, script: 0x5a, flags: 0x0}, - 674: {region: 0x106, script: 0x20, flags: 0x0}, - 675: {region: 0x131, script: 0x5a, flags: 0x0}, - 676: {region: 0x165, script: 0x5a, flags: 0x0}, - 677: {region: 0xd9, script: 0x5a, flags: 0x0}, - 678: {region: 0x165, script: 0x5a, flags: 0x0}, - 679: {region: 0x165, script: 0x5a, flags: 0x0}, + 651: {region: 0x166, script: 0x5b, flags: 0x0}, + 652: {region: 0x166, script: 0x5b, flags: 0x0}, + 653: {region: 0x166, script: 0x5b, flags: 0x0}, + 654: {region: 0x139, script: 0x5b, flags: 0x0}, + 655: {region: 0x88, script: 0x5f, flags: 0x0}, + 656: {region: 0x98, script: 0x3e, flags: 0x0}, + 657: {region: 0x130, script: 0x5b, flags: 0x0}, + 658: {region: 0xe9, script: 0x5, flags: 0x0}, + 659: {region: 0x132, script: 0x5b, flags: 0x0}, + 660: {region: 0x166, script: 0x5b, flags: 0x0}, + 661: {region: 0xb8, script: 0x5b, flags: 0x0}, + 662: {region: 0x107, script: 0x20, flags: 0x0}, + 663: {region: 0x166, script: 0x5b, flags: 0x0}, + 664: {region: 0x96, script: 0x5b, flags: 0x0}, + 665: {region: 0x166, script: 0x5b, flags: 0x0}, + 666: {region: 0x53, script: 0xee, flags: 0x0}, + 667: {region: 0x166, script: 0x5b, flags: 0x0}, + 668: {region: 0x166, script: 0x5b, flags: 0x0}, + 669: {region: 0x166, script: 0x5b, flags: 0x0}, + 670: {region: 0x166, script: 0x5b, flags: 0x0}, + 671: {region: 0x9a, script: 0x5d, flags: 0x0}, + 672: {region: 0x166, script: 0x5b, flags: 0x0}, + 673: {region: 0x166, script: 0x5b, flags: 0x0}, + 674: {region: 0x107, script: 0x20, flags: 0x0}, + 675: {region: 0x132, script: 0x5b, flags: 0x0}, + 676: {region: 0x166, script: 0x5b, flags: 0x0}, + 677: {region: 0xda, script: 0x5b, flags: 0x0}, + 678: {region: 0x166, script: 0x5b, flags: 0x0}, + 679: {region: 0x166, script: 0x5b, flags: 0x0}, 680: {region: 0x21, script: 0x2, flags: 0x1}, - 681: {region: 0x165, script: 0x5a, flags: 0x0}, - 682: {region: 0x165, script: 0x5a, flags: 0x0}, - 683: {region: 0x9e, script: 0x5a, flags: 0x0}, - 684: {region: 0x53, script: 0x60, flags: 0x0}, - 685: {region: 0x95, script: 0x5a, flags: 0x0}, - 686: {region: 0x9c, script: 0x5, flags: 0x0}, - 687: {region: 0x135, script: 0x5a, flags: 0x0}, - 688: {region: 0x165, script: 0x5a, flags: 0x0}, - 689: {region: 0x165, script: 0x5a, flags: 0x0}, - 690: {region: 0x99, script: 0xe6, flags: 0x0}, - 691: {region: 0x9e, script: 0x5a, flags: 0x0}, - 692: {region: 0x165, script: 0x5a, flags: 0x0}, - 693: {region: 0x4b, script: 0x5a, flags: 0x0}, - 694: {region: 0x165, script: 0x5a, flags: 0x0}, - 695: {region: 0x165, script: 0x5a, flags: 0x0}, - 696: {region: 0xaf, script: 0x57, flags: 0x0}, - 697: {region: 0x165, script: 0x5a, flags: 0x0}, - 698: {region: 0x165, script: 0x5a, flags: 0x0}, - 699: {region: 0x4b, script: 0x5a, flags: 0x0}, - 700: {region: 0x165, script: 0x5a, flags: 0x0}, - 701: {region: 0x165, script: 0x5a, flags: 0x0}, - 702: {region: 0x162, script: 0x5a, flags: 0x0}, - 703: {region: 0x9c, script: 0x5, flags: 0x0}, - 704: {region: 0xb6, script: 0x5a, flags: 0x0}, - 705: {region: 0xb8, script: 0x5a, flags: 0x0}, - 706: {region: 0x4b, script: 0x5a, flags: 0x0}, - 707: {region: 0x4b, script: 0x5a, flags: 0x0}, - 708: {region: 0xa4, script: 0x5a, flags: 0x0}, - 709: {region: 0xa4, script: 0x5a, flags: 0x0}, - 710: {region: 0x9c, script: 0x5, flags: 0x0}, - 711: {region: 0xb8, script: 0x5a, flags: 0x0}, - 712: {region: 0x123, script: 0xeb, flags: 0x0}, + 681: {region: 0x166, script: 0x5b, flags: 0x0}, + 682: {region: 0x166, script: 0x5b, flags: 0x0}, + 683: {region: 0x9f, script: 0x5b, flags: 0x0}, + 684: {region: 0x53, script: 0x61, flags: 0x0}, + 685: {region: 0x96, script: 0x5b, flags: 0x0}, + 686: {region: 0x9d, script: 0x5, flags: 0x0}, + 687: {region: 0x136, script: 0x5b, flags: 0x0}, + 688: {region: 0x166, script: 0x5b, flags: 0x0}, + 689: {region: 0x166, script: 0x5b, flags: 0x0}, + 690: {region: 0x9a, script: 0xe9, flags: 0x0}, + 691: {region: 0x9f, script: 0x5b, flags: 0x0}, + 692: {region: 0x166, script: 0x5b, flags: 0x0}, + 693: {region: 0x4b, script: 0x5b, flags: 0x0}, + 694: {region: 0x166, script: 0x5b, flags: 0x0}, + 695: {region: 0x166, script: 0x5b, flags: 0x0}, + 696: {region: 0xb0, script: 0x58, flags: 0x0}, + 697: {region: 0x166, script: 0x5b, flags: 0x0}, + 698: {region: 0x166, script: 0x5b, flags: 0x0}, + 699: {region: 0x4b, script: 0x5b, flags: 0x0}, + 700: {region: 0x166, script: 0x5b, flags: 0x0}, + 701: {region: 0x166, script: 0x5b, flags: 0x0}, + 702: {region: 0x163, script: 0x5b, flags: 0x0}, + 703: {region: 0x9d, script: 0x5, flags: 0x0}, + 704: {region: 0xb7, script: 0x5b, flags: 0x0}, + 705: {region: 0xb9, script: 0x5b, flags: 0x0}, + 706: {region: 0x4b, script: 0x5b, flags: 0x0}, + 707: {region: 0x4b, script: 0x5b, flags: 0x0}, + 708: {region: 0xa5, script: 0x5b, flags: 0x0}, + 709: {region: 0xa5, script: 0x5b, flags: 0x0}, + 710: {region: 0x9d, script: 0x5, flags: 0x0}, + 711: {region: 0xb9, script: 0x5b, flags: 0x0}, + 712: {region: 0x124, script: 0xee, flags: 0x0}, 713: {region: 0x53, script: 0x3b, flags: 0x0}, - 714: {region: 0x12b, script: 0x5a, flags: 0x0}, - 715: {region: 0x95, script: 0x5a, flags: 0x0}, - 716: {region: 0x52, script: 0x5a, flags: 0x0}, - 717: {region: 0x99, script: 0x22, flags: 0x0}, - 718: {region: 0x99, script: 0x22, flags: 0x0}, - 719: {region: 0x95, script: 0x5a, flags: 0x0}, + 714: {region: 0x12c, script: 0x5b, flags: 0x0}, + 715: {region: 0x96, script: 0x5b, flags: 0x0}, + 716: {region: 0x52, script: 0x5b, flags: 0x0}, + 717: {region: 0x9a, script: 0x22, flags: 0x0}, + 718: {region: 0x9a, script: 0x22, flags: 0x0}, + 719: {region: 0x96, script: 0x5b, flags: 0x0}, 720: {region: 0x23, script: 0x3, flags: 0x1}, - 721: {region: 0xa4, script: 0x5a, flags: 0x0}, - 722: {region: 0x165, script: 0x5a, flags: 0x0}, - 723: {region: 0xcf, script: 0x5a, flags: 0x0}, - 724: {region: 0x165, script: 0x5a, flags: 0x0}, - 725: {region: 0x165, script: 0x5a, flags: 0x0}, - 726: {region: 0x165, script: 0x5a, flags: 0x0}, - 727: {region: 0x165, script: 0x5a, flags: 0x0}, - 728: {region: 0x165, script: 0x5a, flags: 0x0}, - 729: {region: 0x165, script: 0x5a, flags: 0x0}, - 730: {region: 0x165, script: 0x5a, flags: 0x0}, - 731: {region: 0x165, script: 0x5a, flags: 0x0}, - 732: {region: 0x165, script: 0x5a, flags: 0x0}, - 733: {region: 0x165, script: 0x5a, flags: 0x0}, - 734: {region: 0x165, script: 0x5a, flags: 0x0}, - 735: {region: 0x165, script: 0x5, flags: 0x0}, - 736: {region: 0x106, script: 0x20, flags: 0x0}, - 737: {region: 0xe7, script: 0x5a, flags: 0x0}, - 738: {region: 0x165, script: 0x5a, flags: 0x0}, - 739: {region: 0x95, script: 0x5a, flags: 0x0}, - 740: {region: 0x165, script: 0x2c, flags: 0x0}, - 741: {region: 0x165, script: 0x5a, flags: 0x0}, - 742: {region: 0x165, script: 0x5a, flags: 0x0}, - 743: {region: 0x165, script: 0x5a, flags: 0x0}, - 744: {region: 0x112, script: 0x5a, flags: 0x0}, - 745: {region: 0xa4, script: 0x5a, flags: 0x0}, - 746: {region: 0x165, script: 0x5a, flags: 0x0}, - 747: {region: 0x165, script: 0x5a, flags: 0x0}, - 748: {region: 0x123, script: 0x5, flags: 0x0}, - 749: {region: 0xcc, script: 0x5a, flags: 0x0}, - 750: {region: 0x165, script: 0x5a, flags: 0x0}, - 751: {region: 0x165, script: 0x5a, flags: 0x0}, - 752: {region: 0x165, script: 0x5a, flags: 0x0}, - 753: {region: 0xbf, script: 0x5a, flags: 0x0}, - 754: {region: 0xd1, script: 0x5a, flags: 0x0}, - 755: {region: 0x165, script: 0x5a, flags: 0x0}, - 756: {region: 0x52, script: 0x5a, flags: 0x0}, - 757: {region: 0xdb, script: 0x22, flags: 0x0}, - 758: {region: 0x12f, script: 0x5a, flags: 0x0}, - 759: {region: 0xc0, script: 0x5a, flags: 0x0}, - 760: {region: 0x165, script: 0x5a, flags: 0x0}, - 761: {region: 0x165, script: 0x5a, flags: 0x0}, - 762: {region: 0xe0, script: 0x5a, flags: 0x0}, - 763: {region: 0x165, script: 0x5a, flags: 0x0}, - 764: {region: 0x95, script: 0x5a, flags: 0x0}, - 765: {region: 0x9b, script: 0x3d, flags: 0x0}, - 766: {region: 0x165, script: 0x5a, flags: 0x0}, - 767: {region: 0xc2, script: 0x20, flags: 0x0}, - 768: {region: 0x165, script: 0x5, flags: 0x0}, - 769: {region: 0x165, script: 0x5a, flags: 0x0}, - 770: {region: 0x165, script: 0x5a, flags: 0x0}, - 771: {region: 0x165, script: 0x5a, flags: 0x0}, - 772: {region: 0x99, script: 0x6e, flags: 0x0}, - 773: {region: 0x165, script: 0x5a, flags: 0x0}, - 774: {region: 0x165, script: 0x5a, flags: 0x0}, - 775: {region: 0x10b, script: 0x5a, flags: 0x0}, - 776: {region: 0x165, script: 0x5a, flags: 0x0}, - 777: {region: 0x165, script: 0x5a, flags: 0x0}, - 778: {region: 0x165, script: 0x5a, flags: 0x0}, + 721: {region: 0xa5, script: 0x5b, flags: 0x0}, + 722: {region: 0x166, script: 0x5b, flags: 0x0}, + 723: {region: 0xd0, script: 0x5b, flags: 0x0}, + 724: {region: 0x166, script: 0x5b, flags: 0x0}, + 725: {region: 0x166, script: 0x5b, flags: 0x0}, + 726: {region: 0x166, script: 0x5b, flags: 0x0}, + 727: {region: 0x166, script: 0x5b, flags: 0x0}, + 728: {region: 0x166, script: 0x5b, flags: 0x0}, + 729: {region: 0x166, script: 0x5b, flags: 0x0}, + 730: {region: 0x166, script: 0x5b, flags: 0x0}, + 731: {region: 0x166, script: 0x5b, flags: 0x0}, + 732: {region: 0x166, script: 0x5b, flags: 0x0}, + 733: {region: 0x166, script: 0x5b, flags: 0x0}, + 734: {region: 0x166, script: 0x5b, flags: 0x0}, + 735: {region: 0x166, script: 0x5, flags: 0x0}, + 736: {region: 0x107, script: 0x20, flags: 0x0}, + 737: {region: 0xe8, script: 0x5b, flags: 0x0}, + 738: {region: 0x166, script: 0x5b, flags: 0x0}, + 739: {region: 0x96, script: 0x5b, flags: 0x0}, + 740: {region: 0x166, script: 0x2c, flags: 0x0}, + 741: {region: 0x166, script: 0x5b, flags: 0x0}, + 742: {region: 0x166, script: 0x5b, flags: 0x0}, + 743: {region: 0x166, script: 0x5b, flags: 0x0}, + 744: {region: 0x113, script: 0x5b, flags: 0x0}, + 745: {region: 0xa5, script: 0x5b, flags: 0x0}, + 746: {region: 0x166, script: 0x5b, flags: 0x0}, + 747: {region: 0x166, script: 0x5b, flags: 0x0}, + 748: {region: 0x124, script: 0x5, flags: 0x0}, + 749: {region: 0xcd, script: 0x5b, flags: 0x0}, + 750: {region: 0x166, script: 0x5b, flags: 0x0}, + 751: {region: 0x166, script: 0x5b, flags: 0x0}, + 752: {region: 0x166, script: 0x5b, flags: 0x0}, + 753: {region: 0xc0, script: 0x5b, flags: 0x0}, + 754: {region: 0xd2, script: 0x5b, flags: 0x0}, + 755: {region: 0x166, script: 0x5b, flags: 0x0}, + 756: {region: 0x52, script: 0x5b, flags: 0x0}, + 757: {region: 0xdc, script: 0x22, flags: 0x0}, + 758: {region: 0x130, script: 0x5b, flags: 0x0}, + 759: {region: 0xc1, script: 0x5b, flags: 0x0}, + 760: {region: 0x166, script: 0x5b, flags: 0x0}, + 761: {region: 0x166, script: 0x5b, flags: 0x0}, + 762: {region: 0xe1, script: 0x5b, flags: 0x0}, + 763: {region: 0x166, script: 0x5b, flags: 0x0}, + 764: {region: 0x96, script: 0x5b, flags: 0x0}, + 765: {region: 0x9c, script: 0x3d, flags: 0x0}, + 766: {region: 0x166, script: 0x5b, flags: 0x0}, + 767: {region: 0xc3, script: 0x20, flags: 0x0}, + 768: {region: 0x166, script: 0x5, flags: 0x0}, + 769: {region: 0x166, script: 0x5b, flags: 0x0}, + 770: {region: 0x166, script: 0x5b, flags: 0x0}, + 771: {region: 0x166, script: 0x5b, flags: 0x0}, + 772: {region: 0x9a, script: 0x6f, flags: 0x0}, + 773: {region: 0x166, script: 0x5b, flags: 0x0}, + 774: {region: 0x166, script: 0x5b, flags: 0x0}, + 775: {region: 0x10c, script: 0x5b, flags: 0x0}, + 776: {region: 0x166, script: 0x5b, flags: 0x0}, + 777: {region: 0x166, script: 0x5b, flags: 0x0}, + 778: {region: 0x166, script: 0x5b, flags: 0x0}, 779: {region: 0x26, script: 0x3, flags: 0x1}, - 780: {region: 0x165, script: 0x5a, flags: 0x0}, - 781: {region: 0x165, script: 0x5a, flags: 0x0}, - 782: {region: 0x99, script: 0xe, flags: 0x0}, - 783: {region: 0xc4, script: 0x75, flags: 0x0}, - 785: {region: 0x165, script: 0x5a, flags: 0x0}, - 786: {region: 0x49, script: 0x5a, flags: 0x0}, - 787: {region: 0x49, script: 0x5a, flags: 0x0}, - 788: {region: 0x37, script: 0x5a, flags: 0x0}, - 789: {region: 0x165, script: 0x5a, flags: 0x0}, - 790: {region: 0x165, script: 0x5a, flags: 0x0}, - 791: {region: 0x165, script: 0x5a, flags: 0x0}, - 792: {region: 0x165, script: 0x5a, flags: 0x0}, - 793: {region: 0x165, script: 0x5a, flags: 0x0}, - 794: {region: 0x165, script: 0x5a, flags: 0x0}, - 795: {region: 0x99, script: 0x22, flags: 0x0}, - 796: {region: 0xdb, script: 0x22, flags: 0x0}, - 797: {region: 0x106, script: 0x20, flags: 0x0}, - 798: {region: 0x35, script: 0x72, flags: 0x0}, + 780: {region: 0x166, script: 0x5b, flags: 0x0}, + 781: {region: 0x166, script: 0x5b, flags: 0x0}, + 782: {region: 0x9a, script: 0xe, flags: 0x0}, + 783: {region: 0xc5, script: 0x76, flags: 0x0}, + 785: {region: 0x166, script: 0x5b, flags: 0x0}, + 786: {region: 0x49, script: 0x5b, flags: 0x0}, + 787: {region: 0x49, script: 0x5b, flags: 0x0}, + 788: {region: 0x37, script: 0x5b, flags: 0x0}, + 789: {region: 0x166, script: 0x5b, flags: 0x0}, + 790: {region: 0x166, script: 0x5b, flags: 0x0}, + 791: {region: 0x166, script: 0x5b, flags: 0x0}, + 792: {region: 0x166, script: 0x5b, flags: 0x0}, + 793: {region: 0x166, script: 0x5b, flags: 0x0}, + 794: {region: 0x166, script: 0x5b, flags: 0x0}, + 795: {region: 0x9a, script: 0x22, flags: 0x0}, + 796: {region: 0xdc, script: 0x22, flags: 0x0}, + 797: {region: 0x107, script: 0x20, flags: 0x0}, + 798: {region: 0x35, script: 0x73, flags: 0x0}, 799: {region: 0x29, script: 0x3, flags: 0x1}, - 800: {region: 0xcb, script: 0x5a, flags: 0x0}, - 801: {region: 0x165, script: 0x5a, flags: 0x0}, - 802: {region: 0x165, script: 0x5a, flags: 0x0}, - 803: {region: 0x165, script: 0x5a, flags: 0x0}, - 804: {region: 0x99, script: 0x22, flags: 0x0}, - 805: {region: 0x52, script: 0x5a, flags: 0x0}, - 807: {region: 0x165, script: 0x5a, flags: 0x0}, - 808: {region: 0x135, script: 0x5a, flags: 0x0}, - 809: {region: 0x165, script: 0x5a, flags: 0x0}, - 810: {region: 0x165, script: 0x5a, flags: 0x0}, - 811: {region: 0xe8, script: 0x5, flags: 0x0}, - 812: {region: 0xc3, script: 0x5a, flags: 0x0}, - 813: {region: 0x99, script: 0x22, flags: 0x0}, - 814: {region: 0x95, script: 0x5a, flags: 0x0}, - 815: {region: 0x164, script: 0x5a, flags: 0x0}, - 816: {region: 0x165, script: 0x5a, flags: 0x0}, - 817: {region: 0xc4, script: 0x75, flags: 0x0}, - 818: {region: 0x165, script: 0x5a, flags: 0x0}, - 819: {region: 0x165, script: 0x2c, flags: 0x0}, - 820: {region: 0x106, script: 0x20, flags: 0x0}, - 821: {region: 0x165, script: 0x5a, flags: 0x0}, - 822: {region: 0x131, script: 0x5a, flags: 0x0}, - 823: {region: 0x9c, script: 0x66, flags: 0x0}, - 824: {region: 0x165, script: 0x5a, flags: 0x0}, - 825: {region: 0x165, script: 0x5a, flags: 0x0}, - 826: {region: 0x9c, script: 0x5, flags: 0x0}, - 827: {region: 0x165, script: 0x5a, flags: 0x0}, - 828: {region: 0x165, script: 0x5a, flags: 0x0}, - 829: {region: 0x165, script: 0x5a, flags: 0x0}, - 830: {region: 0xdd, script: 0x5a, flags: 0x0}, - 831: {region: 0x165, script: 0x5a, flags: 0x0}, - 832: {region: 0x165, script: 0x5a, flags: 0x0}, - 834: {region: 0x165, script: 0x5a, flags: 0x0}, + 800: {region: 0xcc, script: 0x5b, flags: 0x0}, + 801: {region: 0x166, script: 0x5b, flags: 0x0}, + 802: {region: 0x166, script: 0x5b, flags: 0x0}, + 803: {region: 0x166, script: 0x5b, flags: 0x0}, + 804: {region: 0x9a, script: 0x22, flags: 0x0}, + 805: {region: 0x52, script: 0x5b, flags: 0x0}, + 807: {region: 0x166, script: 0x5b, flags: 0x0}, + 808: {region: 0x136, script: 0x5b, flags: 0x0}, + 809: {region: 0x166, script: 0x5b, flags: 0x0}, + 810: {region: 0x166, script: 0x5b, flags: 0x0}, + 811: {region: 0xe9, script: 0x5, flags: 0x0}, + 812: {region: 0xc4, script: 0x5b, flags: 0x0}, + 813: {region: 0x9a, script: 0x22, flags: 0x0}, + 814: {region: 0x96, script: 0x5b, flags: 0x0}, + 815: {region: 0x165, script: 0x5b, flags: 0x0}, + 816: {region: 0x166, script: 0x5b, flags: 0x0}, + 817: {region: 0xc5, script: 0x76, flags: 0x0}, + 818: {region: 0x166, script: 0x5b, flags: 0x0}, + 819: {region: 0x166, script: 0x2c, flags: 0x0}, + 820: {region: 0x107, script: 0x20, flags: 0x0}, + 821: {region: 0x166, script: 0x5b, flags: 0x0}, + 822: {region: 0x132, script: 0x5b, flags: 0x0}, + 823: {region: 0x9d, script: 0x67, flags: 0x0}, + 824: {region: 0x166, script: 0x5b, flags: 0x0}, + 825: {region: 0x166, script: 0x5b, flags: 0x0}, + 826: {region: 0x9d, script: 0x5, flags: 0x0}, + 827: {region: 0x166, script: 0x5b, flags: 0x0}, + 828: {region: 0x166, script: 0x5b, flags: 0x0}, + 829: {region: 0x166, script: 0x5b, flags: 0x0}, + 830: {region: 0xde, script: 0x5b, flags: 0x0}, + 831: {region: 0x166, script: 0x5b, flags: 0x0}, + 832: {region: 0x166, script: 0x5b, flags: 0x0}, + 834: {region: 0x166, script: 0x5b, flags: 0x0}, 835: {region: 0x53, script: 0x3b, flags: 0x0}, - 836: {region: 0x9e, script: 0x5a, flags: 0x0}, - 837: {region: 0xd2, script: 0x5a, flags: 0x0}, - 838: {region: 0x165, script: 0x5a, flags: 0x0}, - 839: {region: 0xda, script: 0x5a, flags: 0x0}, - 840: {region: 0x165, script: 0x5a, flags: 0x0}, - 841: {region: 0x165, script: 0x5a, flags: 0x0}, - 842: {region: 0x165, script: 0x5a, flags: 0x0}, - 843: {region: 0xcf, script: 0x5a, flags: 0x0}, - 844: {region: 0x165, script: 0x5a, flags: 0x0}, - 845: {region: 0x165, script: 0x5a, flags: 0x0}, - 846: {region: 0x164, script: 0x5a, flags: 0x0}, - 847: {region: 0xd1, script: 0x5a, flags: 0x0}, - 848: {region: 0x60, script: 0x5a, flags: 0x0}, - 849: {region: 0xdb, script: 0x22, flags: 0x0}, - 850: {region: 0x165, script: 0x5a, flags: 0x0}, - 851: {region: 0xdb, script: 0x22, flags: 0x0}, - 852: {region: 0x165, script: 0x5a, flags: 0x0}, - 853: {region: 0x165, script: 0x5a, flags: 0x0}, - 854: {region: 0xd2, script: 0x5a, flags: 0x0}, - 855: {region: 0x165, script: 0x5a, flags: 0x0}, - 856: {region: 0x165, script: 0x5a, flags: 0x0}, - 857: {region: 0xd1, script: 0x5a, flags: 0x0}, - 858: {region: 0x165, script: 0x5a, flags: 0x0}, - 859: {region: 0xcf, script: 0x5a, flags: 0x0}, - 860: {region: 0xcf, script: 0x5a, flags: 0x0}, - 861: {region: 0x165, script: 0x5a, flags: 0x0}, - 862: {region: 0x165, script: 0x5a, flags: 0x0}, - 863: {region: 0x95, script: 0x5a, flags: 0x0}, - 864: {region: 0x165, script: 0x5a, flags: 0x0}, - 865: {region: 0xdf, script: 0x5a, flags: 0x0}, - 866: {region: 0x165, script: 0x5a, flags: 0x0}, - 867: {region: 0x165, script: 0x5a, flags: 0x0}, - 868: {region: 0x99, script: 0x5a, flags: 0x0}, - 869: {region: 0x165, script: 0x5a, flags: 0x0}, - 870: {region: 0x165, script: 0x5a, flags: 0x0}, - 871: {region: 0xd9, script: 0x5a, flags: 0x0}, - 872: {region: 0x52, script: 0x5a, flags: 0x0}, - 873: {region: 0x165, script: 0x5a, flags: 0x0}, - 874: {region: 0xda, script: 0x5a, flags: 0x0}, - 875: {region: 0x165, script: 0x5a, flags: 0x0}, - 876: {region: 0x52, script: 0x5a, flags: 0x0}, - 877: {region: 0x165, script: 0x5a, flags: 0x0}, - 878: {region: 0x165, script: 0x5a, flags: 0x0}, - 879: {region: 0xda, script: 0x5a, flags: 0x0}, - 880: {region: 0x123, script: 0x56, flags: 0x0}, - 881: {region: 0x99, script: 0x22, flags: 0x0}, - 882: {region: 0x10c, script: 0xc9, flags: 0x0}, - 883: {region: 0x165, script: 0x5a, flags: 0x0}, - 884: {region: 0x165, script: 0x5a, flags: 0x0}, - 885: {region: 0x84, script: 0x7c, flags: 0x0}, - 886: {region: 0x161, script: 0x5a, flags: 0x0}, - 887: {region: 0x165, script: 0x5a, flags: 0x0}, + 836: {region: 0x9f, script: 0x5b, flags: 0x0}, + 837: {region: 0xd3, script: 0x5b, flags: 0x0}, + 838: {region: 0x166, script: 0x5b, flags: 0x0}, + 839: {region: 0xdb, script: 0x5b, flags: 0x0}, + 840: {region: 0x166, script: 0x5b, flags: 0x0}, + 841: {region: 0x166, script: 0x5b, flags: 0x0}, + 842: {region: 0x166, script: 0x5b, flags: 0x0}, + 843: {region: 0xd0, script: 0x5b, flags: 0x0}, + 844: {region: 0x166, script: 0x5b, flags: 0x0}, + 845: {region: 0x166, script: 0x5b, flags: 0x0}, + 846: {region: 0x165, script: 0x5b, flags: 0x0}, + 847: {region: 0xd2, script: 0x5b, flags: 0x0}, + 848: {region: 0x61, script: 0x5b, flags: 0x0}, + 849: {region: 0xdc, script: 0x22, flags: 0x0}, + 850: {region: 0x166, script: 0x5b, flags: 0x0}, + 851: {region: 0xdc, script: 0x22, flags: 0x0}, + 852: {region: 0x166, script: 0x5b, flags: 0x0}, + 853: {region: 0x166, script: 0x5b, flags: 0x0}, + 854: {region: 0xd3, script: 0x5b, flags: 0x0}, + 855: {region: 0x166, script: 0x5b, flags: 0x0}, + 856: {region: 0x166, script: 0x5b, flags: 0x0}, + 857: {region: 0xd2, script: 0x5b, flags: 0x0}, + 858: {region: 0x166, script: 0x5b, flags: 0x0}, + 859: {region: 0xd0, script: 0x5b, flags: 0x0}, + 860: {region: 0xd0, script: 0x5b, flags: 0x0}, + 861: {region: 0x166, script: 0x5b, flags: 0x0}, + 862: {region: 0x166, script: 0x5b, flags: 0x0}, + 863: {region: 0x96, script: 0x5b, flags: 0x0}, + 864: {region: 0x166, script: 0x5b, flags: 0x0}, + 865: {region: 0xe0, script: 0x5b, flags: 0x0}, + 866: {region: 0x166, script: 0x5b, flags: 0x0}, + 867: {region: 0x166, script: 0x5b, flags: 0x0}, + 868: {region: 0x9a, script: 0x5b, flags: 0x0}, + 869: {region: 0x166, script: 0x5b, flags: 0x0}, + 870: {region: 0x166, script: 0x5b, flags: 0x0}, + 871: {region: 0xda, script: 0x5b, flags: 0x0}, + 872: {region: 0x52, script: 0x5b, flags: 0x0}, + 873: {region: 0x166, script: 0x5b, flags: 0x0}, + 874: {region: 0xdb, script: 0x5b, flags: 0x0}, + 875: {region: 0x166, script: 0x5b, flags: 0x0}, + 876: {region: 0x52, script: 0x5b, flags: 0x0}, + 877: {region: 0x166, script: 0x5b, flags: 0x0}, + 878: {region: 0x166, script: 0x5b, flags: 0x0}, + 879: {region: 0xdb, script: 0x5b, flags: 0x0}, + 880: {region: 0x124, script: 0x57, flags: 0x0}, + 881: {region: 0x9a, script: 0x22, flags: 0x0}, + 882: {region: 0x10d, script: 0xcb, flags: 0x0}, + 883: {region: 0x166, script: 0x5b, flags: 0x0}, + 884: {region: 0x166, script: 0x5b, flags: 0x0}, + 885: {region: 0x85, script: 0x7e, flags: 0x0}, + 886: {region: 0x162, script: 0x5b, flags: 0x0}, + 887: {region: 0x166, script: 0x5b, flags: 0x0}, 888: {region: 0x49, script: 0x17, flags: 0x0}, - 889: {region: 0x165, script: 0x5a, flags: 0x0}, - 890: {region: 0x161, script: 0x5a, flags: 0x0}, - 891: {region: 0x165, script: 0x5a, flags: 0x0}, - 892: {region: 0x165, script: 0x5a, flags: 0x0}, - 893: {region: 0x165, script: 0x5a, flags: 0x0}, - 894: {region: 0x165, script: 0x5a, flags: 0x0}, - 895: {region: 0x165, script: 0x5a, flags: 0x0}, - 896: {region: 0x117, script: 0x5a, flags: 0x0}, - 897: {region: 0x165, script: 0x5a, flags: 0x0}, - 898: {region: 0x165, script: 0x5a, flags: 0x0}, - 899: {region: 0x135, script: 0x5a, flags: 0x0}, - 900: {region: 0x165, script: 0x5a, flags: 0x0}, - 901: {region: 0x53, script: 0x5a, flags: 0x0}, - 902: {region: 0x165, script: 0x5a, flags: 0x0}, - 903: {region: 0xce, script: 0x5a, flags: 0x0}, - 904: {region: 0x12f, script: 0x5a, flags: 0x0}, - 905: {region: 0x131, script: 0x5a, flags: 0x0}, - 906: {region: 0x80, script: 0x5a, flags: 0x0}, - 907: {region: 0x78, script: 0x5a, flags: 0x0}, - 908: {region: 0x165, script: 0x5a, flags: 0x0}, - 910: {region: 0x165, script: 0x5a, flags: 0x0}, - 911: {region: 0x165, script: 0x5a, flags: 0x0}, - 912: {region: 0x6f, script: 0x5a, flags: 0x0}, - 913: {region: 0x165, script: 0x5a, flags: 0x0}, - 914: {region: 0x165, script: 0x5a, flags: 0x0}, - 915: {region: 0x165, script: 0x5a, flags: 0x0}, - 916: {region: 0x165, script: 0x5a, flags: 0x0}, - 917: {region: 0x99, script: 0x81, flags: 0x0}, - 918: {region: 0x165, script: 0x5a, flags: 0x0}, - 919: {region: 0x165, script: 0x5, flags: 0x0}, - 920: {region: 0x7d, script: 0x20, flags: 0x0}, - 921: {region: 0x135, script: 0x82, flags: 0x0}, - 922: {region: 0x165, script: 0x5, flags: 0x0}, - 923: {region: 0xc5, script: 0x80, flags: 0x0}, - 924: {region: 0x165, script: 0x5a, flags: 0x0}, + 889: {region: 0x166, script: 0x5b, flags: 0x0}, + 890: {region: 0x162, script: 0x5b, flags: 0x0}, + 891: {region: 0x166, script: 0x5b, flags: 0x0}, + 892: {region: 0x166, script: 0x5b, flags: 0x0}, + 893: {region: 0x166, script: 0x5b, flags: 0x0}, + 894: {region: 0x166, script: 0x5b, flags: 0x0}, + 895: {region: 0x166, script: 0x5b, flags: 0x0}, + 896: {region: 0x118, script: 0x5b, flags: 0x0}, + 897: {region: 0x166, script: 0x5b, flags: 0x0}, + 898: {region: 0x166, script: 0x5b, flags: 0x0}, + 899: {region: 0x136, script: 0x5b, flags: 0x0}, + 900: {region: 0x166, script: 0x5b, flags: 0x0}, + 901: {region: 0x53, script: 0x5b, flags: 0x0}, + 902: {region: 0x166, script: 0x5b, flags: 0x0}, + 903: {region: 0xcf, script: 0x5b, flags: 0x0}, + 904: {region: 0x130, script: 0x5b, flags: 0x0}, + 905: {region: 0x132, script: 0x5b, flags: 0x0}, + 906: {region: 0x81, script: 0x5b, flags: 0x0}, + 907: {region: 0x79, script: 0x5b, flags: 0x0}, + 908: {region: 0x166, script: 0x5b, flags: 0x0}, + 910: {region: 0x166, script: 0x5b, flags: 0x0}, + 911: {region: 0x166, script: 0x5b, flags: 0x0}, + 912: {region: 0x70, script: 0x5b, flags: 0x0}, + 913: {region: 0x166, script: 0x5b, flags: 0x0}, + 914: {region: 0x166, script: 0x5b, flags: 0x0}, + 915: {region: 0x166, script: 0x5b, flags: 0x0}, + 916: {region: 0x166, script: 0x5b, flags: 0x0}, + 917: {region: 0x9a, script: 0x83, flags: 0x0}, + 918: {region: 0x166, script: 0x5b, flags: 0x0}, + 919: {region: 0x166, script: 0x5, flags: 0x0}, + 920: {region: 0x7e, script: 0x20, flags: 0x0}, + 921: {region: 0x136, script: 0x84, flags: 0x0}, + 922: {region: 0x166, script: 0x5, flags: 0x0}, + 923: {region: 0xc6, script: 0x82, flags: 0x0}, + 924: {region: 0x166, script: 0x5b, flags: 0x0}, 925: {region: 0x2c, script: 0x3, flags: 0x1}, - 926: {region: 0xe7, script: 0x5a, flags: 0x0}, + 926: {region: 0xe8, script: 0x5b, flags: 0x0}, 927: {region: 0x2f, script: 0x2, flags: 0x1}, - 928: {region: 0xe7, script: 0x5a, flags: 0x0}, - 929: {region: 0x30, script: 0x5a, flags: 0x0}, - 930: {region: 0xf0, script: 0x5a, flags: 0x0}, - 931: {region: 0x165, script: 0x5a, flags: 0x0}, - 932: {region: 0x78, script: 0x5a, flags: 0x0}, - 933: {region: 0xd6, script: 0x5a, flags: 0x0}, - 934: {region: 0x135, script: 0x5a, flags: 0x0}, - 935: {region: 0x49, script: 0x5a, flags: 0x0}, - 936: {region: 0x165, script: 0x5a, flags: 0x0}, - 937: {region: 0x9c, script: 0xf7, flags: 0x0}, - 938: {region: 0x165, script: 0x5a, flags: 0x0}, - 939: {region: 0x60, script: 0x5a, flags: 0x0}, - 940: {region: 0x165, script: 0x5, flags: 0x0}, - 941: {region: 0xb0, script: 0x8e, flags: 0x0}, - 943: {region: 0x165, script: 0x5a, flags: 0x0}, - 944: {region: 0x165, script: 0x5a, flags: 0x0}, - 945: {region: 0x99, script: 0x12, flags: 0x0}, - 946: {region: 0xa4, script: 0x5a, flags: 0x0}, - 947: {region: 0xe9, script: 0x5a, flags: 0x0}, - 948: {region: 0x165, script: 0x5a, flags: 0x0}, - 949: {region: 0x9e, script: 0x5a, flags: 0x0}, - 950: {region: 0x165, script: 0x5a, flags: 0x0}, - 951: {region: 0x165, script: 0x5a, flags: 0x0}, - 952: {region: 0x87, script: 0x34, flags: 0x0}, - 953: {region: 0x75, script: 0x5a, flags: 0x0}, - 954: {region: 0x165, script: 0x5a, flags: 0x0}, - 955: {region: 0xe8, script: 0x4d, flags: 0x0}, - 956: {region: 0x9c, script: 0x5, flags: 0x0}, - 957: {region: 0x1, script: 0x5a, flags: 0x0}, + 928: {region: 0xe8, script: 0x5b, flags: 0x0}, + 929: {region: 0x30, script: 0x5b, flags: 0x0}, + 930: {region: 0xf1, script: 0x5b, flags: 0x0}, + 931: {region: 0x166, script: 0x5b, flags: 0x0}, + 932: {region: 0x79, script: 0x5b, flags: 0x0}, + 933: {region: 0xd7, script: 0x5b, flags: 0x0}, + 934: {region: 0x136, script: 0x5b, flags: 0x0}, + 935: {region: 0x49, script: 0x5b, flags: 0x0}, + 936: {region: 0x166, script: 0x5b, flags: 0x0}, + 937: {region: 0x9d, script: 0xfa, flags: 0x0}, + 938: {region: 0x166, script: 0x5b, flags: 0x0}, + 939: {region: 0x61, script: 0x5b, flags: 0x0}, + 940: {region: 0x166, script: 0x5, flags: 0x0}, + 941: {region: 0xb1, script: 0x90, flags: 0x0}, + 943: {region: 0x166, script: 0x5b, flags: 0x0}, + 944: {region: 0x166, script: 0x5b, flags: 0x0}, + 945: {region: 0x9a, script: 0x12, flags: 0x0}, + 946: {region: 0xa5, script: 0x5b, flags: 0x0}, + 947: {region: 0xea, script: 0x5b, flags: 0x0}, + 948: {region: 0x166, script: 0x5b, flags: 0x0}, + 949: {region: 0x9f, script: 0x5b, flags: 0x0}, + 950: {region: 0x166, script: 0x5b, flags: 0x0}, + 951: {region: 0x166, script: 0x5b, flags: 0x0}, + 952: {region: 0x88, script: 0x34, flags: 0x0}, + 953: {region: 0x76, script: 0x5b, flags: 0x0}, + 954: {region: 0x166, script: 0x5b, flags: 0x0}, + 955: {region: 0xe9, script: 0x4e, flags: 0x0}, + 956: {region: 0x9d, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x5b, flags: 0x0}, 958: {region: 0x24, script: 0x5, flags: 0x0}, - 959: {region: 0x165, script: 0x5a, flags: 0x0}, - 960: {region: 0x41, script: 0x5a, flags: 0x0}, - 961: {region: 0x165, script: 0x5a, flags: 0x0}, - 962: {region: 0x7a, script: 0x5a, flags: 0x0}, - 963: {region: 0x165, script: 0x5a, flags: 0x0}, - 964: {region: 0xe4, script: 0x5a, flags: 0x0}, - 965: {region: 0x89, script: 0x5a, flags: 0x0}, - 966: {region: 0x69, script: 0x5a, flags: 0x0}, - 967: {region: 0x165, script: 0x5a, flags: 0x0}, - 968: {region: 0x99, script: 0x22, flags: 0x0}, - 969: {region: 0x165, script: 0x5a, flags: 0x0}, - 970: {region: 0x102, script: 0x5a, flags: 0x0}, - 971: {region: 0x95, script: 0x5a, flags: 0x0}, - 972: {region: 0x165, script: 0x5a, flags: 0x0}, - 973: {region: 0x165, script: 0x5a, flags: 0x0}, - 974: {region: 0x9e, script: 0x5a, flags: 0x0}, - 975: {region: 0x165, script: 0x5, flags: 0x0}, - 976: {region: 0x99, script: 0x5a, flags: 0x0}, + 959: {region: 0x166, script: 0x5b, flags: 0x0}, + 960: {region: 0x41, script: 0x5b, flags: 0x0}, + 961: {region: 0x166, script: 0x5b, flags: 0x0}, + 962: {region: 0x7b, script: 0x5b, flags: 0x0}, + 963: {region: 0x166, script: 0x5b, flags: 0x0}, + 964: {region: 0xe5, script: 0x5b, flags: 0x0}, + 965: {region: 0x8a, script: 0x5b, flags: 0x0}, + 966: {region: 0x6a, script: 0x5b, flags: 0x0}, + 967: {region: 0x166, script: 0x5b, flags: 0x0}, + 968: {region: 0x9a, script: 0x22, flags: 0x0}, + 969: {region: 0x166, script: 0x5b, flags: 0x0}, + 970: {region: 0x103, script: 0x5b, flags: 0x0}, + 971: {region: 0x96, script: 0x5b, flags: 0x0}, + 972: {region: 0x166, script: 0x5b, flags: 0x0}, + 973: {region: 0x166, script: 0x5b, flags: 0x0}, + 974: {region: 0x9f, script: 0x5b, flags: 0x0}, + 975: {region: 0x166, script: 0x5, flags: 0x0}, + 976: {region: 0x9a, script: 0x5b, flags: 0x0}, 977: {region: 0x31, script: 0x2, flags: 0x1}, - 978: {region: 0xdb, script: 0x22, flags: 0x0}, + 978: {region: 0xdc, script: 0x22, flags: 0x0}, 979: {region: 0x35, script: 0xe, flags: 0x0}, - 980: {region: 0x4e, script: 0x5a, flags: 0x0}, - 981: {region: 0x72, script: 0x5a, flags: 0x0}, - 982: {region: 0x4e, script: 0x5a, flags: 0x0}, - 983: {region: 0x9c, script: 0x5, flags: 0x0}, - 984: {region: 0x10c, script: 0x5a, flags: 0x0}, - 985: {region: 0x3a, script: 0x5a, flags: 0x0}, - 986: {region: 0x165, script: 0x5a, flags: 0x0}, - 987: {region: 0xd1, script: 0x5a, flags: 0x0}, - 988: {region: 0x104, script: 0x5a, flags: 0x0}, - 989: {region: 0x95, script: 0x5a, flags: 0x0}, - 990: {region: 0x12f, script: 0x5a, flags: 0x0}, - 991: {region: 0x165, script: 0x5a, flags: 0x0}, - 992: {region: 0x165, script: 0x5a, flags: 0x0}, - 993: {region: 0x73, script: 0x5a, flags: 0x0}, - 994: {region: 0x106, script: 0x20, flags: 0x0}, - 995: {region: 0x130, script: 0x20, flags: 0x0}, - 996: {region: 0x109, script: 0x5a, flags: 0x0}, - 997: {region: 0x107, script: 0x5a, flags: 0x0}, - 998: {region: 0x12f, script: 0x5a, flags: 0x0}, - 999: {region: 0x165, script: 0x5a, flags: 0x0}, - 1000: {region: 0xa2, script: 0x4c, flags: 0x0}, - 1001: {region: 0x99, script: 0x22, flags: 0x0}, - 1002: {region: 0x80, script: 0x5a, flags: 0x0}, - 1003: {region: 0x106, script: 0x20, flags: 0x0}, - 1004: {region: 0xa4, script: 0x5a, flags: 0x0}, - 1005: {region: 0x95, script: 0x5a, flags: 0x0}, - 1006: {region: 0x99, script: 0x5a, flags: 0x0}, - 1007: {region: 0x114, script: 0x5a, flags: 0x0}, - 1008: {region: 0x99, script: 0xcd, flags: 0x0}, - 1009: {region: 0x165, script: 0x5a, flags: 0x0}, - 1010: {region: 0x165, script: 0x5a, flags: 0x0}, - 1011: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1012: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1013: {region: 0x99, script: 0x22, flags: 0x0}, - 1014: {region: 0x165, script: 0x5, flags: 0x0}, - 1015: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1016: {region: 0x7b, script: 0x5a, flags: 0x0}, - 1017: {region: 0x49, script: 0x5a, flags: 0x0}, + 980: {region: 0x4e, script: 0x5b, flags: 0x0}, + 981: {region: 0x73, script: 0x5b, flags: 0x0}, + 982: {region: 0x4e, script: 0x5b, flags: 0x0}, + 983: {region: 0x9d, script: 0x5, flags: 0x0}, + 984: {region: 0x10d, script: 0x5b, flags: 0x0}, + 985: {region: 0x3a, script: 0x5b, flags: 0x0}, + 986: {region: 0x166, script: 0x5b, flags: 0x0}, + 987: {region: 0xd2, script: 0x5b, flags: 0x0}, + 988: {region: 0x105, script: 0x5b, flags: 0x0}, + 989: {region: 0x96, script: 0x5b, flags: 0x0}, + 990: {region: 0x130, script: 0x5b, flags: 0x0}, + 991: {region: 0x166, script: 0x5b, flags: 0x0}, + 992: {region: 0x166, script: 0x5b, flags: 0x0}, + 993: {region: 0x74, script: 0x5b, flags: 0x0}, + 994: {region: 0x107, script: 0x20, flags: 0x0}, + 995: {region: 0x131, script: 0x20, flags: 0x0}, + 996: {region: 0x10a, script: 0x5b, flags: 0x0}, + 997: {region: 0x108, script: 0x5b, flags: 0x0}, + 998: {region: 0x130, script: 0x5b, flags: 0x0}, + 999: {region: 0x166, script: 0x5b, flags: 0x0}, + 1000: {region: 0xa3, script: 0x4c, flags: 0x0}, + 1001: {region: 0x9a, script: 0x22, flags: 0x0}, + 1002: {region: 0x81, script: 0x5b, flags: 0x0}, + 1003: {region: 0x107, script: 0x20, flags: 0x0}, + 1004: {region: 0xa5, script: 0x5b, flags: 0x0}, + 1005: {region: 0x96, script: 0x5b, flags: 0x0}, + 1006: {region: 0x9a, script: 0x5b, flags: 0x0}, + 1007: {region: 0x115, script: 0x5b, flags: 0x0}, + 1008: {region: 0x9a, script: 0xcf, flags: 0x0}, + 1009: {region: 0x166, script: 0x5b, flags: 0x0}, + 1010: {region: 0x166, script: 0x5b, flags: 0x0}, + 1011: {region: 0x130, script: 0x5b, flags: 0x0}, + 1012: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1013: {region: 0x9a, script: 0x22, flags: 0x0}, + 1014: {region: 0x166, script: 0x5, flags: 0x0}, + 1015: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1016: {region: 0x7c, script: 0x5b, flags: 0x0}, + 1017: {region: 0x49, script: 0x5b, flags: 0x0}, 1018: {region: 0x33, script: 0x4, flags: 0x1}, - 1019: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1020: {region: 0x9c, script: 0x5, flags: 0x0}, - 1021: {region: 0xda, script: 0x5a, flags: 0x0}, - 1022: {region: 0x4f, script: 0x5a, flags: 0x0}, - 1023: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1024: {region: 0xcf, script: 0x5a, flags: 0x0}, - 1025: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1026: {region: 0x4c, script: 0x5a, flags: 0x0}, - 1027: {region: 0x96, script: 0x7e, flags: 0x0}, - 1028: {region: 0xb6, script: 0x5a, flags: 0x0}, - 1029: {region: 0x165, script: 0x2c, flags: 0x0}, - 1030: {region: 0x165, script: 0x5a, flags: 0x0}, - 1032: {region: 0xba, script: 0xe8, flags: 0x0}, - 1033: {region: 0x165, script: 0x5a, flags: 0x0}, - 1034: {region: 0xc4, script: 0x75, flags: 0x0}, - 1035: {region: 0x165, script: 0x5, flags: 0x0}, - 1036: {region: 0xb3, script: 0xd4, flags: 0x0}, - 1037: {region: 0x6f, script: 0x5a, flags: 0x0}, - 1038: {region: 0x165, script: 0x5a, flags: 0x0}, - 1039: {region: 0x165, script: 0x5a, flags: 0x0}, - 1040: {region: 0x165, script: 0x5a, flags: 0x0}, - 1041: {region: 0x165, script: 0x5a, flags: 0x0}, - 1042: {region: 0x111, script: 0x5a, flags: 0x0}, - 1043: {region: 0x165, script: 0x5a, flags: 0x0}, - 1044: {region: 0xe8, script: 0x5, flags: 0x0}, - 1045: {region: 0x165, script: 0x5a, flags: 0x0}, - 1046: {region: 0x10f, script: 0x5a, flags: 0x0}, - 1047: {region: 0x165, script: 0x5a, flags: 0x0}, - 1048: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1049: {region: 0x165, script: 0x5a, flags: 0x0}, - 1050: {region: 0x95, script: 0x5a, flags: 0x0}, - 1051: {region: 0x142, script: 0x5a, flags: 0x0}, - 1052: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1054: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1055: {region: 0x72, script: 0x5a, flags: 0x0}, - 1056: {region: 0x97, script: 0xca, flags: 0x0}, - 1057: {region: 0x165, script: 0x5a, flags: 0x0}, - 1058: {region: 0x72, script: 0x5a, flags: 0x0}, - 1059: {region: 0x164, script: 0x5a, flags: 0x0}, - 1060: {region: 0x165, script: 0x5a, flags: 0x0}, - 1061: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1062: {region: 0x165, script: 0x5a, flags: 0x0}, - 1063: {region: 0x165, script: 0x5a, flags: 0x0}, - 1064: {region: 0x165, script: 0x5a, flags: 0x0}, - 1065: {region: 0x115, script: 0x5a, flags: 0x0}, - 1066: {region: 0x165, script: 0x5a, flags: 0x0}, - 1067: {region: 0x165, script: 0x5a, flags: 0x0}, - 1068: {region: 0x123, script: 0xeb, flags: 0x0}, - 1069: {region: 0x165, script: 0x5a, flags: 0x0}, - 1070: {region: 0x165, script: 0x5a, flags: 0x0}, - 1071: {region: 0x165, script: 0x5a, flags: 0x0}, - 1072: {region: 0x165, script: 0x5a, flags: 0x0}, - 1073: {region: 0x27, script: 0x5a, flags: 0x0}, + 1019: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1020: {region: 0x9d, script: 0x5, flags: 0x0}, + 1021: {region: 0xdb, script: 0x5b, flags: 0x0}, + 1022: {region: 0x4f, script: 0x5b, flags: 0x0}, + 1023: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1024: {region: 0xd0, script: 0x5b, flags: 0x0}, + 1025: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1026: {region: 0x4c, script: 0x5b, flags: 0x0}, + 1027: {region: 0x97, script: 0x80, flags: 0x0}, + 1028: {region: 0xb7, script: 0x5b, flags: 0x0}, + 1029: {region: 0x166, script: 0x2c, flags: 0x0}, + 1030: {region: 0x166, script: 0x5b, flags: 0x0}, + 1032: {region: 0xbb, script: 0xeb, flags: 0x0}, + 1033: {region: 0x166, script: 0x5b, flags: 0x0}, + 1034: {region: 0xc5, script: 0x76, flags: 0x0}, + 1035: {region: 0x166, script: 0x5, flags: 0x0}, + 1036: {region: 0xb4, script: 0xd6, flags: 0x0}, + 1037: {region: 0x70, script: 0x5b, flags: 0x0}, + 1038: {region: 0x166, script: 0x5b, flags: 0x0}, + 1039: {region: 0x166, script: 0x5b, flags: 0x0}, + 1040: {region: 0x166, script: 0x5b, flags: 0x0}, + 1041: {region: 0x166, script: 0x5b, flags: 0x0}, + 1042: {region: 0x112, script: 0x5b, flags: 0x0}, + 1043: {region: 0x166, script: 0x5b, flags: 0x0}, + 1044: {region: 0xe9, script: 0x5, flags: 0x0}, + 1045: {region: 0x166, script: 0x5b, flags: 0x0}, + 1046: {region: 0x110, script: 0x5b, flags: 0x0}, + 1047: {region: 0x166, script: 0x5b, flags: 0x0}, + 1048: {region: 0xea, script: 0x5b, flags: 0x0}, + 1049: {region: 0x166, script: 0x5b, flags: 0x0}, + 1050: {region: 0x96, script: 0x5b, flags: 0x0}, + 1051: {region: 0x143, script: 0x5b, flags: 0x0}, + 1052: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1054: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1055: {region: 0x73, script: 0x5b, flags: 0x0}, + 1056: {region: 0x98, script: 0xcc, flags: 0x0}, + 1057: {region: 0x166, script: 0x5b, flags: 0x0}, + 1058: {region: 0x73, script: 0x5b, flags: 0x0}, + 1059: {region: 0x165, script: 0x5b, flags: 0x0}, + 1060: {region: 0x166, script: 0x5b, flags: 0x0}, + 1061: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1062: {region: 0x166, script: 0x5b, flags: 0x0}, + 1063: {region: 0x166, script: 0x5b, flags: 0x0}, + 1064: {region: 0x166, script: 0x5b, flags: 0x0}, + 1065: {region: 0x116, script: 0x5b, flags: 0x0}, + 1066: {region: 0x166, script: 0x5b, flags: 0x0}, + 1067: {region: 0x166, script: 0x5b, flags: 0x0}, + 1068: {region: 0x124, script: 0xee, flags: 0x0}, + 1069: {region: 0x166, script: 0x5b, flags: 0x0}, + 1070: {region: 0x166, script: 0x5b, flags: 0x0}, + 1071: {region: 0x166, script: 0x5b, flags: 0x0}, + 1072: {region: 0x166, script: 0x5b, flags: 0x0}, + 1073: {region: 0x27, script: 0x5b, flags: 0x0}, 1074: {region: 0x37, script: 0x5, flags: 0x1}, - 1075: {region: 0x99, script: 0xd7, flags: 0x0}, - 1076: {region: 0x116, script: 0x5a, flags: 0x0}, - 1077: {region: 0x114, script: 0x5a, flags: 0x0}, - 1078: {region: 0x99, script: 0x22, flags: 0x0}, - 1079: {region: 0x161, script: 0x5a, flags: 0x0}, - 1080: {region: 0x165, script: 0x5a, flags: 0x0}, - 1081: {region: 0x165, script: 0x5a, flags: 0x0}, - 1082: {region: 0x6d, script: 0x5a, flags: 0x0}, - 1083: {region: 0x161, script: 0x5a, flags: 0x0}, - 1084: {region: 0x165, script: 0x5a, flags: 0x0}, - 1085: {region: 0x60, script: 0x5a, flags: 0x0}, - 1086: {region: 0x95, script: 0x5a, flags: 0x0}, - 1087: {region: 0x165, script: 0x5a, flags: 0x0}, - 1088: {region: 0x165, script: 0x5a, flags: 0x0}, - 1089: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1090: {region: 0x165, script: 0x5a, flags: 0x0}, - 1091: {region: 0x84, script: 0x5a, flags: 0x0}, - 1092: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1093: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1094: {region: 0x15f, script: 0x5, flags: 0x0}, - 1095: {region: 0x4b, script: 0x5a, flags: 0x0}, - 1096: {region: 0x60, script: 0x5a, flags: 0x0}, - 1097: {region: 0x165, script: 0x5a, flags: 0x0}, - 1098: {region: 0x99, script: 0x22, flags: 0x0}, - 1099: {region: 0x95, script: 0x5a, flags: 0x0}, - 1100: {region: 0x165, script: 0x5a, flags: 0x0}, + 1075: {region: 0x9a, script: 0xd9, flags: 0x0}, + 1076: {region: 0x117, script: 0x5b, flags: 0x0}, + 1077: {region: 0x115, script: 0x5b, flags: 0x0}, + 1078: {region: 0x9a, script: 0x22, flags: 0x0}, + 1079: {region: 0x162, script: 0x5b, flags: 0x0}, + 1080: {region: 0x166, script: 0x5b, flags: 0x0}, + 1081: {region: 0x166, script: 0x5b, flags: 0x0}, + 1082: {region: 0x6e, script: 0x5b, flags: 0x0}, + 1083: {region: 0x162, script: 0x5b, flags: 0x0}, + 1084: {region: 0x166, script: 0x5b, flags: 0x0}, + 1085: {region: 0x61, script: 0x5b, flags: 0x0}, + 1086: {region: 0x96, script: 0x5b, flags: 0x0}, + 1087: {region: 0x166, script: 0x5b, flags: 0x0}, + 1088: {region: 0x166, script: 0x5b, flags: 0x0}, + 1089: {region: 0x130, script: 0x5b, flags: 0x0}, + 1090: {region: 0x166, script: 0x5b, flags: 0x0}, + 1091: {region: 0x85, script: 0x5b, flags: 0x0}, + 1092: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1093: {region: 0x130, script: 0x5b, flags: 0x0}, + 1094: {region: 0x160, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x5b, flags: 0x0}, + 1096: {region: 0x61, script: 0x5b, flags: 0x0}, + 1097: {region: 0x166, script: 0x5b, flags: 0x0}, + 1098: {region: 0x9a, script: 0x22, flags: 0x0}, + 1099: {region: 0x96, script: 0x5b, flags: 0x0}, + 1100: {region: 0x166, script: 0x5b, flags: 0x0}, 1101: {region: 0x35, script: 0xe, flags: 0x0}, - 1102: {region: 0x9b, script: 0xdb, flags: 0x0}, - 1103: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1104: {region: 0x99, script: 0xe3, flags: 0x0}, - 1105: {region: 0xdb, script: 0x22, flags: 0x0}, - 1106: {region: 0x165, script: 0x5a, flags: 0x0}, - 1107: {region: 0x165, script: 0x5a, flags: 0x0}, - 1108: {region: 0x165, script: 0x5a, flags: 0x0}, - 1109: {region: 0x165, script: 0x5a, flags: 0x0}, - 1110: {region: 0x165, script: 0x5a, flags: 0x0}, - 1111: {region: 0x165, script: 0x5a, flags: 0x0}, - 1112: {region: 0x165, script: 0x5a, flags: 0x0}, - 1113: {region: 0x165, script: 0x5a, flags: 0x0}, - 1114: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1115: {region: 0x165, script: 0x5a, flags: 0x0}, - 1116: {region: 0x165, script: 0x5a, flags: 0x0}, - 1117: {region: 0x99, script: 0x52, flags: 0x0}, - 1118: {region: 0x53, script: 0xe1, flags: 0x0}, - 1119: {region: 0xdb, script: 0x22, flags: 0x0}, - 1120: {region: 0xdb, script: 0x22, flags: 0x0}, - 1121: {region: 0x99, script: 0xe6, flags: 0x0}, - 1122: {region: 0x165, script: 0x5a, flags: 0x0}, - 1123: {region: 0x112, script: 0x5a, flags: 0x0}, - 1124: {region: 0x131, script: 0x5a, flags: 0x0}, - 1125: {region: 0x126, script: 0x5a, flags: 0x0}, - 1126: {region: 0x165, script: 0x5a, flags: 0x0}, + 1102: {region: 0x9c, script: 0xde, flags: 0x0}, + 1103: {region: 0xea, script: 0x5b, flags: 0x0}, + 1104: {region: 0x9a, script: 0xe6, flags: 0x0}, + 1105: {region: 0xdc, script: 0x22, flags: 0x0}, + 1106: {region: 0x166, script: 0x5b, flags: 0x0}, + 1107: {region: 0x166, script: 0x5b, flags: 0x0}, + 1108: {region: 0x166, script: 0x5b, flags: 0x0}, + 1109: {region: 0x166, script: 0x5b, flags: 0x0}, + 1110: {region: 0x166, script: 0x5b, flags: 0x0}, + 1111: {region: 0x166, script: 0x5b, flags: 0x0}, + 1112: {region: 0x166, script: 0x5b, flags: 0x0}, + 1113: {region: 0x166, script: 0x5b, flags: 0x0}, + 1114: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1115: {region: 0x166, script: 0x5b, flags: 0x0}, + 1116: {region: 0x166, script: 0x5b, flags: 0x0}, + 1117: {region: 0x9a, script: 0x53, flags: 0x0}, + 1118: {region: 0x53, script: 0xe4, flags: 0x0}, + 1119: {region: 0xdc, script: 0x22, flags: 0x0}, + 1120: {region: 0xdc, script: 0x22, flags: 0x0}, + 1121: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1122: {region: 0x166, script: 0x5b, flags: 0x0}, + 1123: {region: 0x113, script: 0x5b, flags: 0x0}, + 1124: {region: 0x132, script: 0x5b, flags: 0x0}, + 1125: {region: 0x127, script: 0x5b, flags: 0x0}, + 1126: {region: 0x166, script: 0x5b, flags: 0x0}, 1127: {region: 0x3c, script: 0x3, flags: 0x1}, - 1128: {region: 0x165, script: 0x5a, flags: 0x0}, - 1129: {region: 0x165, script: 0x5a, flags: 0x0}, - 1130: {region: 0x165, script: 0x5a, flags: 0x0}, - 1131: {region: 0x123, script: 0xeb, flags: 0x0}, - 1132: {region: 0xdb, script: 0x22, flags: 0x0}, - 1133: {region: 0xdb, script: 0x22, flags: 0x0}, - 1134: {region: 0xdb, script: 0x22, flags: 0x0}, - 1135: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1136: {region: 0x165, script: 0x5a, flags: 0x0}, - 1137: {region: 0x6d, script: 0x2c, flags: 0x0}, - 1138: {region: 0x165, script: 0x5a, flags: 0x0}, - 1139: {region: 0x165, script: 0x5a, flags: 0x0}, - 1140: {region: 0x165, script: 0x5a, flags: 0x0}, - 1141: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1142: {region: 0x127, script: 0x5a, flags: 0x0}, - 1143: {region: 0x125, script: 0x5a, flags: 0x0}, - 1144: {region: 0x32, script: 0x5a, flags: 0x0}, - 1145: {region: 0xdb, script: 0x22, flags: 0x0}, - 1146: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1147: {region: 0x165, script: 0x5a, flags: 0x0}, - 1148: {region: 0x165, script: 0x5a, flags: 0x0}, - 1149: {region: 0x32, script: 0x5a, flags: 0x0}, - 1150: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1151: {region: 0x165, script: 0x5a, flags: 0x0}, - 1152: {region: 0x161, script: 0x5a, flags: 0x0}, - 1153: {region: 0x165, script: 0x5a, flags: 0x0}, - 1154: {region: 0x129, script: 0x5a, flags: 0x0}, - 1155: {region: 0x165, script: 0x5a, flags: 0x0}, - 1156: {region: 0xce, script: 0x5a, flags: 0x0}, - 1157: {region: 0x165, script: 0x5a, flags: 0x0}, - 1158: {region: 0xe6, script: 0x5a, flags: 0x0}, - 1159: {region: 0x165, script: 0x5a, flags: 0x0}, - 1160: {region: 0x165, script: 0x5a, flags: 0x0}, - 1161: {region: 0x165, script: 0x5a, flags: 0x0}, - 1162: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1163: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1164: {region: 0x12e, script: 0x5a, flags: 0x0}, - 1165: {region: 0x165, script: 0x5, flags: 0x0}, - 1166: {region: 0x161, script: 0x5a, flags: 0x0}, - 1167: {region: 0x87, script: 0x34, flags: 0x0}, - 1168: {region: 0xdb, script: 0x22, flags: 0x0}, - 1169: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1170: {region: 0x43, script: 0xec, flags: 0x0}, - 1171: {region: 0x165, script: 0x5a, flags: 0x0}, - 1172: {region: 0x106, script: 0x20, flags: 0x0}, - 1173: {region: 0x165, script: 0x5a, flags: 0x0}, - 1174: {region: 0x165, script: 0x5a, flags: 0x0}, - 1175: {region: 0x131, script: 0x5a, flags: 0x0}, - 1176: {region: 0x165, script: 0x5a, flags: 0x0}, - 1177: {region: 0x123, script: 0xeb, flags: 0x0}, - 1178: {region: 0x32, script: 0x5a, flags: 0x0}, - 1179: {region: 0x165, script: 0x5a, flags: 0x0}, - 1180: {region: 0x165, script: 0x5a, flags: 0x0}, - 1181: {region: 0xce, script: 0x5a, flags: 0x0}, - 1182: {region: 0x165, script: 0x5a, flags: 0x0}, - 1183: {region: 0x165, script: 0x5a, flags: 0x0}, - 1184: {region: 0x12d, script: 0x5a, flags: 0x0}, - 1185: {region: 0x165, script: 0x5a, flags: 0x0}, - 1187: {region: 0x165, script: 0x5a, flags: 0x0}, - 1188: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1189: {region: 0x53, script: 0xe4, flags: 0x0}, - 1190: {region: 0xe5, script: 0x5a, flags: 0x0}, - 1191: {region: 0x165, script: 0x5a, flags: 0x0}, - 1192: {region: 0x106, script: 0x20, flags: 0x0}, - 1193: {region: 0xba, script: 0x5a, flags: 0x0}, - 1194: {region: 0x165, script: 0x5a, flags: 0x0}, - 1195: {region: 0x106, script: 0x20, flags: 0x0}, + 1128: {region: 0x166, script: 0x5b, flags: 0x0}, + 1129: {region: 0x166, script: 0x5b, flags: 0x0}, + 1130: {region: 0x166, script: 0x5b, flags: 0x0}, + 1131: {region: 0x124, script: 0xee, flags: 0x0}, + 1132: {region: 0xdc, script: 0x22, flags: 0x0}, + 1133: {region: 0xdc, script: 0x22, flags: 0x0}, + 1134: {region: 0xdc, script: 0x22, flags: 0x0}, + 1135: {region: 0x70, script: 0x2c, flags: 0x0}, + 1136: {region: 0x166, script: 0x5b, flags: 0x0}, + 1137: {region: 0x6e, script: 0x2c, flags: 0x0}, + 1138: {region: 0x166, script: 0x5b, flags: 0x0}, + 1139: {region: 0x166, script: 0x5b, flags: 0x0}, + 1140: {region: 0x166, script: 0x5b, flags: 0x0}, + 1141: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1142: {region: 0x128, script: 0x5b, flags: 0x0}, + 1143: {region: 0x126, script: 0x5b, flags: 0x0}, + 1144: {region: 0x32, script: 0x5b, flags: 0x0}, + 1145: {region: 0xdc, script: 0x22, flags: 0x0}, + 1146: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1147: {region: 0x166, script: 0x5b, flags: 0x0}, + 1148: {region: 0x166, script: 0x5b, flags: 0x0}, + 1149: {region: 0x32, script: 0x5b, flags: 0x0}, + 1150: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1151: {region: 0x166, script: 0x5b, flags: 0x0}, + 1152: {region: 0x162, script: 0x5b, flags: 0x0}, + 1153: {region: 0x166, script: 0x5b, flags: 0x0}, + 1154: {region: 0x12a, script: 0x5b, flags: 0x0}, + 1155: {region: 0x166, script: 0x5b, flags: 0x0}, + 1156: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1157: {region: 0x166, script: 0x5b, flags: 0x0}, + 1158: {region: 0xe7, script: 0x5b, flags: 0x0}, + 1159: {region: 0x166, script: 0x5b, flags: 0x0}, + 1160: {region: 0x166, script: 0x5b, flags: 0x0}, + 1161: {region: 0x166, script: 0x5b, flags: 0x0}, + 1162: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1163: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1164: {region: 0x12f, script: 0x5b, flags: 0x0}, + 1165: {region: 0x166, script: 0x5, flags: 0x0}, + 1166: {region: 0x162, script: 0x5b, flags: 0x0}, + 1167: {region: 0x88, script: 0x34, flags: 0x0}, + 1168: {region: 0xdc, script: 0x22, flags: 0x0}, + 1169: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1170: {region: 0x43, script: 0xef, flags: 0x0}, + 1171: {region: 0x166, script: 0x5b, flags: 0x0}, + 1172: {region: 0x107, script: 0x20, flags: 0x0}, + 1173: {region: 0x166, script: 0x5b, flags: 0x0}, + 1174: {region: 0x166, script: 0x5b, flags: 0x0}, + 1175: {region: 0x132, script: 0x5b, flags: 0x0}, + 1176: {region: 0x166, script: 0x5b, flags: 0x0}, + 1177: {region: 0x124, script: 0xee, flags: 0x0}, + 1178: {region: 0x32, script: 0x5b, flags: 0x0}, + 1179: {region: 0x166, script: 0x5b, flags: 0x0}, + 1180: {region: 0x166, script: 0x5b, flags: 0x0}, + 1181: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1182: {region: 0x166, script: 0x5b, flags: 0x0}, + 1183: {region: 0x166, script: 0x5b, flags: 0x0}, + 1184: {region: 0x12e, script: 0x5b, flags: 0x0}, + 1185: {region: 0x166, script: 0x5b, flags: 0x0}, + 1187: {region: 0x166, script: 0x5b, flags: 0x0}, + 1188: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1189: {region: 0x53, script: 0xe7, flags: 0x0}, + 1190: {region: 0xe6, script: 0x5b, flags: 0x0}, + 1191: {region: 0x166, script: 0x5b, flags: 0x0}, + 1192: {region: 0x107, script: 0x20, flags: 0x0}, + 1193: {region: 0xbb, script: 0x5b, flags: 0x0}, + 1194: {region: 0x166, script: 0x5b, flags: 0x0}, + 1195: {region: 0x107, script: 0x20, flags: 0x0}, 1196: {region: 0x3f, script: 0x4, flags: 0x1}, - 1197: {region: 0x11c, script: 0xf0, flags: 0x0}, - 1198: {region: 0x130, script: 0x20, flags: 0x0}, - 1199: {region: 0x75, script: 0x5a, flags: 0x0}, - 1200: {region: 0x2a, script: 0x5a, flags: 0x0}, + 1197: {region: 0x11d, script: 0xf3, flags: 0x0}, + 1198: {region: 0x131, script: 0x20, flags: 0x0}, + 1199: {region: 0x76, script: 0x5b, flags: 0x0}, + 1200: {region: 0x2a, script: 0x5b, flags: 0x0}, 1202: {region: 0x43, script: 0x3, flags: 0x1}, - 1203: {region: 0x99, script: 0xe, flags: 0x0}, - 1204: {region: 0xe8, script: 0x5, flags: 0x0}, - 1205: {region: 0x165, script: 0x5a, flags: 0x0}, - 1206: {region: 0x165, script: 0x5a, flags: 0x0}, - 1207: {region: 0x165, script: 0x5a, flags: 0x0}, - 1208: {region: 0x165, script: 0x5a, flags: 0x0}, - 1209: {region: 0x165, script: 0x5a, flags: 0x0}, - 1210: {region: 0x165, script: 0x5a, flags: 0x0}, - 1211: {region: 0x165, script: 0x5a, flags: 0x0}, + 1203: {region: 0x9a, script: 0xe, flags: 0x0}, + 1204: {region: 0xe9, script: 0x5, flags: 0x0}, + 1205: {region: 0x166, script: 0x5b, flags: 0x0}, + 1206: {region: 0x166, script: 0x5b, flags: 0x0}, + 1207: {region: 0x166, script: 0x5b, flags: 0x0}, + 1208: {region: 0x166, script: 0x5b, flags: 0x0}, + 1209: {region: 0x166, script: 0x5b, flags: 0x0}, + 1210: {region: 0x166, script: 0x5b, flags: 0x0}, + 1211: {region: 0x166, script: 0x5b, flags: 0x0}, 1212: {region: 0x46, script: 0x4, flags: 0x1}, - 1213: {region: 0x165, script: 0x5a, flags: 0x0}, - 1214: {region: 0xb4, script: 0xf1, flags: 0x0}, - 1215: {region: 0x165, script: 0x5a, flags: 0x0}, - 1216: {region: 0x161, script: 0x5a, flags: 0x0}, - 1217: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1218: {region: 0x106, script: 0x5a, flags: 0x0}, - 1219: {region: 0x13e, script: 0x5a, flags: 0x0}, - 1220: {region: 0x11b, script: 0x5a, flags: 0x0}, - 1221: {region: 0x165, script: 0x5a, flags: 0x0}, - 1222: {region: 0x36, script: 0x5a, flags: 0x0}, - 1223: {region: 0x60, script: 0x5a, flags: 0x0}, - 1224: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1225: {region: 0x1, script: 0x5a, flags: 0x0}, - 1226: {region: 0x106, script: 0x5a, flags: 0x0}, - 1227: {region: 0x6a, script: 0x5a, flags: 0x0}, - 1228: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1229: {region: 0x165, script: 0x5a, flags: 0x0}, - 1230: {region: 0x36, script: 0x5a, flags: 0x0}, - 1231: {region: 0x4e, script: 0x5a, flags: 0x0}, - 1232: {region: 0x165, script: 0x5a, flags: 0x0}, - 1233: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1234: {region: 0x165, script: 0x5a, flags: 0x0}, - 1235: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1236: {region: 0x2f, script: 0x5a, flags: 0x0}, - 1237: {region: 0x99, script: 0xe6, flags: 0x0}, - 1238: {region: 0x99, script: 0x22, flags: 0x0}, - 1239: {region: 0x165, script: 0x5a, flags: 0x0}, - 1240: {region: 0x165, script: 0x5a, flags: 0x0}, - 1241: {region: 0x165, script: 0x5a, flags: 0x0}, - 1242: {region: 0x165, script: 0x5a, flags: 0x0}, - 1243: {region: 0x165, script: 0x5a, flags: 0x0}, - 1244: {region: 0x165, script: 0x5a, flags: 0x0}, - 1245: {region: 0x165, script: 0x5a, flags: 0x0}, - 1246: {region: 0x165, script: 0x5a, flags: 0x0}, - 1247: {region: 0x165, script: 0x5a, flags: 0x0}, - 1248: {region: 0x140, script: 0x5a, flags: 0x0}, - 1249: {region: 0x165, script: 0x5a, flags: 0x0}, - 1250: {region: 0x165, script: 0x5a, flags: 0x0}, - 1251: {region: 0xa8, script: 0x5, flags: 0x0}, - 1252: {region: 0x165, script: 0x5a, flags: 0x0}, - 1253: {region: 0x114, script: 0x5a, flags: 0x0}, - 1254: {region: 0x165, script: 0x5a, flags: 0x0}, - 1255: {region: 0x165, script: 0x5a, flags: 0x0}, - 1256: {region: 0x165, script: 0x5a, flags: 0x0}, - 1257: {region: 0x165, script: 0x5a, flags: 0x0}, - 1258: {region: 0x99, script: 0x22, flags: 0x0}, + 1213: {region: 0x166, script: 0x5b, flags: 0x0}, + 1214: {region: 0xb5, script: 0xf4, flags: 0x0}, + 1215: {region: 0x166, script: 0x5b, flags: 0x0}, + 1216: {region: 0x162, script: 0x5b, flags: 0x0}, + 1217: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1218: {region: 0x107, script: 0x5b, flags: 0x0}, + 1219: {region: 0x13f, script: 0x5b, flags: 0x0}, + 1220: {region: 0x11c, script: 0x5b, flags: 0x0}, + 1221: {region: 0x166, script: 0x5b, flags: 0x0}, + 1222: {region: 0x36, script: 0x5b, flags: 0x0}, + 1223: {region: 0x61, script: 0x5b, flags: 0x0}, + 1224: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1225: {region: 0x1, script: 0x5b, flags: 0x0}, + 1226: {region: 0x107, script: 0x5b, flags: 0x0}, + 1227: {region: 0x6b, script: 0x5b, flags: 0x0}, + 1228: {region: 0x130, script: 0x5b, flags: 0x0}, + 1229: {region: 0x166, script: 0x5b, flags: 0x0}, + 1230: {region: 0x36, script: 0x5b, flags: 0x0}, + 1231: {region: 0x4e, script: 0x5b, flags: 0x0}, + 1232: {region: 0x166, script: 0x5b, flags: 0x0}, + 1233: {region: 0x70, script: 0x2c, flags: 0x0}, + 1234: {region: 0x166, script: 0x5b, flags: 0x0}, + 1235: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1236: {region: 0x2f, script: 0x5b, flags: 0x0}, + 1237: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1238: {region: 0x9a, script: 0x22, flags: 0x0}, + 1239: {region: 0x166, script: 0x5b, flags: 0x0}, + 1240: {region: 0x166, script: 0x5b, flags: 0x0}, + 1241: {region: 0x166, script: 0x5b, flags: 0x0}, + 1242: {region: 0x166, script: 0x5b, flags: 0x0}, + 1243: {region: 0x166, script: 0x5b, flags: 0x0}, + 1244: {region: 0x166, script: 0x5b, flags: 0x0}, + 1245: {region: 0x166, script: 0x5b, flags: 0x0}, + 1246: {region: 0x166, script: 0x5b, flags: 0x0}, + 1247: {region: 0x166, script: 0x5b, flags: 0x0}, + 1248: {region: 0x141, script: 0x5b, flags: 0x0}, + 1249: {region: 0x166, script: 0x5b, flags: 0x0}, + 1250: {region: 0x166, script: 0x5b, flags: 0x0}, + 1251: {region: 0xa9, script: 0x5, flags: 0x0}, + 1252: {region: 0x166, script: 0x5b, flags: 0x0}, + 1253: {region: 0x115, script: 0x5b, flags: 0x0}, + 1254: {region: 0x166, script: 0x5b, flags: 0x0}, + 1255: {region: 0x166, script: 0x5b, flags: 0x0}, + 1256: {region: 0x166, script: 0x5b, flags: 0x0}, + 1257: {region: 0x166, script: 0x5b, flags: 0x0}, + 1258: {region: 0x9a, script: 0x22, flags: 0x0}, 1259: {region: 0x53, script: 0x3b, flags: 0x0}, - 1260: {region: 0x165, script: 0x5a, flags: 0x0}, - 1261: {region: 0x165, script: 0x5a, flags: 0x0}, - 1262: {region: 0x41, script: 0x5a, flags: 0x0}, - 1263: {region: 0x165, script: 0x5a, flags: 0x0}, - 1264: {region: 0x12b, script: 0x18, flags: 0x0}, - 1265: {region: 0x165, script: 0x5a, flags: 0x0}, - 1266: {region: 0x161, script: 0x5a, flags: 0x0}, - 1267: {region: 0x165, script: 0x5a, flags: 0x0}, - 1268: {region: 0x12b, script: 0x62, flags: 0x0}, - 1269: {region: 0x12b, script: 0x63, flags: 0x0}, - 1270: {region: 0x7d, script: 0x2e, flags: 0x0}, - 1271: {region: 0x53, script: 0x67, flags: 0x0}, - 1272: {region: 0x10b, script: 0x6c, flags: 0x0}, - 1273: {region: 0x108, script: 0x77, flags: 0x0}, - 1274: {region: 0x99, script: 0x22, flags: 0x0}, - 1275: {region: 0x131, script: 0x5a, flags: 0x0}, - 1276: {region: 0x165, script: 0x5a, flags: 0x0}, - 1277: {region: 0x9c, script: 0x91, flags: 0x0}, - 1278: {region: 0x165, script: 0x5a, flags: 0x0}, - 1279: {region: 0x15e, script: 0xcc, flags: 0x0}, - 1280: {region: 0x165, script: 0x5a, flags: 0x0}, - 1281: {region: 0x165, script: 0x5a, flags: 0x0}, - 1282: {region: 0xdb, script: 0x22, flags: 0x0}, - 1283: {region: 0x165, script: 0x5a, flags: 0x0}, - 1284: {region: 0x165, script: 0x5a, flags: 0x0}, - 1285: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1286: {region: 0x75, script: 0x5a, flags: 0x0}, - 1287: {region: 0x165, script: 0x5a, flags: 0x0}, - 1288: {region: 0x165, script: 0x5a, flags: 0x0}, - 1289: {region: 0x52, script: 0x5a, flags: 0x0}, - 1290: {region: 0x165, script: 0x5a, flags: 0x0}, - 1291: {region: 0x165, script: 0x5a, flags: 0x0}, - 1292: {region: 0x165, script: 0x5a, flags: 0x0}, - 1293: {region: 0x52, script: 0x5a, flags: 0x0}, - 1294: {region: 0x165, script: 0x5a, flags: 0x0}, - 1295: {region: 0x165, script: 0x5a, flags: 0x0}, - 1296: {region: 0x165, script: 0x5a, flags: 0x0}, - 1297: {region: 0x165, script: 0x5a, flags: 0x0}, + 1260: {region: 0x166, script: 0x5b, flags: 0x0}, + 1261: {region: 0x166, script: 0x5b, flags: 0x0}, + 1262: {region: 0x41, script: 0x5b, flags: 0x0}, + 1263: {region: 0x166, script: 0x5b, flags: 0x0}, + 1264: {region: 0x12c, script: 0x18, flags: 0x0}, + 1265: {region: 0x166, script: 0x5b, flags: 0x0}, + 1266: {region: 0x162, script: 0x5b, flags: 0x0}, + 1267: {region: 0x166, script: 0x5b, flags: 0x0}, + 1268: {region: 0x12c, script: 0x63, flags: 0x0}, + 1269: {region: 0x12c, script: 0x64, flags: 0x0}, + 1270: {region: 0x7e, script: 0x2e, flags: 0x0}, + 1271: {region: 0x53, script: 0x68, flags: 0x0}, + 1272: {region: 0x10c, script: 0x6d, flags: 0x0}, + 1273: {region: 0x109, script: 0x79, flags: 0x0}, + 1274: {region: 0x9a, script: 0x22, flags: 0x0}, + 1275: {region: 0x132, script: 0x5b, flags: 0x0}, + 1276: {region: 0x166, script: 0x5b, flags: 0x0}, + 1277: {region: 0x9d, script: 0x93, flags: 0x0}, + 1278: {region: 0x166, script: 0x5b, flags: 0x0}, + 1279: {region: 0x15f, script: 0xce, flags: 0x0}, + 1280: {region: 0x166, script: 0x5b, flags: 0x0}, + 1281: {region: 0x166, script: 0x5b, flags: 0x0}, + 1282: {region: 0xdc, script: 0x22, flags: 0x0}, + 1283: {region: 0x166, script: 0x5b, flags: 0x0}, + 1284: {region: 0x166, script: 0x5b, flags: 0x0}, + 1285: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1286: {region: 0x76, script: 0x5b, flags: 0x0}, + 1287: {region: 0x166, script: 0x5b, flags: 0x0}, + 1288: {region: 0x166, script: 0x5b, flags: 0x0}, + 1289: {region: 0x52, script: 0x5b, flags: 0x0}, + 1290: {region: 0x166, script: 0x5b, flags: 0x0}, + 1291: {region: 0x166, script: 0x5b, flags: 0x0}, + 1292: {region: 0x166, script: 0x5b, flags: 0x0}, + 1293: {region: 0x52, script: 0x5b, flags: 0x0}, + 1294: {region: 0x166, script: 0x5b, flags: 0x0}, + 1295: {region: 0x166, script: 0x5b, flags: 0x0}, + 1296: {region: 0x166, script: 0x5b, flags: 0x0}, + 1297: {region: 0x166, script: 0x5b, flags: 0x0}, 1298: {region: 0x1, script: 0x3e, flags: 0x0}, - 1299: {region: 0x165, script: 0x5a, flags: 0x0}, - 1300: {region: 0x165, script: 0x5a, flags: 0x0}, - 1301: {region: 0x165, script: 0x5a, flags: 0x0}, - 1302: {region: 0x165, script: 0x5a, flags: 0x0}, - 1303: {region: 0x165, script: 0x5a, flags: 0x0}, - 1304: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1305: {region: 0x165, script: 0x5a, flags: 0x0}, - 1306: {region: 0x165, script: 0x5a, flags: 0x0}, - 1307: {region: 0x165, script: 0x5a, flags: 0x0}, - 1308: {region: 0x41, script: 0x5a, flags: 0x0}, - 1309: {region: 0x165, script: 0x5a, flags: 0x0}, - 1310: {region: 0xcf, script: 0x5a, flags: 0x0}, + 1299: {region: 0x166, script: 0x5b, flags: 0x0}, + 1300: {region: 0x166, script: 0x5b, flags: 0x0}, + 1301: {region: 0x166, script: 0x5b, flags: 0x0}, + 1302: {region: 0x166, script: 0x5b, flags: 0x0}, + 1303: {region: 0x166, script: 0x5b, flags: 0x0}, + 1304: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1305: {region: 0x166, script: 0x5b, flags: 0x0}, + 1306: {region: 0x166, script: 0x5b, flags: 0x0}, + 1307: {region: 0x166, script: 0x5b, flags: 0x0}, + 1308: {region: 0x41, script: 0x5b, flags: 0x0}, + 1309: {region: 0x166, script: 0x5b, flags: 0x0}, + 1310: {region: 0xd0, script: 0x5b, flags: 0x0}, 1311: {region: 0x4a, script: 0x3, flags: 0x1}, - 1312: {region: 0x165, script: 0x5a, flags: 0x0}, - 1313: {region: 0x165, script: 0x5a, flags: 0x0}, - 1314: {region: 0x165, script: 0x5a, flags: 0x0}, - 1315: {region: 0x53, script: 0x5a, flags: 0x0}, - 1316: {region: 0x10b, script: 0x5a, flags: 0x0}, - 1318: {region: 0xa8, script: 0x5, flags: 0x0}, - 1319: {region: 0xd9, script: 0x5a, flags: 0x0}, - 1320: {region: 0xba, script: 0xe8, flags: 0x0}, + 1312: {region: 0x166, script: 0x5b, flags: 0x0}, + 1313: {region: 0x166, script: 0x5b, flags: 0x0}, + 1314: {region: 0x166, script: 0x5b, flags: 0x0}, + 1315: {region: 0x53, script: 0x5b, flags: 0x0}, + 1316: {region: 0x10c, script: 0x5b, flags: 0x0}, + 1318: {region: 0xa9, script: 0x5, flags: 0x0}, + 1319: {region: 0xda, script: 0x5b, flags: 0x0}, + 1320: {region: 0xbb, script: 0xeb, flags: 0x0}, 1321: {region: 0x4d, script: 0x14, flags: 0x1}, - 1322: {region: 0x53, script: 0x7d, flags: 0x0}, - 1323: {region: 0x165, script: 0x5a, flags: 0x0}, - 1324: {region: 0x122, script: 0x5a, flags: 0x0}, - 1325: {region: 0xd0, script: 0x5a, flags: 0x0}, - 1326: {region: 0x165, script: 0x5a, flags: 0x0}, - 1327: {region: 0x161, script: 0x5a, flags: 0x0}, - 1329: {region: 0x12b, script: 0x5a, flags: 0x0}, + 1322: {region: 0x53, script: 0x7f, flags: 0x0}, + 1323: {region: 0x166, script: 0x5b, flags: 0x0}, + 1324: {region: 0x123, script: 0x5b, flags: 0x0}, + 1325: {region: 0xd1, script: 0x5b, flags: 0x0}, + 1326: {region: 0x166, script: 0x5b, flags: 0x0}, + 1327: {region: 0x162, script: 0x5b, flags: 0x0}, + 1329: {region: 0x12c, script: 0x5b, flags: 0x0}, } // likelyLangList holds lists info associated with likelyLang. // Size: 582 bytes, 97 elements var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9c, script: 0x7, flags: 0x0}, - 1: {region: 0xa1, script: 0x78, flags: 0x2}, - 2: {region: 0x11c, script: 0x85, flags: 0x2}, - 3: {region: 0x32, script: 0x5a, flags: 0x0}, - 4: {region: 0x9b, script: 0x5, flags: 0x4}, - 5: {region: 0x9c, script: 0x5, flags: 0x4}, - 6: {region: 0x106, script: 0x20, flags: 0x4}, - 7: {region: 0x9c, script: 0x5, flags: 0x2}, - 8: {region: 0x106, script: 0x20, flags: 0x0}, + 0: {region: 0x9d, script: 0x7, flags: 0x0}, + 1: {region: 0xa2, script: 0x7a, flags: 0x2}, + 2: {region: 0x11d, script: 0x87, flags: 0x2}, + 3: {region: 0x32, script: 0x5b, flags: 0x0}, + 4: {region: 0x9c, script: 0x5, flags: 0x4}, + 5: {region: 0x9d, script: 0x5, flags: 0x4}, + 6: {region: 0x107, script: 0x20, flags: 0x4}, + 7: {region: 0x9d, script: 0x5, flags: 0x2}, + 8: {region: 0x107, script: 0x20, flags: 0x0}, 9: {region: 0x38, script: 0x2f, flags: 0x2}, - 10: {region: 0x135, script: 0x5a, flags: 0x0}, - 11: {region: 0x7b, script: 0xcf, flags: 0x2}, - 12: {region: 0x114, script: 0x5a, flags: 0x0}, - 13: {region: 0x84, script: 0x1, flags: 0x2}, - 14: {region: 0x5d, script: 0x1f, flags: 0x0}, - 15: {region: 0x87, script: 0x5f, flags: 0x2}, - 16: {region: 0xd6, script: 0x5a, flags: 0x0}, + 10: {region: 0x136, script: 0x5b, flags: 0x0}, + 11: {region: 0x7c, script: 0xd1, flags: 0x2}, + 12: {region: 0x115, script: 0x5b, flags: 0x0}, + 13: {region: 0x85, script: 0x1, flags: 0x2}, + 14: {region: 0x5e, script: 0x1f, flags: 0x0}, + 15: {region: 0x88, script: 0x60, flags: 0x2}, + 16: {region: 0xd7, script: 0x5b, flags: 0x0}, 17: {region: 0x52, script: 0x5, flags: 0x4}, - 18: {region: 0x10b, script: 0x5, flags: 0x4}, - 19: {region: 0xae, script: 0x20, flags: 0x0}, + 18: {region: 0x10c, script: 0x5, flags: 0x4}, + 19: {region: 0xaf, script: 0x20, flags: 0x0}, 20: {region: 0x24, script: 0x5, flags: 0x4}, 21: {region: 0x53, script: 0x5, flags: 0x4}, - 22: {region: 0x9c, script: 0x5, flags: 0x4}, - 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 22: {region: 0x9d, script: 0x5, flags: 0x4}, + 23: {region: 0xc6, script: 0x5, flags: 0x4}, 24: {region: 0x53, script: 0x5, flags: 0x2}, - 25: {region: 0x12b, script: 0x5a, flags: 0x0}, - 26: {region: 0xb0, script: 0x5, flags: 0x4}, - 27: {region: 0x9b, script: 0x5, flags: 0x2}, - 28: {region: 0xa5, script: 0x20, flags: 0x0}, + 25: {region: 0x12c, script: 0x5b, flags: 0x0}, + 26: {region: 0xb1, script: 0x5, flags: 0x4}, + 27: {region: 0x9c, script: 0x5, flags: 0x2}, + 28: {region: 0xa6, script: 0x20, flags: 0x0}, 29: {region: 0x53, script: 0x5, flags: 0x4}, - 30: {region: 0x12b, script: 0x5a, flags: 0x4}, + 30: {region: 0x12c, script: 0x5b, flags: 0x4}, 31: {region: 0x53, script: 0x5, flags: 0x2}, - 32: {region: 0x12b, script: 0x5a, flags: 0x2}, - 33: {region: 0xdb, script: 0x22, flags: 0x0}, - 34: {region: 0x99, script: 0x5d, flags: 0x2}, - 35: {region: 0x83, script: 0x5a, flags: 0x0}, - 36: {region: 0x84, script: 0x7c, flags: 0x4}, - 37: {region: 0x84, script: 0x7c, flags: 0x2}, - 38: {region: 0xc5, script: 0x20, flags: 0x0}, - 39: {region: 0x53, script: 0x70, flags: 0x4}, - 40: {region: 0x53, script: 0x70, flags: 0x2}, - 41: {region: 0xd0, script: 0x5a, flags: 0x0}, + 32: {region: 0x12c, script: 0x5b, flags: 0x2}, + 33: {region: 0xdc, script: 0x22, flags: 0x0}, + 34: {region: 0x9a, script: 0x5e, flags: 0x2}, + 35: {region: 0x84, script: 0x5b, flags: 0x0}, + 36: {region: 0x85, script: 0x7e, flags: 0x4}, + 37: {region: 0x85, script: 0x7e, flags: 0x2}, + 38: {region: 0xc6, script: 0x20, flags: 0x0}, + 39: {region: 0x53, script: 0x71, flags: 0x4}, + 40: {region: 0x53, script: 0x71, flags: 0x2}, + 41: {region: 0xd1, script: 0x5b, flags: 0x0}, 42: {region: 0x4a, script: 0x5, flags: 0x4}, - 43: {region: 0x95, script: 0x5, flags: 0x4}, - 44: {region: 0x99, script: 0x36, flags: 0x0}, - 45: {region: 0xe8, script: 0x5, flags: 0x4}, - 46: {region: 0xe8, script: 0x5, flags: 0x2}, - 47: {region: 0x9c, script: 0x8b, flags: 0x0}, - 48: {region: 0x53, script: 0x8c, flags: 0x2}, - 49: {region: 0xba, script: 0xe8, flags: 0x0}, - 50: {region: 0xd9, script: 0x5a, flags: 0x4}, - 51: {region: 0xe8, script: 0x5, flags: 0x0}, - 52: {region: 0x99, script: 0x22, flags: 0x2}, - 53: {region: 0x99, script: 0x4f, flags: 0x2}, - 54: {region: 0x99, script: 0xd3, flags: 0x2}, - 55: {region: 0x105, script: 0x20, flags: 0x0}, - 56: {region: 0xbd, script: 0x5a, flags: 0x4}, - 57: {region: 0x104, script: 0x5a, flags: 0x4}, - 58: {region: 0x106, script: 0x5a, flags: 0x4}, - 59: {region: 0x12b, script: 0x5a, flags: 0x4}, - 60: {region: 0x124, script: 0x20, flags: 0x0}, - 61: {region: 0xe8, script: 0x5, flags: 0x4}, - 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 43: {region: 0x96, script: 0x5, flags: 0x4}, + 44: {region: 0x9a, script: 0x36, flags: 0x0}, + 45: {region: 0xe9, script: 0x5, flags: 0x4}, + 46: {region: 0xe9, script: 0x5, flags: 0x2}, + 47: {region: 0x9d, script: 0x8d, flags: 0x0}, + 48: {region: 0x53, script: 0x8e, flags: 0x2}, + 49: {region: 0xbb, script: 0xeb, flags: 0x0}, + 50: {region: 0xda, script: 0x5b, flags: 0x4}, + 51: {region: 0xe9, script: 0x5, flags: 0x0}, + 52: {region: 0x9a, script: 0x22, flags: 0x2}, + 53: {region: 0x9a, script: 0x50, flags: 0x2}, + 54: {region: 0x9a, script: 0xd5, flags: 0x2}, + 55: {region: 0x106, script: 0x20, flags: 0x0}, + 56: {region: 0xbe, script: 0x5b, flags: 0x4}, + 57: {region: 0x105, script: 0x5b, flags: 0x4}, + 58: {region: 0x107, script: 0x5b, flags: 0x4}, + 59: {region: 0x12c, script: 0x5b, flags: 0x4}, + 60: {region: 0x125, script: 0x20, flags: 0x0}, + 61: {region: 0xe9, script: 0x5, flags: 0x4}, + 62: {region: 0xe9, script: 0x5, flags: 0x2}, 63: {region: 0x53, script: 0x5, flags: 0x0}, - 64: {region: 0xae, script: 0x20, flags: 0x4}, - 65: {region: 0xc5, script: 0x20, flags: 0x4}, - 66: {region: 0xae, script: 0x20, flags: 0x2}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0xdb, script: 0x22, flags: 0x4}, - 69: {region: 0xdb, script: 0x22, flags: 0x2}, - 70: {region: 0x137, script: 0x5a, flags: 0x0}, + 64: {region: 0xaf, script: 0x20, flags: 0x4}, + 65: {region: 0xc6, script: 0x20, flags: 0x4}, + 66: {region: 0xaf, script: 0x20, flags: 0x2}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0xdc, script: 0x22, flags: 0x4}, + 69: {region: 0xdc, script: 0x22, flags: 0x2}, + 70: {region: 0x138, script: 0x5b, flags: 0x0}, 71: {region: 0x24, script: 0x5, flags: 0x4}, 72: {region: 0x53, script: 0x20, flags: 0x4}, 73: {region: 0x24, script: 0x5, flags: 0x2}, - 74: {region: 0x8d, script: 0x3c, flags: 0x0}, + 74: {region: 0x8e, script: 0x3c, flags: 0x0}, 75: {region: 0x53, script: 0x3b, flags: 0x4}, 76: {region: 0x53, script: 0x3b, flags: 0x2}, 77: {region: 0x53, script: 0x3b, flags: 0x0}, 78: {region: 0x2f, script: 0x3c, flags: 0x4}, 79: {region: 0x3e, script: 0x3c, flags: 0x4}, - 80: {region: 0x7b, script: 0x3c, flags: 0x4}, - 81: {region: 0x7e, script: 0x3c, flags: 0x4}, - 82: {region: 0x8d, script: 0x3c, flags: 0x4}, - 83: {region: 0x95, script: 0x3c, flags: 0x4}, - 84: {region: 0xc6, script: 0x3c, flags: 0x4}, - 85: {region: 0xd0, script: 0x3c, flags: 0x4}, - 86: {region: 0xe2, script: 0x3c, flags: 0x4}, - 87: {region: 0xe5, script: 0x3c, flags: 0x4}, - 88: {region: 0xe7, script: 0x3c, flags: 0x4}, - 89: {region: 0x116, script: 0x3c, flags: 0x4}, - 90: {region: 0x123, script: 0x3c, flags: 0x4}, - 91: {region: 0x12e, script: 0x3c, flags: 0x4}, - 92: {region: 0x135, script: 0x3c, flags: 0x4}, - 93: {region: 0x13e, script: 0x3c, flags: 0x4}, - 94: {region: 0x12e, script: 0x11, flags: 0x2}, - 95: {region: 0x12e, script: 0x37, flags: 0x2}, - 96: {region: 0x12e, script: 0x3c, flags: 0x2}, + 80: {region: 0x7c, script: 0x3c, flags: 0x4}, + 81: {region: 0x7f, script: 0x3c, flags: 0x4}, + 82: {region: 0x8e, script: 0x3c, flags: 0x4}, + 83: {region: 0x96, script: 0x3c, flags: 0x4}, + 84: {region: 0xc7, script: 0x3c, flags: 0x4}, + 85: {region: 0xd1, script: 0x3c, flags: 0x4}, + 86: {region: 0xe3, script: 0x3c, flags: 0x4}, + 87: {region: 0xe6, script: 0x3c, flags: 0x4}, + 88: {region: 0xe8, script: 0x3c, flags: 0x4}, + 89: {region: 0x117, script: 0x3c, flags: 0x4}, + 90: {region: 0x124, script: 0x3c, flags: 0x4}, + 91: {region: 0x12f, script: 0x3c, flags: 0x4}, + 92: {region: 0x136, script: 0x3c, flags: 0x4}, + 93: {region: 0x13f, script: 0x3c, flags: 0x4}, + 94: {region: 0x12f, script: 0x11, flags: 0x2}, + 95: {region: 0x12f, script: 0x37, flags: 0x2}, + 96: {region: 0x12f, script: 0x3c, flags: 0x2}, } type likelyLangScript struct { @@ -2987,306 +3009,306 @@ type likelyLangScript struct { // for a given regionID, lang and script are the index and size respectively // of the list in likelyRegionList. // TODO: exclude containers and user-definable regions from the list. -// Size: 2148 bytes, 358 elements -var likelyRegion = [358]likelyLangScript{ - 34: {lang: 0xd7, script: 0x5a, flags: 0x0}, +// Size: 2154 bytes, 359 elements +var likelyRegion = [359]likelyLangScript{ + 34: {lang: 0xd7, script: 0x5b, flags: 0x0}, 35: {lang: 0x3a, script: 0x5, flags: 0x0}, 36: {lang: 0x0, script: 0x2, flags: 0x1}, 39: {lang: 0x2, script: 0x2, flags: 0x1}, 40: {lang: 0x4, script: 0x2, flags: 0x1}, - 42: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 43: {lang: 0x0, script: 0x5a, flags: 0x0}, - 44: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 45: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 46: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 48: {lang: 0x367, script: 0x5a, flags: 0x0}, - 49: {lang: 0x444, script: 0x5a, flags: 0x0}, - 50: {lang: 0x58, script: 0x5a, flags: 0x0}, + 42: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 43: {lang: 0x0, script: 0x5b, flags: 0x0}, + 44: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 45: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 46: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 48: {lang: 0x367, script: 0x5b, flags: 0x0}, + 49: {lang: 0x444, script: 0x5b, flags: 0x0}, + 50: {lang: 0x58, script: 0x5b, flags: 0x0}, 51: {lang: 0x6, script: 0x2, flags: 0x1}, 53: {lang: 0xa5, script: 0xe, flags: 0x0}, - 54: {lang: 0x367, script: 0x5a, flags: 0x0}, - 55: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 54: {lang: 0x367, script: 0x5b, flags: 0x0}, + 55: {lang: 0x15e, script: 0x5b, flags: 0x0}, 56: {lang: 0x7e, script: 0x20, flags: 0x0}, 57: {lang: 0x3a, script: 0x5, flags: 0x0}, - 58: {lang: 0x3d9, script: 0x5a, flags: 0x0}, - 59: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 60: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 62: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 63: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 64: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 65: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x5b, flags: 0x0}, + 59: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 60: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 62: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 63: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 67: {lang: 0x8, script: 0x2, flags: 0x1}, - 69: {lang: 0x0, script: 0x5a, flags: 0x0}, + 69: {lang: 0x0, script: 0x5b, flags: 0x0}, 71: {lang: 0x71, script: 0x20, flags: 0x0}, 73: {lang: 0x512, script: 0x3e, flags: 0x2}, 74: {lang: 0x31f, script: 0x5, flags: 0x2}, - 75: {lang: 0x445, script: 0x5a, flags: 0x0}, - 76: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 77: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 78: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 81: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 82: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 75: {lang: 0x445, script: 0x5b, flags: 0x0}, + 76: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 77: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 78: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 81: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 82: {lang: 0x15e, script: 0x5b, flags: 0x0}, 83: {lang: 0xa, script: 0x4, flags: 0x1}, - 84: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 85: {lang: 0x0, script: 0x5a, flags: 0x0}, - 86: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 89: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 90: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 91: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 93: {lang: 0xe, script: 0x2, flags: 0x1}, - 94: {lang: 0xfa, script: 0x5a, flags: 0x0}, - 96: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 98: {lang: 0x1, script: 0x5a, flags: 0x0}, - 99: {lang: 0x101, script: 0x5a, flags: 0x0}, - 101: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 103: {lang: 0x10, script: 0x2, flags: 0x1}, - 104: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 105: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 106: {lang: 0x140, script: 0x5a, flags: 0x0}, - 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 84: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 85: {lang: 0x0, script: 0x5b, flags: 0x0}, + 87: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 90: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 91: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 92: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 94: {lang: 0xe, script: 0x2, flags: 0x1}, + 95: {lang: 0xfa, script: 0x5b, flags: 0x0}, + 97: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 99: {lang: 0x1, script: 0x5b, flags: 0x0}, + 100: {lang: 0x101, script: 0x5b, flags: 0x0}, + 102: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 104: {lang: 0x10, script: 0x2, flags: 0x1}, + 105: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 106: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 107: {lang: 0x140, script: 0x5b, flags: 0x0}, 108: {lang: 0x3a, script: 0x5, flags: 0x0}, - 109: {lang: 0x46f, script: 0x2c, flags: 0x0}, - 110: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 111: {lang: 0x12, script: 0x2, flags: 0x1}, - 113: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 114: {lang: 0x151, script: 0x5a, flags: 0x0}, - 115: {lang: 0x1c0, script: 0x22, flags: 0x2}, - 118: {lang: 0x158, script: 0x5a, flags: 0x0}, - 120: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 122: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 123: {lang: 0x14, script: 0x2, flags: 0x1}, - 125: {lang: 0x16, script: 0x3, flags: 0x1}, - 126: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 128: {lang: 0x21, script: 0x5a, flags: 0x0}, - 130: {lang: 0x245, script: 0x5a, flags: 0x0}, - 132: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 133: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 134: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 135: {lang: 0x19, script: 0x2, flags: 0x1}, - 136: {lang: 0x0, script: 0x5a, flags: 0x0}, - 137: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 139: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 141: {lang: 0x529, script: 0x3c, flags: 0x0}, - 142: {lang: 0x0, script: 0x5a, flags: 0x0}, - 143: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 144: {lang: 0x1d1, script: 0x5a, flags: 0x0}, - 145: {lang: 0x1d4, script: 0x5a, flags: 0x0}, - 146: {lang: 0x1d5, script: 0x5a, flags: 0x0}, - 148: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 149: {lang: 0x1b, script: 0x2, flags: 0x1}, - 151: {lang: 0x1bc, script: 0x3e, flags: 0x0}, - 153: {lang: 0x1d, script: 0x3, flags: 0x1}, - 155: {lang: 0x3a, script: 0x5, flags: 0x0}, - 156: {lang: 0x20, script: 0x2, flags: 0x1}, - 157: {lang: 0x1f8, script: 0x5a, flags: 0x0}, - 158: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 161: {lang: 0x3a, script: 0x5, flags: 0x0}, - 162: {lang: 0x200, script: 0x49, flags: 0x0}, - 164: {lang: 0x445, script: 0x5a, flags: 0x0}, - 165: {lang: 0x28a, script: 0x20, flags: 0x0}, - 166: {lang: 0x22, script: 0x3, flags: 0x1}, - 168: {lang: 0x25, script: 0x2, flags: 0x1}, - 170: {lang: 0x254, script: 0x53, flags: 0x0}, - 171: {lang: 0x254, script: 0x53, flags: 0x0}, - 172: {lang: 0x3a, script: 0x5, flags: 0x0}, - 174: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 175: {lang: 0x27, script: 0x2, flags: 0x1}, - 176: {lang: 0x3a, script: 0x5, flags: 0x0}, - 178: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 179: {lang: 0x40c, script: 0xd4, flags: 0x0}, - 181: {lang: 0x43b, script: 0x5a, flags: 0x0}, - 182: {lang: 0x2c0, script: 0x5a, flags: 0x0}, - 183: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 184: {lang: 0x2c7, script: 0x5a, flags: 0x0}, - 185: {lang: 0x3a, script: 0x5, flags: 0x0}, - 186: {lang: 0x29, script: 0x2, flags: 0x1}, - 187: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 188: {lang: 0x2b, script: 0x2, flags: 0x1}, - 189: {lang: 0x432, script: 0x5a, flags: 0x0}, - 190: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 191: {lang: 0x2f1, script: 0x5a, flags: 0x0}, - 194: {lang: 0x2d, script: 0x2, flags: 0x1}, - 195: {lang: 0xa0, script: 0x5a, flags: 0x0}, - 196: {lang: 0x2f, script: 0x2, flags: 0x1}, - 197: {lang: 0x31, script: 0x2, flags: 0x1}, - 198: {lang: 0x33, script: 0x2, flags: 0x1}, - 200: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 201: {lang: 0x35, script: 0x2, flags: 0x1}, - 203: {lang: 0x320, script: 0x5a, flags: 0x0}, - 204: {lang: 0x37, script: 0x3, flags: 0x1}, - 205: {lang: 0x128, script: 0xea, flags: 0x0}, - 207: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 208: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 209: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 210: {lang: 0x16, script: 0x5a, flags: 0x0}, - 211: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 212: {lang: 0x1b4, script: 0x5a, flags: 0x0}, - 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, - 216: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 217: {lang: 0x367, script: 0x5a, flags: 0x0}, - 218: {lang: 0x347, script: 0x5a, flags: 0x0}, - 219: {lang: 0x351, script: 0x22, flags: 0x0}, - 225: {lang: 0x3a, script: 0x5, flags: 0x0}, - 226: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 228: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 229: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 230: {lang: 0x486, script: 0x5a, flags: 0x0}, - 231: {lang: 0x153, script: 0x5a, flags: 0x0}, - 232: {lang: 0x3a, script: 0x3, flags: 0x1}, - 233: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 234: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 236: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 237: {lang: 0x3a, script: 0x5, flags: 0x0}, - 238: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 240: {lang: 0x3a2, script: 0x5a, flags: 0x0}, - 241: {lang: 0x194, script: 0x5a, flags: 0x0}, - 243: {lang: 0x3a, script: 0x5, flags: 0x0}, - 258: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 260: {lang: 0x3d, script: 0x2, flags: 0x1}, - 261: {lang: 0x432, script: 0x20, flags: 0x0}, - 262: {lang: 0x3f, script: 0x2, flags: 0x1}, - 263: {lang: 0x3e5, script: 0x5a, flags: 0x0}, - 264: {lang: 0x3a, script: 0x5, flags: 0x0}, - 266: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 267: {lang: 0x3a, script: 0x5, flags: 0x0}, - 268: {lang: 0x41, script: 0x2, flags: 0x1}, - 271: {lang: 0x416, script: 0x5a, flags: 0x0}, - 272: {lang: 0x347, script: 0x5a, flags: 0x0}, - 273: {lang: 0x43, script: 0x2, flags: 0x1}, - 275: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 276: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 277: {lang: 0x429, script: 0x5a, flags: 0x0}, - 278: {lang: 0x367, script: 0x5a, flags: 0x0}, - 280: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 282: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 284: {lang: 0x45, script: 0x2, flags: 0x1}, - 288: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 289: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 290: {lang: 0x47, script: 0x2, flags: 0x1}, - 291: {lang: 0x49, script: 0x3, flags: 0x1}, - 292: {lang: 0x4c, script: 0x2, flags: 0x1}, - 293: {lang: 0x477, script: 0x5a, flags: 0x0}, - 294: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 295: {lang: 0x476, script: 0x5a, flags: 0x0}, - 296: {lang: 0x4e, script: 0x2, flags: 0x1}, - 297: {lang: 0x482, script: 0x5a, flags: 0x0}, - 299: {lang: 0x50, script: 0x4, flags: 0x1}, - 301: {lang: 0x4a0, script: 0x5a, flags: 0x0}, - 302: {lang: 0x54, script: 0x2, flags: 0x1}, - 303: {lang: 0x445, script: 0x5a, flags: 0x0}, - 304: {lang: 0x56, script: 0x3, flags: 0x1}, - 305: {lang: 0x445, script: 0x5a, flags: 0x0}, - 309: {lang: 0x512, script: 0x3e, flags: 0x2}, - 310: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 311: {lang: 0x4bc, script: 0x5a, flags: 0x0}, - 312: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 315: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 318: {lang: 0x4c3, script: 0x5a, flags: 0x0}, - 319: {lang: 0x8a, script: 0x5a, flags: 0x0}, - 320: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 322: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 333: {lang: 0x59, script: 0x2, flags: 0x1}, - 350: {lang: 0x3a, script: 0x5, flags: 0x0}, - 351: {lang: 0x5b, script: 0x2, flags: 0x1}, - 356: {lang: 0x423, script: 0x5a, flags: 0x0}, + 109: {lang: 0x3a, script: 0x5, flags: 0x0}, + 110: {lang: 0x46f, script: 0x2c, flags: 0x0}, + 111: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 112: {lang: 0x12, script: 0x2, flags: 0x1}, + 114: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 115: {lang: 0x151, script: 0x5b, flags: 0x0}, + 116: {lang: 0x1c0, script: 0x22, flags: 0x2}, + 119: {lang: 0x158, script: 0x5b, flags: 0x0}, + 121: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 123: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 124: {lang: 0x14, script: 0x2, flags: 0x1}, + 126: {lang: 0x16, script: 0x3, flags: 0x1}, + 127: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 129: {lang: 0x21, script: 0x5b, flags: 0x0}, + 131: {lang: 0x245, script: 0x5b, flags: 0x0}, + 133: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 134: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 135: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 136: {lang: 0x19, script: 0x2, flags: 0x1}, + 137: {lang: 0x0, script: 0x5b, flags: 0x0}, + 138: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 140: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 142: {lang: 0x529, script: 0x3c, flags: 0x0}, + 143: {lang: 0x0, script: 0x5b, flags: 0x0}, + 144: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 145: {lang: 0x1d1, script: 0x5b, flags: 0x0}, + 146: {lang: 0x1d4, script: 0x5b, flags: 0x0}, + 147: {lang: 0x1d5, script: 0x5b, flags: 0x0}, + 149: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 150: {lang: 0x1b, script: 0x2, flags: 0x1}, + 152: {lang: 0x1bc, script: 0x3e, flags: 0x0}, + 154: {lang: 0x1d, script: 0x3, flags: 0x1}, + 156: {lang: 0x3a, script: 0x5, flags: 0x0}, + 157: {lang: 0x20, script: 0x2, flags: 0x1}, + 158: {lang: 0x1f8, script: 0x5b, flags: 0x0}, + 159: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 162: {lang: 0x3a, script: 0x5, flags: 0x0}, + 163: {lang: 0x200, script: 0x49, flags: 0x0}, + 165: {lang: 0x445, script: 0x5b, flags: 0x0}, + 166: {lang: 0x28a, script: 0x20, flags: 0x0}, + 167: {lang: 0x22, script: 0x3, flags: 0x1}, + 169: {lang: 0x25, script: 0x2, flags: 0x1}, + 171: {lang: 0x254, script: 0x54, flags: 0x0}, + 172: {lang: 0x254, script: 0x54, flags: 0x0}, + 173: {lang: 0x3a, script: 0x5, flags: 0x0}, + 175: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 176: {lang: 0x27, script: 0x2, flags: 0x1}, + 177: {lang: 0x3a, script: 0x5, flags: 0x0}, + 179: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 180: {lang: 0x40c, script: 0xd6, flags: 0x0}, + 182: {lang: 0x43b, script: 0x5b, flags: 0x0}, + 183: {lang: 0x2c0, script: 0x5b, flags: 0x0}, + 184: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 185: {lang: 0x2c7, script: 0x5b, flags: 0x0}, + 186: {lang: 0x3a, script: 0x5, flags: 0x0}, + 187: {lang: 0x29, script: 0x2, flags: 0x1}, + 188: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 189: {lang: 0x2b, script: 0x2, flags: 0x1}, + 190: {lang: 0x432, script: 0x5b, flags: 0x0}, + 191: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 192: {lang: 0x2f1, script: 0x5b, flags: 0x0}, + 195: {lang: 0x2d, script: 0x2, flags: 0x1}, + 196: {lang: 0xa0, script: 0x5b, flags: 0x0}, + 197: {lang: 0x2f, script: 0x2, flags: 0x1}, + 198: {lang: 0x31, script: 0x2, flags: 0x1}, + 199: {lang: 0x33, script: 0x2, flags: 0x1}, + 201: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 202: {lang: 0x35, script: 0x2, flags: 0x1}, + 204: {lang: 0x320, script: 0x5b, flags: 0x0}, + 205: {lang: 0x37, script: 0x3, flags: 0x1}, + 206: {lang: 0x128, script: 0xed, flags: 0x0}, + 208: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 209: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 210: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 211: {lang: 0x16, script: 0x5b, flags: 0x0}, + 212: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 213: {lang: 0x1b4, script: 0x5b, flags: 0x0}, + 215: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 217: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 218: {lang: 0x367, script: 0x5b, flags: 0x0}, + 219: {lang: 0x347, script: 0x5b, flags: 0x0}, + 220: {lang: 0x351, script: 0x22, flags: 0x0}, + 226: {lang: 0x3a, script: 0x5, flags: 0x0}, + 227: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 229: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 230: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 231: {lang: 0x486, script: 0x5b, flags: 0x0}, + 232: {lang: 0x153, script: 0x5b, flags: 0x0}, + 233: {lang: 0x3a, script: 0x3, flags: 0x1}, + 234: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 235: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 237: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 238: {lang: 0x3a, script: 0x5, flags: 0x0}, + 239: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 241: {lang: 0x3a2, script: 0x5b, flags: 0x0}, + 242: {lang: 0x194, script: 0x5b, flags: 0x0}, + 244: {lang: 0x3a, script: 0x5, flags: 0x0}, + 259: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 261: {lang: 0x3d, script: 0x2, flags: 0x1}, + 262: {lang: 0x432, script: 0x20, flags: 0x0}, + 263: {lang: 0x3f, script: 0x2, flags: 0x1}, + 264: {lang: 0x3e5, script: 0x5b, flags: 0x0}, + 265: {lang: 0x3a, script: 0x5, flags: 0x0}, + 267: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 268: {lang: 0x3a, script: 0x5, flags: 0x0}, + 269: {lang: 0x41, script: 0x2, flags: 0x1}, + 272: {lang: 0x416, script: 0x5b, flags: 0x0}, + 273: {lang: 0x347, script: 0x5b, flags: 0x0}, + 274: {lang: 0x43, script: 0x2, flags: 0x1}, + 276: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 277: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 278: {lang: 0x429, script: 0x5b, flags: 0x0}, + 279: {lang: 0x367, script: 0x5b, flags: 0x0}, + 281: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 283: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 285: {lang: 0x45, script: 0x2, flags: 0x1}, + 289: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 290: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 291: {lang: 0x47, script: 0x2, flags: 0x1}, + 292: {lang: 0x49, script: 0x3, flags: 0x1}, + 293: {lang: 0x4c, script: 0x2, flags: 0x1}, + 294: {lang: 0x477, script: 0x5b, flags: 0x0}, + 295: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 296: {lang: 0x476, script: 0x5b, flags: 0x0}, + 297: {lang: 0x4e, script: 0x2, flags: 0x1}, + 298: {lang: 0x482, script: 0x5b, flags: 0x0}, + 300: {lang: 0x50, script: 0x4, flags: 0x1}, + 302: {lang: 0x4a0, script: 0x5b, flags: 0x0}, + 303: {lang: 0x54, script: 0x2, flags: 0x1}, + 304: {lang: 0x445, script: 0x5b, flags: 0x0}, + 305: {lang: 0x56, script: 0x3, flags: 0x1}, + 306: {lang: 0x445, script: 0x5b, flags: 0x0}, + 310: {lang: 0x512, script: 0x3e, flags: 0x2}, + 311: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 312: {lang: 0x4bc, script: 0x5b, flags: 0x0}, + 313: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 316: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 319: {lang: 0x4c3, script: 0x5b, flags: 0x0}, + 320: {lang: 0x8a, script: 0x5b, flags: 0x0}, + 321: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 323: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 334: {lang: 0x59, script: 0x2, flags: 0x1}, + 351: {lang: 0x3a, script: 0x5, flags: 0x0}, + 352: {lang: 0x5b, script: 0x2, flags: 0x1}, + 357: {lang: 0x423, script: 0x5b, flags: 0x0}, } // likelyRegionList holds lists info associated with likelyRegion. // Size: 558 bytes, 93 elements var likelyRegionList = [93]likelyLangScript{ 0: {lang: 0x148, script: 0x5, flags: 0x0}, - 1: {lang: 0x476, script: 0x5a, flags: 0x0}, - 2: {lang: 0x431, script: 0x5a, flags: 0x0}, + 1: {lang: 0x476, script: 0x5b, flags: 0x0}, + 2: {lang: 0x431, script: 0x5b, flags: 0x0}, 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, - 5: {lang: 0x274, script: 0x5a, flags: 0x0}, - 6: {lang: 0xb7, script: 0x5a, flags: 0x0}, + 5: {lang: 0x274, script: 0x5b, flags: 0x0}, + 6: {lang: 0xb7, script: 0x5b, flags: 0x0}, 7: {lang: 0x432, script: 0x20, flags: 0x0}, - 8: {lang: 0x12d, script: 0xec, flags: 0x0}, + 8: {lang: 0x12d, script: 0xef, flags: 0x0}, 9: {lang: 0x351, script: 0x22, flags: 0x0}, 10: {lang: 0x529, script: 0x3b, flags: 0x0}, 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, - 12: {lang: 0x523, script: 0x5a, flags: 0x0}, - 13: {lang: 0x29a, script: 0xeb, flags: 0x0}, + 12: {lang: 0x523, script: 0x5b, flags: 0x0}, + 13: {lang: 0x29a, script: 0xee, flags: 0x0}, 14: {lang: 0x136, script: 0x34, flags: 0x0}, - 15: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 15: {lang: 0x48a, script: 0x5b, flags: 0x0}, 16: {lang: 0x3a, script: 0x5, flags: 0x0}, - 17: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 17: {lang: 0x15e, script: 0x5b, flags: 0x0}, 18: {lang: 0x27, script: 0x2c, flags: 0x0}, - 19: {lang: 0x139, script: 0x5a, flags: 0x0}, + 19: {lang: 0x139, script: 0x5b, flags: 0x0}, 20: {lang: 0x26a, script: 0x5, flags: 0x2}, 21: {lang: 0x512, script: 0x3e, flags: 0x2}, 22: {lang: 0x210, script: 0x2e, flags: 0x0}, 23: {lang: 0x5, script: 0x20, flags: 0x0}, - 24: {lang: 0x274, script: 0x5a, flags: 0x0}, + 24: {lang: 0x274, script: 0x5b, flags: 0x0}, 25: {lang: 0x136, script: 0x34, flags: 0x0}, 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 27: {lang: 0x1e1, script: 0x5a, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x5b, flags: 0x0}, 28: {lang: 0x31f, script: 0x5, flags: 0x0}, 29: {lang: 0x1be, script: 0x22, flags: 0x0}, 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 31: {lang: 0x236, script: 0x75, flags: 0x0}, + 31: {lang: 0x236, script: 0x76, flags: 0x0}, 32: {lang: 0x148, script: 0x5, flags: 0x0}, - 33: {lang: 0x476, script: 0x5a, flags: 0x0}, - 34: {lang: 0x24a, script: 0x4e, flags: 0x0}, + 33: {lang: 0x476, script: 0x5b, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4f, flags: 0x0}, 35: {lang: 0xe6, script: 0x5, flags: 0x0}, - 36: {lang: 0x226, script: 0xeb, flags: 0x0}, + 36: {lang: 0x226, script: 0xee, flags: 0x0}, 37: {lang: 0x3a, script: 0x5, flags: 0x0}, - 38: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 39: {lang: 0x2b8, script: 0x57, flags: 0x0}, - 40: {lang: 0x226, script: 0xeb, flags: 0x0}, + 38: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x58, flags: 0x0}, + 40: {lang: 0x226, script: 0xee, flags: 0x0}, 41: {lang: 0x3a, script: 0x5, flags: 0x0}, - 42: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 43: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 42: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 46: {lang: 0x431, script: 0x5a, flags: 0x0}, - 47: {lang: 0x331, script: 0x75, flags: 0x0}, - 48: {lang: 0x213, script: 0x5a, flags: 0x0}, + 46: {lang: 0x431, script: 0x5b, flags: 0x0}, + 47: {lang: 0x331, script: 0x76, flags: 0x0}, + 48: {lang: 0x213, script: 0x5b, flags: 0x0}, 49: {lang: 0x30b, script: 0x20, flags: 0x0}, 50: {lang: 0x242, script: 0x5, flags: 0x0}, 51: {lang: 0x529, script: 0x3c, flags: 0x0}, - 52: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 53: {lang: 0x3a, script: 0x5, flags: 0x0}, - 54: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 55: {lang: 0x2ed, script: 0x5a, flags: 0x0}, + 54: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x5b, flags: 0x0}, 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, 57: {lang: 0x88, script: 0x22, flags: 0x0}, 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, 60: {lang: 0xbe, script: 0x22, flags: 0x0}, - 61: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 62: {lang: 0x7e, script: 0x20, flags: 0x0}, 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 64: {lang: 0x267, script: 0x5a, flags: 0x0}, - 65: {lang: 0x444, script: 0x5a, flags: 0x0}, + 64: {lang: 0x267, script: 0x5b, flags: 0x0}, + 65: {lang: 0x444, script: 0x5b, flags: 0x0}, 66: {lang: 0x512, script: 0x3e, flags: 0x0}, - 67: {lang: 0x412, script: 0x5a, flags: 0x0}, + 67: {lang: 0x412, script: 0x5b, flags: 0x0}, 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, 69: {lang: 0x3a, script: 0x5, flags: 0x0}, - 70: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 71: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 70: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 71: {lang: 0x15e, script: 0x5b, flags: 0x0}, 72: {lang: 0x35, script: 0x5, flags: 0x0}, - 73: {lang: 0x46b, script: 0xeb, flags: 0x0}, + 73: {lang: 0x46b, script: 0xee, flags: 0x0}, 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, - 75: {lang: 0x30f, script: 0x75, flags: 0x0}, + 75: {lang: 0x30f, script: 0x76, flags: 0x0}, 76: {lang: 0x467, script: 0x20, flags: 0x0}, 77: {lang: 0x148, script: 0x5, flags: 0x0}, 78: {lang: 0x3a, script: 0x5, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 80: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 80: {lang: 0x48a, script: 0x5b, flags: 0x0}, 81: {lang: 0x58, script: 0x5, flags: 0x0}, 82: {lang: 0x219, script: 0x20, flags: 0x0}, 83: {lang: 0x81, script: 0x34, flags: 0x0}, 84: {lang: 0x529, script: 0x3c, flags: 0x0}, - 85: {lang: 0x48c, script: 0x5a, flags: 0x0}, + 85: {lang: 0x48c, script: 0x5b, flags: 0x0}, 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, 87: {lang: 0x512, script: 0x3e, flags: 0x0}, - 88: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 89: {lang: 0x431, script: 0x5a, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 89: {lang: 0x431, script: 0x5b, flags: 0x0}, 90: {lang: 0x432, script: 0x20, flags: 0x0}, - 91: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 91: {lang: 0x15e, script: 0x5b, flags: 0x0}, 92: {lang: 0x446, script: 0x5, flags: 0x0}, } @@ -3298,38 +3320,38 @@ type likelyTag struct { // Size: 198 bytes, 33 elements var likelyRegionGroup = [33]likelyTag{ - 1: {lang: 0x139, region: 0xd6, script: 0x5a}, - 2: {lang: 0x139, region: 0x135, script: 0x5a}, - 3: {lang: 0x3c0, region: 0x41, script: 0x5a}, - 4: {lang: 0x139, region: 0x2f, script: 0x5a}, - 5: {lang: 0x139, region: 0xd6, script: 0x5a}, - 6: {lang: 0x13e, region: 0xcf, script: 0x5a}, - 7: {lang: 0x445, region: 0x12f, script: 0x5a}, - 8: {lang: 0x3a, region: 0x6b, script: 0x5}, - 9: {lang: 0x445, region: 0x4b, script: 0x5a}, - 10: {lang: 0x139, region: 0x161, script: 0x5a}, - 11: {lang: 0x139, region: 0x135, script: 0x5a}, - 12: {lang: 0x139, region: 0x135, script: 0x5a}, - 13: {lang: 0x13e, region: 0x59, script: 0x5a}, + 1: {lang: 0x139, region: 0xd7, script: 0x5b}, + 2: {lang: 0x139, region: 0x136, script: 0x5b}, + 3: {lang: 0x3c0, region: 0x41, script: 0x5b}, + 4: {lang: 0x139, region: 0x2f, script: 0x5b}, + 5: {lang: 0x139, region: 0xd7, script: 0x5b}, + 6: {lang: 0x13e, region: 0xd0, script: 0x5b}, + 7: {lang: 0x445, region: 0x130, script: 0x5b}, + 8: {lang: 0x3a, region: 0x6c, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x5b}, + 10: {lang: 0x139, region: 0x162, script: 0x5b}, + 11: {lang: 0x139, region: 0x136, script: 0x5b}, + 12: {lang: 0x139, region: 0x136, script: 0x5b}, + 13: {lang: 0x13e, region: 0x5a, script: 0x5b}, 14: {lang: 0x529, region: 0x53, script: 0x3b}, - 15: {lang: 0x1be, region: 0x99, script: 0x22}, - 16: {lang: 0x1e1, region: 0x95, script: 0x5a}, - 17: {lang: 0x1f9, region: 0x9e, script: 0x5a}, - 18: {lang: 0x139, region: 0x2f, script: 0x5a}, - 19: {lang: 0x139, region: 0xe6, script: 0x5a}, - 20: {lang: 0x139, region: 0x8a, script: 0x5a}, - 21: {lang: 0x41b, region: 0x142, script: 0x5a}, + 15: {lang: 0x1be, region: 0x9a, script: 0x22}, + 16: {lang: 0x1e1, region: 0x96, script: 0x5b}, + 17: {lang: 0x1f9, region: 0x9f, script: 0x5b}, + 18: {lang: 0x139, region: 0x2f, script: 0x5b}, + 19: {lang: 0x139, region: 0xe7, script: 0x5b}, + 20: {lang: 0x139, region: 0x8b, script: 0x5b}, + 21: {lang: 0x41b, region: 0x143, script: 0x5b}, 22: {lang: 0x529, region: 0x53, script: 0x3b}, - 23: {lang: 0x4bc, region: 0x137, script: 0x5a}, - 24: {lang: 0x3a, region: 0x108, script: 0x5}, - 25: {lang: 0x3e2, region: 0x106, script: 0x20}, - 26: {lang: 0x3e2, region: 0x106, script: 0x20}, - 27: {lang: 0x139, region: 0x7b, script: 0x5a}, - 28: {lang: 0x10d, region: 0x60, script: 0x5a}, - 29: {lang: 0x139, region: 0xd6, script: 0x5a}, - 30: {lang: 0x13e, region: 0x1f, script: 0x5a}, - 31: {lang: 0x139, region: 0x9a, script: 0x5a}, - 32: {lang: 0x139, region: 0x7b, script: 0x5a}, + 23: {lang: 0x4bc, region: 0x138, script: 0x5b}, + 24: {lang: 0x3a, region: 0x109, script: 0x5}, + 25: {lang: 0x3e2, region: 0x107, script: 0x20}, + 26: {lang: 0x3e2, region: 0x107, script: 0x20}, + 27: {lang: 0x139, region: 0x7c, script: 0x5b}, + 28: {lang: 0x10d, region: 0x61, script: 0x5b}, + 29: {lang: 0x139, region: 0xd7, script: 0x5b}, + 30: {lang: 0x13e, region: 0x1f, script: 0x5b}, + 31: {lang: 0x139, region: 0x9b, script: 0x5b}, + 32: {lang: 0x139, region: 0x7c, script: 0x5b}, } // Size: 264 bytes, 33 elements @@ -3350,8 +3372,8 @@ var regionContainment = [33]uint64{ // regionInclusion maps region identifiers to sets of regions in regionInclusionBits, // where each set holds all groupings that are directly connected in a region // containment graph. -// Size: 358 bytes, 358 elements -var regionInclusion = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionInclusion = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, @@ -3364,45 +3386,45 @@ var regionInclusion = [358]uint8{ // Entry 40 - 7F 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, - 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, - 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, - 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, - 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, - 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, - 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34, + 0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, + 0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, + 0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, + 0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, + 0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, // Entry 80 - BF - 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, - 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, - 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, - 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, - 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, - 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, - 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, - 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + 0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, + 0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, + 0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, + 0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, + 0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, + 0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, + 0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, + 0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, // Entry C0 - FF - 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, - 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, - 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, - 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, - 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, - 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, - 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, + 0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, + 0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, + 0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, + 0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, + 0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, + 0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, // Entry 100 - 13F - 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, - 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, - 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, - 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, - 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, - 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, - 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, - 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + 0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, + 0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, + 0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, + 0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, + 0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, + 0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, + 0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, + 0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, // Entry 140 - 17F - 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, - 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, + 0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, } // regionInclusionBits is an array of bit vectors where every vector represents @@ -3462,11 +3484,11 @@ type parentRel struct { // Size: 414 bytes, 5 elements var parents = [5]parentRel{ - 0: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, - 1: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, - 2: {lang: 0x13e, script: 0x0, maxScript: 0x5a, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, - 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5a, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, - 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, + 0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}}, + 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}}, } -// Total table size 30244 bytes (29KiB); checksum: B6B15F30 +// Total table size 30466 bytes (29KiB); checksum: 7544152B diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go index ee45f4947..1153baf29 100644 --- a/vendor/golang.org/x/text/language/match.go +++ b/vendor/golang.org/x/text/language/match.go @@ -434,7 +434,7 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { // (their canonicalization simply substitutes a different language code, but // nothing else), the match confidence is Exact, otherwise it is High. for i, lm := range language.AliasMap { - // If deprecated codes match and there is no fiddling with the script or + // If deprecated codes match and there is no fiddling with the script // or region, we consider it an exact match. conf := Exact if language.AliasTypes[i] != language.Macro { diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go index 34a732b69..a6573dcb2 100644 --- a/vendor/golang.org/x/text/language/tables.go +++ b/vendor/golang.org/x/text/language/tables.go @@ -23,31 +23,31 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) -var regionToGroups = []uint8{ // 358 elements +var regionToGroups = []uint8{ // 359 elements // Entry 0 - 3F 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, @@ -60,51 +60,51 @@ var regionToGroups = []uint8{ // 358 elements // Entry 40 - 7F 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, - 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x08, 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, // Entry 80 - BF - 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, + 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, // Entry C0 - FF - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, - 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, + 0x01, 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, // Entry 140 - 17F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, -} // Size: 382 bytes + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 383 bytes var paradigmLocales = [][3]uint16{ // 3 elements - 0: [3]uint16{0x139, 0x0, 0x7b}, + 0: [3]uint16{0x139, 0x0, 0x7c}, 1: [3]uint16{0x13e, 0x0, 0x1f}, - 2: [3]uint16{0x3c0, 0x41, 0xee}, + 2: [3]uint16{0x3c0, 0x41, 0xef}, } // Size: 42 bytes type mutualIntelligibility struct { @@ -249,30 +249,30 @@ var matchLang = []mutualIntelligibility{ // 113 elements // matchScript holds pairs of scriptIDs where readers of one script // can typically also read the other. Each is associated with a confidence. var matchScript = []scriptIntelligibility{ // 26 elements - 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5a, haveScript: 0x20, distance: 0x5}, - 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5a, distance: 0x5}, - 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5a, distance: 0xa}, + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5b, haveScript: 0x20, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5b, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5b, distance: 0xa}, 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, - 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5a, distance: 0xa}, - 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4e, haveScript: 0x5a, distance: 0xa}, - 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x52, haveScript: 0x5a, distance: 0xa}, - 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x57, haveScript: 0x5a, distance: 0xa}, - 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6e, haveScript: 0x5a, distance: 0xa}, - 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x75, haveScript: 0x5a, distance: 0xa}, - 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5a, distance: 0xa}, - 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x81, haveScript: 0x5a, distance: 0xa}, - 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5a, distance: 0xa}, - 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd4, haveScript: 0x5a, distance: 0xa}, - 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe3, haveScript: 0x5a, distance: 0xa}, - 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5a, distance: 0xa}, - 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5a, distance: 0xa}, - 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5a, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5b, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x5b, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x53, haveScript: 0x5b, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x58, haveScript: 0x5b, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6f, haveScript: 0x5b, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x76, haveScript: 0x5b, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5b, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x83, haveScript: 0x5b, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5b, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd6, haveScript: 0x5b, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5b, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe9, haveScript: 0x5b, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5b, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5b, distance: 0xa}, 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, } // Size: 232 bytes @@ -295,4 +295,4 @@ var matchRegion = []regionIntelligibility{ // 15 elements 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, } // Size: 114 bytes -// Total table size 1472 bytes (1KiB); checksum: F86C669 +// Total table size 1473 bytes (1KiB); checksum: 7BB90B5C diff --git a/vendor/modules.txt b/vendor/modules.txt index a0fcade07..a92c67b7e 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -7,10 +7,10 @@ github.com/Masterminds/semver # github.com/blang/semver v3.5.1+incompatible ## explicit github.com/blang/semver -# github.com/cenkalti/backoff/v4 v4.2.0 +# github.com/cenkalti/backoff/v4 v4.2.1 ## explicit; go 1.18 github.com/cenkalti/backoff/v4 -# github.com/cloudfoundry/libbuildpack v0.0.0-20230404152448-8da916cb09fe +# github.com/cloudfoundry/libbuildpack v0.0.0-20231211162543-86d10e150195 ## explicit; go 1.19 github.com/cloudfoundry/libbuildpack github.com/cloudfoundry/libbuildpack/bratshelper @@ -18,22 +18,22 @@ github.com/cloudfoundry/libbuildpack/cutlass github.com/cloudfoundry/libbuildpack/cutlass/docker github.com/cloudfoundry/libbuildpack/cutlass/glow github.com/cloudfoundry/libbuildpack/packager -# github.com/elazarl/goproxy v0.0.0-20221015165544-a0805db90819 +# github.com/elazarl/goproxy v0.0.0-20231117061959-7cc037d33fb5 ## explicit github.com/elazarl/goproxy # github.com/elazarl/goproxy/ext v0.0.0-20210110162100-a92cc753f88e ## explicit -# github.com/fsnotify/fsnotify v1.6.0 -## explicit; go 1.16 +# github.com/fsnotify/fsnotify v1.7.0 +## explicit; go 1.17 github.com/fsnotify/fsnotify -# github.com/google/go-cmp v0.5.9 +# github.com/google/go-cmp v0.6.0 ## explicit; go 1.13 github.com/google/go-cmp/cmp github.com/google/go-cmp/cmp/internal/diff github.com/google/go-cmp/cmp/internal/flags github.com/google/go-cmp/cmp/internal/function github.com/google/go-cmp/cmp/internal/value -# github.com/nxadm/tail v1.4.8 +# github.com/nxadm/tail v1.4.11 ## explicit; go 1.13 github.com/nxadm/tail github.com/nxadm/tail/ratelimiter @@ -62,7 +62,7 @@ github.com/onsi/ginkgo/reporters/stenographer github.com/onsi/ginkgo/reporters/stenographer/support/go-colorable github.com/onsi/ginkgo/reporters/stenographer/support/go-isatty github.com/onsi/ginkgo/types -# github.com/onsi/gomega v1.27.6 +# github.com/onsi/gomega v1.30.0 ## explicit; go 1.18 github.com/onsi/gomega github.com/onsi/gomega/format @@ -82,7 +82,7 @@ github.com/paketo-buildpacks/packit/pexec # github.com/pkg/errors v0.9.1 ## explicit github.com/pkg/errors -# github.com/tidwall/gjson v1.14.4 +# github.com/tidwall/gjson v1.17.0 ## explicit; go 1.12 github.com/tidwall/gjson # github.com/tidwall/match v1.1.1 @@ -91,18 +91,17 @@ github.com/tidwall/match # github.com/tidwall/pretty v1.2.1 ## explicit; go 1.16 github.com/tidwall/pretty -# golang.org/x/net v0.8.0 -## explicit; go 1.17 +# golang.org/x/net v0.19.0 +## explicit; go 1.18 golang.org/x/net/html golang.org/x/net/html/atom golang.org/x/net/html/charset -# golang.org/x/sys v0.6.0 -## explicit; go 1.17 -golang.org/x/sys/internal/unsafeheader +# golang.org/x/sys v0.15.0 +## explicit; go 1.18 golang.org/x/sys/unix golang.org/x/sys/windows -# golang.org/x/text v0.8.0 -## explicit; go 1.17 +# golang.org/x/text v0.14.0 +## explicit; go 1.18 golang.org/x/text/encoding golang.org/x/text/encoding/charmap golang.org/x/text/encoding/htmlindex