09 - SeqIO.ipynb

{
 "cells": [
  {
   "cell_type": "markdown",
   "metadata": {},
   "source": [
    "## 3 SeqIO\n",
    "\n",
    "As classes `Seq` e `SeqRecord` são ótimas para guarda as informações das sequências e suas anotações, mas normalmente as informações para popular os objetos dessas classes estão em arquivos. Uma forma de popular esses objetos seria então abrir um arquivo com o método open() do python e extrair as informações que precisamos. Esse processo de extrair informações chamamos de parsing. Dependendo da formatação do arquivo pode ser bem trabalhoso extrair essas informações. Felizmente para nós o Biopython, na classe SeqIO, traz consigo parsers para diversos formatos de arquivo e retorna um Generator que pode ser iterado em um loop for para retornar um SeqRecord. Os formatos suportado são os seguintes:\n",
    "\n",
    "\n",
    "| Format name           | Read | Write       | Index | Notes                                                                                                                                                                                                                                                                                                                                                                                       |\n",
    "|-----------------------|------|-------------|-------|---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------|\n",
    "| abi                   | 1.58 | No          | N/A   | Reads the ABI “Sanger” capillary sequence traces files, including the PHRED quality scores for the base calls. This allows ABI to FASTQ conversion. Note each ABI file contains one and only one sequence (so there is no point in indexing the file).                                                                                                                                      |\n",
    "| abi-trim              | 1.71 | No          | N/A   | Same as “abi” but with quality trimming with Mott’s algorithm.                                                                                                                                                                                                                                                                                                                              |\n",
    "| ace                   | 1.47 | No          | 1.52  | Reads the contig sequences from an ACE assembly file. Uses Bio.Sequencing.Ace internally                                                                                                                                                                                                                                                                                                    |\n",
    "| cif-atom              | 1.73 | No          | No    | Uses Bio.PDB.MMCIFParser to determine the (partial) protein sequence as it appears in the structure based on the atomic coordinates.                                                                                                                                                                                                                                                        |\n",
    "| cif-seqres            | 1.73 | No          | No    | Reads a macromolecular Crystallographic Information File (mmCIF) file to determine the complete protein sequence as defined by the _pdbx_poly_seq_scheme records.                                                                                                                                                                                                                           |\n",
    "| clustal               | 1.43 | 1.43        | No    | The alignment format of Clustal X and Clustal W.                                                                                                                                                                                                                                                                                                                                            |\n",
    "| embl                  | 1.43 | 1.54        | 1.52  | The EMBL flat file format. Uses Bio.GenBank internally.                                                                                                                                                                                                                                                                                                                                     |\n",
    "| fasta                 | 1.43 | 1.43        | 1.52  | This refers to the input FASTA file format introduced for Bill Pearson’s FASTA tool, where each record starts with a “>” line. Resulting sequences have a generic alphabet by default.                                                                                                                                                                                                      |\n",
    "| fasta-2line           | 1.71 | 1.71        | No    | FASTA format variant with no line wrapping and exactly two lines per record.                                                                                                                                                                                                                                                                                                                |\n",
    "| fastq-sanger or fastq | 1.50 | 1.50        | 1.52  | FASTQ files are a bit like FASTA files but also include sequencing qualities. In Biopython, “fastq” (or the alias “fastq-sanger”) refers to Sanger style FASTQ files which encode PHRED qualities using an ASCII offset of 33. See also the incompatible “fastq-solexa” and “fastq-illumina” variants used in early Solexa/Illumina pipelines, Illumina pipeline 1.8 produces Sanger FASTQ. |\n",
    "| fastq-solexa          | 1.50 | 1.50        | 1.52  | In Biopython, “fastq-solexa” refers to the original Solexa/Illumina style FASTQ files which encode Solexa qualities using an ASCII offset of 64. See also what we call the “fastq-illumina” format.                                                                                                                                                                                         |\n",
    "| fastq-illumina        | 1.51 | 1.51        | 1.52  | In Biopython, “fastq-illumina” refers to early Solexa/Illumina style FASTQ files (from pipeline version 1.3 to 1.7) which encode PHRED qualities using an ASCII offset of 64. For good quality reads, PHRED and Solexa scores are approximately equal, so the “fastq-solexa” and “fastq-illumina” variants are almost equivalent.                                                           |\n",
    "| genbank or gb         | 1.43 | 1.48 / 1.51 | 1.52  | The GenBank or GenPept flat file format. Uses Bio.GenBank internally for parsing. Biopython 1.48 to 1.50 wrote basic GenBank files with only minimal annotation, while 1.51 onwards will also write the features table.                                                                                                                                                                     |\n",
    "| ig                    | 1.47 | No          | 1.52  | This refers to the IntelliGenetics file format, apparently the same as the MASE alignment format.                                                                                                                                                                                                                                                                                           |\n",
    "| imgt                  | 1.56 | 1.56        | 1.56  | This refers to the IMGT variant of the EMBL plain text file format.                                                                                                                                                                                                                                                                                                                         |\n",
    "| nexus                 | 1.43 | 1.48        | No    | The NEXUS multiple alignment format, also known as PAUP format. Uses Bio.Nexus internally.                                                                                                                                                                                                                                                                                                  |\n",
    "| pdb-seqres            | 1.61 | No          | No    | Reads a Protein Data Bank (PDB) file to determine the complete protein sequence as it appears in the header (no dependency on Bio.PDB and NumPy).                                                                                                                                                                                                                                           |\n",
    "| pdb-atom              | 1.61 | No          | No    | Uses Bio.PDB to determine the (partial) protein sequence as it appears in the structure based on the atom coordinate section of the file (requires NumPy).                                                                                                                                                                                                                                  |\n",
    "| phd                   | 1.46 | 1.52        | 1.52  | PHD files are output from PHRED, used by PHRAP and CONSED for input. Uses Bio.Sequencing.Phd internally.                                                                                                                                                                                                                                                                                    |\n",
    "| phylip                | 1.43 | 1.43        | No    | PHYLIP files. Truncates names at 10 characters.                                                                                                                                                                                                                                                                                                                                             |\n",
    "| pir                   | 1.48 | 1.71        | 1.52  | A “FASTA like” format introduced by the National Biomedical Research Foundation (NBRF) for the Protein Information Resource (PIR) database, now part of UniProt.                                                                                                                                                                                                                            |\n",
    "| seqxml                | 1.58 | 1.58        | No    | Simple sequence XML file format.                                                                                                                                                                                                                                                                                                                                                            |\n",
    "| sff                   | 1.54 | 1.54        | 1.54  | Standard Flowgram Format (SFF) binary files produced by Roche 454 and IonTorrent/IonProton sequencing machines.                                                                                                                                                                                                                                                                             |\n",
    "| sff-trim              | 1.54 | No          | 1.54  | Standard Flowgram Format applying the trimming listed in the file.                                                                                                                                                                                                                                                                                                                          |\n",
    "| stockholm             | 1.43 | 1.43        | No    | The Stockholm alignment format is also known as PFAM format.                                                                                                                                                                                                                                                                                                                                |\n",
    "| swiss                 | 1.43 | No          | 1.52  | Swiss-Prot aka UniProt format. Uses Bio.SwissProtinternally. See also the UniProt XML format.                                                                                                                                                                                                                                                                                               |\n",
    "| tab                   | 1.48 | 1.48        | 1.52  | Simple two column tab separated sequence files, where each line holds a record’s identifier and sequence. For example, this is used by Aligent’s eArray software when saving microarray probes in a minimal tab delimited text file.                                                                                                                                                        |\n",
    "| qual                  | 1.50 | 1.50        | 1.52  | Qual files are a bit like FASTA files but instead of the sequence, record space separated integer sequencing values as PHRED quality scores. A matched pair of FASTA and QUAL files are often used as an alternative to a single FASTQ file.                                                                                                                                                |\n",
    "| uniprot-xml           | 1.56 | No          | 1.56  | UniProt XML format, successor to the plain text Swiss-Prot format.                                                                                                                                                                                                                                                                                                                          |\n",
    "\n",
    "No exemplo abaixo vamos abrir um arquivo chamado \"ls_orchid.fasta\" que está no formato FASTA."
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 3,
   "metadata": {},
   "outputs": [
    {
     "name": "stdout",
     "output_type": "stream",
     "text": [
      "gi|2765658|emb|Z78533.1|CIZ78533\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGATGAGACCGTGG...CGC', SingleLetterAlphabet())\n",
      "740\n",
      "gi|2765657|emb|Z78532.1|CCZ78532\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACAACAG...GGC', SingleLetterAlphabet())\n",
      "753\n",
      "gi|2765656|emb|Z78531.1|CFZ78531\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACAGCAG...TAA', SingleLetterAlphabet())\n",
      "748\n",
      "gi|2765655|emb|Z78530.1|CMZ78530\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAAACAACAT...CAT', SingleLetterAlphabet())\n",
      "744\n",
      "gi|2765654|emb|Z78529.1|CLZ78529\n",
      "Seq('ACGGCGAGCTGCCGAAGGACATTGTTGAGACAGCAGAATATACGATTGAGTGAA...AAA', SingleLetterAlphabet())\n",
      "733\n",
      "gi|2765652|emb|Z78527.1|CYZ78527\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACAGTAG...CCC', SingleLetterAlphabet())\n",
      "718\n",
      "gi|2765651|emb|Z78526.1|CGZ78526\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACAGTAG...TGT', SingleLetterAlphabet())\n",
      "730\n",
      "gi|2765650|emb|Z78525.1|CAZ78525\n",
      "Seq('TGTTGAGATAGCAGAATATACATCGAGTGAATCCGGAGGACCTGTGGTTATTCG...GCA', SingleLetterAlphabet())\n",
      "704\n",
      "gi|2765649|emb|Z78524.1|CFZ78524\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATAGTAG...AGC', SingleLetterAlphabet())\n",
      "740\n",
      "gi|2765648|emb|Z78523.1|CHZ78523\n",
      "Seq('CGTAACCAGGTTTCCGTAGGTGAACCTGCGGCAGGATCATTGTTGAGACAGCAG...AAG', SingleLetterAlphabet())\n",
      "709\n",
      "gi|2765647|emb|Z78522.1|CMZ78522\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACAGCAG...GAG', SingleLetterAlphabet())\n",
      "700\n",
      "gi|2765646|emb|Z78521.1|CCZ78521\n",
      "Seq('GTAGGTGAACCTGCGGAAGGATCATTGTTGAGACAGTAGAATATATGATCGAGT...ACC', SingleLetterAlphabet())\n",
      "726\n",
      "gi|2765645|emb|Z78520.1|CSZ78520\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACAGCAG...TTT', SingleLetterAlphabet())\n",
      "753\n",
      "gi|2765644|emb|Z78519.1|CPZ78519\n",
      "Seq('ATATGATCGAGTGAATCTGGTGGACTTGTGGTTACTCAGCTCGCCATAGGCTTT...TTA', SingleLetterAlphabet())\n",
      "699\n",
      "gi|2765643|emb|Z78518.1|CRZ78518\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGGAGGATCATTGTTGAGATAGTAG...TCC', SingleLetterAlphabet())\n",
      "658\n",
      "gi|2765642|emb|Z78517.1|CFZ78517\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACAGTAG...AGC', SingleLetterAlphabet())\n",
      "752\n",
      "gi|2765641|emb|Z78516.1|CPZ78516\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACAGTAT...TAA', SingleLetterAlphabet())\n",
      "726\n",
      "gi|2765640|emb|Z78515.1|MXZ78515\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGCTGAGACCGTAG...AGC', SingleLetterAlphabet())\n",
      "765\n",
      "gi|2765639|emb|Z78514.1|PSZ78514\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGGACCTTCGGGAGGATCATTTTTGAAGCCCCCA...CTA', SingleLetterAlphabet())\n",
      "755\n",
      "gi|2765638|emb|Z78513.1|PBZ78513\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACCGCCA...GAG', SingleLetterAlphabet())\n",
      "742\n",
      "gi|2765637|emb|Z78512.1|PWZ78512\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGGACCTTCGGGAGGATCATTTTTGAAGCCCCCA...AGC', SingleLetterAlphabet())\n",
      "762\n",
      "gi|2765636|emb|Z78511.1|PEZ78511\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTTCGGAAGGATCATTGTTGAGACCCCCA...GGA', SingleLetterAlphabet())\n",
      "745\n",
      "gi|2765635|emb|Z78510.1|PCZ78510\n",
      "Seq('CTAACCAGGGTTCCGAGGTGACCTTCGGGAGGATTCCTTTTTAAGCCCCCGAAA...TTA', SingleLetterAlphabet())\n",
      "750\n",
      "gi|2765634|emb|Z78509.1|PPZ78509\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACCGCCA...GGA', SingleLetterAlphabet())\n",
      "731\n",
      "gi|2765633|emb|Z78508.1|PLZ78508\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACCGCCA...TGA', SingleLetterAlphabet())\n",
      "741\n",
      "gi|2765632|emb|Z78507.1|PLZ78507\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACCCCCA...TGA', SingleLetterAlphabet())\n",
      "740\n",
      "gi|2765631|emb|Z78506.1|PLZ78506\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACCGCAA...TGA', SingleLetterAlphabet())\n",
      "727\n",
      "gi|2765630|emb|Z78505.1|PSZ78505\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACCGCCA...TTT', SingleLetterAlphabet())\n",
      "711\n",
      "gi|2765629|emb|Z78504.1|PKZ78504\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTTCGGAAGGATCATTGTTGAGACCGCAA...TAA', SingleLetterAlphabet())\n",
      "743\n",
      "gi|2765628|emb|Z78503.1|PCZ78503\n",
      "Seq('CGTAACCAGGTTTCCGTAGGTGAACCTCCGGAAGGATCCTTGTTGAGACCGCCA...TAA', SingleLetterAlphabet())\n",
      "727\n",
      "gi|2765627|emb|Z78502.1|PBZ78502\n",
      "Seq('CGTAACCAGGTTTCCGTAGGTGAACCTCCGGAAGGATCATTGTTGAGACCGCCA...CGC', SingleLetterAlphabet())\n",
      "757\n",
      "gi|2765626|emb|Z78501.1|PCZ78501\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACCGCAA...AGA', SingleLetterAlphabet())\n",
      "770\n",
      "gi|2765625|emb|Z78500.1|PWZ78500\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGCTCATTGTTGAGACCGCAA...AAG', SingleLetterAlphabet())\n",
      "767\n",
      "gi|2765624|emb|Z78499.1|PMZ78499\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAGGGATCATTGTTGAGATCGCAT...ACC', SingleLetterAlphabet())\n",
      "759\n",
      "gi|2765623|emb|Z78498.1|PMZ78498\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAAGGTCATTGTTGAGATCACAT...AGC', SingleLetterAlphabet())\n",
      "750\n",
      "gi|2765622|emb|Z78497.1|PDZ78497\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...AGC', SingleLetterAlphabet())\n",
      "788\n",
      "gi|2765621|emb|Z78496.1|PAZ78496\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCGCAT...AGC', SingleLetterAlphabet())\n",
      "774\n",
      "gi|2765620|emb|Z78495.1|PEZ78495\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTCCGGAAGGATCATTGTTGAGATCACAT...GTG', SingleLetterAlphabet())\n",
      "789\n",
      "gi|2765619|emb|Z78494.1|PNZ78494\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGGTCGCAT...AAG', SingleLetterAlphabet())\n",
      "688\n",
      "gi|2765618|emb|Z78493.1|PGZ78493\n",
      "Seq('CGTAACAAGGATTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCGCAT...CCC', SingleLetterAlphabet())\n",
      "719\n",
      "gi|2765617|emb|Z78492.1|PBZ78492\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCGCAT...ATA', SingleLetterAlphabet())\n",
      "743\n",
      "gi|2765616|emb|Z78491.1|PCZ78491\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCGCAT...AGC', SingleLetterAlphabet())\n",
      "737\n",
      "gi|2765615|emb|Z78490.1|PFZ78490\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...TGA', SingleLetterAlphabet())\n",
      "728\n",
      "gi|2765614|emb|Z78489.1|PDZ78489\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...GGC', SingleLetterAlphabet())\n",
      "740\n",
      "gi|2765613|emb|Z78488.1|PTZ78488\n",
      "Seq('CTGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACGCAATAATTGATCGA...GCT', SingleLetterAlphabet())\n",
      "696\n",
      "gi|2765612|emb|Z78487.1|PHZ78487\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...TAA', SingleLetterAlphabet())\n",
      "732\n",
      "gi|2765611|emb|Z78486.1|PBZ78486\n",
      "Seq('CGTCACGAGGTTTCCGTAGGTGAATCTGCGGGAGGATCATTGTTGAGATCACAT...TGA', SingleLetterAlphabet())\n",
      "731\n",
      "gi|2765610|emb|Z78485.1|PHZ78485\n",
      "Seq('CTGAACCTGGTGTCCGAAGGTGAATCTGCGGATGGATCATTGTTGAGATATCAT...GTA', SingleLetterAlphabet())\n",
      "735\n",
      "gi|2765609|emb|Z78484.1|PCZ78484\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGGGGAAGGATCATTGTTGAGATCACAT...TTT', SingleLetterAlphabet())\n",
      "720\n",
      "gi|2765608|emb|Z78483.1|PVZ78483\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...GCA', SingleLetterAlphabet())\n",
      "740\n",
      "gi|2765607|emb|Z78482.1|PEZ78482\n",
      "Seq('TCTACTGCAGTGACCGAGATTTGCCATCGAGCCTCCTGGGAGCTTTCTTGCTGG...GCA', SingleLetterAlphabet())\n",
      "629\n",
      "gi|2765606|emb|Z78481.1|PIZ78481\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...TGA', SingleLetterAlphabet())\n",
      "572\n",
      "gi|2765605|emb|Z78480.1|PGZ78480\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...TGA', SingleLetterAlphabet())\n",
      "587\n",
      "gi|2765604|emb|Z78479.1|PPZ78479\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...AGT', SingleLetterAlphabet())\n",
      "700\n",
      "gi|2765603|emb|Z78478.1|PVZ78478\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTCCGGAAGGATCAGTGTTGAGATCACAT...GGC', SingleLetterAlphabet())\n",
      "636\n",
      "gi|2765602|emb|Z78477.1|PVZ78477\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...TGC', SingleLetterAlphabet())\n",
      "716\n",
      "gi|2765601|emb|Z78476.1|PGZ78476\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...CCC', SingleLetterAlphabet())\n",
      "592\n",
      "gi|2765600|emb|Z78475.1|PSZ78475\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...GGT', SingleLetterAlphabet())\n",
      "716\n",
      "gi|2765599|emb|Z78474.1|PKZ78474\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACGT...CTT', SingleLetterAlphabet())\n",
      "733\n",
      "gi|2765598|emb|Z78473.1|PSZ78473\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...AGG', SingleLetterAlphabet())\n",
      "626\n",
      "gi|2765597|emb|Z78472.1|PLZ78472\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...AGC', SingleLetterAlphabet())\n",
      "737\n",
      "gi|2765596|emb|Z78471.1|PDZ78471\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...AGC', SingleLetterAlphabet())\n",
      "740\n",
      "gi|2765595|emb|Z78470.1|PPZ78470\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...GTT', SingleLetterAlphabet())\n",
      "574\n",
      "gi|2765594|emb|Z78469.1|PHZ78469\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...GTT', SingleLetterAlphabet())\n",
      "594\n",
      "gi|2765593|emb|Z78468.1|PAZ78468\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCGCAT...GTT', SingleLetterAlphabet())\n",
      "610\n",
      "gi|2765592|emb|Z78467.1|PSZ78467\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...TGA', SingleLetterAlphabet())\n",
      "730\n",
      "gi|2765591|emb|Z78466.1|PPZ78466\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...CCC', SingleLetterAlphabet())\n",
      "641\n",
      "gi|2765590|emb|Z78465.1|PRZ78465\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...TGC', SingleLetterAlphabet())\n",
      "702\n",
      "gi|2765589|emb|Z78464.1|PGZ78464\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAGCGGAAGGGTCATTGTTGAGATCACATAATA...AGC', SingleLetterAlphabet())\n",
      "733\n",
      "gi|2765588|emb|Z78463.1|PGZ78463\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGTTCATTGTTGAGATCACAT...AGC', SingleLetterAlphabet())\n",
      "738\n",
      "gi|2765587|emb|Z78462.1|PSZ78462\n",
      "Seq('CGTCACGAGGTCTCCGGATGTGACCCTGCGGAAGGATCATTGTTGAGATCACAT...CAT', SingleLetterAlphabet())\n",
      "736\n",
      "gi|2765586|emb|Z78461.1|PWZ78461\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTCCGGAAGGATCATTGTTGAGATCACAT...TAA', SingleLetterAlphabet())\n",
      "732\n",
      "gi|2765585|emb|Z78460.1|PCZ78460\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTCCGGAAGGATCATTGTTGAGATCACAT...TTA', SingleLetterAlphabet())\n",
      "745\n",
      "gi|2765584|emb|Z78459.1|PDZ78459\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...TTT', SingleLetterAlphabet())\n",
      "744\n",
      "gi|2765583|emb|Z78458.1|PHZ78458\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...TTG', SingleLetterAlphabet())\n",
      "738\n",
      "gi|2765582|emb|Z78457.1|PCZ78457\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTCCGGAAGGATCATTGTTGAGATCACAT...GAG', SingleLetterAlphabet())\n",
      "739\n",
      "gi|2765581|emb|Z78456.1|PTZ78456\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...AGC', SingleLetterAlphabet())\n",
      "740\n",
      "gi|2765580|emb|Z78455.1|PJZ78455\n",
      "Seq('CGTAACCAGGTTTCCGTAGGTGGACCTTCGGGAGGATCATTTTTGAGATCACAT...GCA', SingleLetterAlphabet())\n",
      "745\n",
      "gi|2765579|emb|Z78454.1|PFZ78454\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...AAC', SingleLetterAlphabet())\n",
      "695\n",
      "gi|2765578|emb|Z78453.1|PSZ78453\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...GCA', SingleLetterAlphabet())\n",
      "745\n",
      "gi|2765577|emb|Z78452.1|PBZ78452\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...GCA', SingleLetterAlphabet())\n",
      "743\n",
      "gi|2765576|emb|Z78451.1|PHZ78451\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGTACCTCCGGAAGGATCATTGTTGAGATCACAT...AGC', SingleLetterAlphabet())\n",
      "730\n",
      "gi|2765575|emb|Z78450.1|PPZ78450\n",
      "Seq('GGAAGGATCATTGCTGATATCACATAATAATTGATCGAGTTAAGCTGGAGGATC...GAG', SingleLetterAlphabet())\n",
      "706\n",
      "gi|2765574|emb|Z78449.1|PMZ78449\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...TGC', SingleLetterAlphabet())\n",
      "744\n",
      "gi|2765573|emb|Z78448.1|PAZ78448\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...AGG', SingleLetterAlphabet())\n",
      "742\n",
      "gi|2765572|emb|Z78447.1|PVZ78447\n",
      "Seq('CGTAACAAGGATTCCGTAGGTGAACCTGCGGGAGGATCATTGTTGAGATCACAT...AGC', SingleLetterAlphabet())\n",
      "694\n",
      "gi|2765571|emb|Z78446.1|PAZ78446\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTCCGGAAGGATCATTGTTGAGATCACAT...CCC', SingleLetterAlphabet())\n",
      "712\n",
      "gi|2765570|emb|Z78445.1|PUZ78445\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...TGT', SingleLetterAlphabet())\n",
      "715\n",
      "gi|2765569|emb|Z78444.1|PAZ78444\n",
      "Seq('CGTAACAAGGTTTCCGTAGGGTGAACTGCGGAAGGATCATTGTTGAGATCACAT...ATT', SingleLetterAlphabet())\n",
      "688\n",
      "gi|2765568|emb|Z78443.1|PLZ78443\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...AGG', SingleLetterAlphabet())\n",
      "784\n",
      "gi|2765567|emb|Z78442.1|PBZ78442\n",
      "Seq('GTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACATAATAATTGATCGAGT...AGT', SingleLetterAlphabet())\n",
      "721\n",
      "gi|2765566|emb|Z78441.1|PSZ78441\n",
      "Seq('GGAAGGTCATTGCCGATATCACATAATAATTGATCGAGTTAATCTGGAGGATCT...GAG', SingleLetterAlphabet())\n",
      "703\n",
      "gi|2765565|emb|Z78440.1|PPZ78440\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGGACCTCCGGGAGGATCATTGTTGAGATCACAT...GCA', SingleLetterAlphabet())\n",
      "744\n",
      "gi|2765564|emb|Z78439.1|PBZ78439\n",
      "Seq('CATTGTTGAGATCACATAATAATTGATCGAGTTAATCTGGAGGATCTGTTTACT...GCC', SingleLetterAlphabet())\n",
      "592\n"
     ]
    }
   ],
   "source": [
    "from Bio import SeqIO\n",
    "records = SeqIO.parse(\"ls_orchid.fasta\", \"fasta\")\n",
    "for seq_record in records:\n",
    "    print(seq_record.id)\n",
    "    print(repr(seq_record.seq))\n",
    "    print(len(seq_record))"
   ]
  },
  {
   "cell_type": "markdown",
   "metadata": {},
   "source": [
    "### 3.1 Carregar os SeqRecords em uma lista\n",
    "\n",
    "Como o método parse retorna um Generator, a cada iteração ele retorna un SeqRecord, porém não tem como você voltar para uma sequência anterior ou pular para a sequência final. Uma forma contorna isso é ler todas as sequências e guardar em uma lista utilizando list comprehension. A vantagem de fazer isso é que sempre podemos percorrer a lista de qualquer forma e acessar qualquer sequência a qualquer momento. Porém a desvantagem é que fazer isso você estará carregando o arquivo todo na memória RAM. Como os arquivos que utilizamos em bioinformática não tem o costume de serem muito pequenos isso pode ser um problemão."
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 4,
   "metadata": {},
   "outputs": [
    {
     "name": "stdout",
     "output_type": "stream",
     "text": [
      "ID: gi|2765658|emb|Z78533.1|CIZ78533\n",
      "Name: gi|2765658|emb|Z78533.1|CIZ78533\n",
      "Description: gi|2765658|emb|Z78533.1|CIZ78533 C.irapeanum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGATGAGACCGTGG...CGC', SingleLetterAlphabet())\n",
      "ID: gi|2765657|emb|Z78532.1|CCZ78532\n",
      "Name: gi|2765657|emb|Z78532.1|CCZ78532\n",
      "Description: gi|2765657|emb|Z78532.1|CCZ78532 C.californicum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACAACAG...GGC', SingleLetterAlphabet())\n",
      "ID: gi|2765656|emb|Z78531.1|CFZ78531\n",
      "Name: gi|2765656|emb|Z78531.1|CFZ78531\n",
      "Description: gi|2765656|emb|Z78531.1|CFZ78531 C.fasciculatum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACAGCAG...TAA', SingleLetterAlphabet())\n",
      "ID: gi|2765655|emb|Z78530.1|CMZ78530\n",
      "Name: gi|2765655|emb|Z78530.1|CMZ78530\n",
      "Description: gi|2765655|emb|Z78530.1|CMZ78530 C.margaritaceum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAAACAACAT...CAT', SingleLetterAlphabet())\n",
      "ID: gi|2765654|emb|Z78529.1|CLZ78529\n",
      "Name: gi|2765654|emb|Z78529.1|CLZ78529\n",
      "Description: gi|2765654|emb|Z78529.1|CLZ78529 C.lichiangense 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('ACGGCGAGCTGCCGAAGGACATTGTTGAGACAGCAGAATATACGATTGAGTGAA...AAA', SingleLetterAlphabet())\n",
      "ID: gi|2765652|emb|Z78527.1|CYZ78527\n",
      "Name: gi|2765652|emb|Z78527.1|CYZ78527\n",
      "Description: gi|2765652|emb|Z78527.1|CYZ78527 C.yatabeanum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACAGTAG...CCC', SingleLetterAlphabet())\n",
      "ID: gi|2765651|emb|Z78526.1|CGZ78526\n",
      "Name: gi|2765651|emb|Z78526.1|CGZ78526\n",
      "Description: gi|2765651|emb|Z78526.1|CGZ78526 C.guttatum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACAGTAG...TGT', SingleLetterAlphabet())\n",
      "ID: gi|2765650|emb|Z78525.1|CAZ78525\n",
      "Name: gi|2765650|emb|Z78525.1|CAZ78525\n",
      "Description: gi|2765650|emb|Z78525.1|CAZ78525 C.acaule 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('TGTTGAGATAGCAGAATATACATCGAGTGAATCCGGAGGACCTGTGGTTATTCG...GCA', SingleLetterAlphabet())\n",
      "ID: gi|2765649|emb|Z78524.1|CFZ78524\n",
      "Name: gi|2765649|emb|Z78524.1|CFZ78524\n",
      "Description: gi|2765649|emb|Z78524.1|CFZ78524 C.formosanum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATAGTAG...AGC', SingleLetterAlphabet())\n",
      "ID: gi|2765648|emb|Z78523.1|CHZ78523\n",
      "Name: gi|2765648|emb|Z78523.1|CHZ78523\n",
      "Description: gi|2765648|emb|Z78523.1|CHZ78523 C.himalaicum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACCAGGTTTCCGTAGGTGAACCTGCGGCAGGATCATTGTTGAGACAGCAG...AAG', SingleLetterAlphabet())\n",
      "ID: gi|2765647|emb|Z78522.1|CMZ78522\n",
      "Name: gi|2765647|emb|Z78522.1|CMZ78522\n",
      "Description: gi|2765647|emb|Z78522.1|CMZ78522 C.macranthum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACAGCAG...GAG', SingleLetterAlphabet())\n",
      "ID: gi|2765646|emb|Z78521.1|CCZ78521\n",
      "Name: gi|2765646|emb|Z78521.1|CCZ78521\n",
      "Description: gi|2765646|emb|Z78521.1|CCZ78521 C.calceolus 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('GTAGGTGAACCTGCGGAAGGATCATTGTTGAGACAGTAGAATATATGATCGAGT...ACC', SingleLetterAlphabet())\n",
      "ID: gi|2765645|emb|Z78520.1|CSZ78520\n",
      "Name: gi|2765645|emb|Z78520.1|CSZ78520\n",
      "Description: gi|2765645|emb|Z78520.1|CSZ78520 C.segawai 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACAGCAG...TTT', SingleLetterAlphabet())\n",
      "ID: gi|2765644|emb|Z78519.1|CPZ78519\n",
      "Name: gi|2765644|emb|Z78519.1|CPZ78519\n",
      "Description: gi|2765644|emb|Z78519.1|CPZ78519 C.pubescens 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('ATATGATCGAGTGAATCTGGTGGACTTGTGGTTACTCAGCTCGCCATAGGCTTT...TTA', SingleLetterAlphabet())\n",
      "ID: gi|2765643|emb|Z78518.1|CRZ78518\n",
      "Name: gi|2765643|emb|Z78518.1|CRZ78518\n",
      "Description: gi|2765643|emb|Z78518.1|CRZ78518 C.reginae 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGGAGGATCATTGTTGAGATAGTAG...TCC', SingleLetterAlphabet())\n",
      "ID: gi|2765642|emb|Z78517.1|CFZ78517\n",
      "Name: gi|2765642|emb|Z78517.1|CFZ78517\n",
      "Description: gi|2765642|emb|Z78517.1|CFZ78517 C.flavum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACAGTAG...AGC', SingleLetterAlphabet())\n",
      "ID: gi|2765641|emb|Z78516.1|CPZ78516\n",
      "Name: gi|2765641|emb|Z78516.1|CPZ78516\n",
      "Description: gi|2765641|emb|Z78516.1|CPZ78516 C.passerinum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACAGTAT...TAA', SingleLetterAlphabet())\n",
      "ID: gi|2765640|emb|Z78515.1|MXZ78515\n",
      "Name: gi|2765640|emb|Z78515.1|MXZ78515\n",
      "Description: gi|2765640|emb|Z78515.1|MXZ78515 M.xerophyticum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGCTGAGACCGTAG...AGC', SingleLetterAlphabet())\n",
      "ID: gi|2765639|emb|Z78514.1|PSZ78514\n",
      "Name: gi|2765639|emb|Z78514.1|PSZ78514\n",
      "Description: gi|2765639|emb|Z78514.1|PSZ78514 P.schlimii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGGACCTTCGGGAGGATCATTTTTGAAGCCCCCA...CTA', SingleLetterAlphabet())\n",
      "ID: gi|2765638|emb|Z78513.1|PBZ78513\n",
      "Name: gi|2765638|emb|Z78513.1|PBZ78513\n",
      "Description: gi|2765638|emb|Z78513.1|PBZ78513 P.besseae 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACCGCCA...GAG', SingleLetterAlphabet())\n",
      "ID: gi|2765637|emb|Z78512.1|PWZ78512\n",
      "Name: gi|2765637|emb|Z78512.1|PWZ78512\n",
      "Description: gi|2765637|emb|Z78512.1|PWZ78512 P.wallisii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGGACCTTCGGGAGGATCATTTTTGAAGCCCCCA...AGC', SingleLetterAlphabet())\n",
      "ID: gi|2765636|emb|Z78511.1|PEZ78511\n",
      "Name: gi|2765636|emb|Z78511.1|PEZ78511\n",
      "Description: gi|2765636|emb|Z78511.1|PEZ78511 P.exstaminodium 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTTCGGAAGGATCATTGTTGAGACCCCCA...GGA', SingleLetterAlphabet())\n",
      "ID: gi|2765635|emb|Z78510.1|PCZ78510\n",
      "Name: gi|2765635|emb|Z78510.1|PCZ78510\n",
      "Description: gi|2765635|emb|Z78510.1|PCZ78510 P.caricinum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CTAACCAGGGTTCCGAGGTGACCTTCGGGAGGATTCCTTTTTAAGCCCCCGAAA...TTA', SingleLetterAlphabet())\n",
      "ID: gi|2765634|emb|Z78509.1|PPZ78509\n",
      "Name: gi|2765634|emb|Z78509.1|PPZ78509\n",
      "Description: gi|2765634|emb|Z78509.1|PPZ78509 P.pearcei 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACCGCCA...GGA', SingleLetterAlphabet())\n",
      "ID: gi|2765633|emb|Z78508.1|PLZ78508\n",
      "Name: gi|2765633|emb|Z78508.1|PLZ78508\n",
      "Description: gi|2765633|emb|Z78508.1|PLZ78508 P.longifolium 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACCGCCA...TGA', SingleLetterAlphabet())\n",
      "ID: gi|2765632|emb|Z78507.1|PLZ78507\n",
      "Name: gi|2765632|emb|Z78507.1|PLZ78507\n",
      "Description: gi|2765632|emb|Z78507.1|PLZ78507 P.lindenii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACCCCCA...TGA', SingleLetterAlphabet())\n",
      "ID: gi|2765631|emb|Z78506.1|PLZ78506\n",
      "Name: gi|2765631|emb|Z78506.1|PLZ78506\n",
      "Description: gi|2765631|emb|Z78506.1|PLZ78506 P.lindleyanum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACCGCAA...TGA', SingleLetterAlphabet())\n",
      "ID: gi|2765630|emb|Z78505.1|PSZ78505\n",
      "Name: gi|2765630|emb|Z78505.1|PSZ78505\n",
      "Description: gi|2765630|emb|Z78505.1|PSZ78505 P.sargentianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACCGCCA...TTT', SingleLetterAlphabet())\n",
      "ID: gi|2765629|emb|Z78504.1|PKZ78504\n",
      "Name: gi|2765629|emb|Z78504.1|PKZ78504\n",
      "Description: gi|2765629|emb|Z78504.1|PKZ78504 P.kaiteurum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTTCGGAAGGATCATTGTTGAGACCGCAA...TAA', SingleLetterAlphabet())\n",
      "ID: gi|2765628|emb|Z78503.1|PCZ78503\n",
      "Name: gi|2765628|emb|Z78503.1|PCZ78503\n",
      "Description: gi|2765628|emb|Z78503.1|PCZ78503 P.czerwiakowianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACCAGGTTTCCGTAGGTGAACCTCCGGAAGGATCCTTGTTGAGACCGCCA...TAA', SingleLetterAlphabet())\n",
      "ID: gi|2765627|emb|Z78502.1|PBZ78502\n",
      "Name: gi|2765627|emb|Z78502.1|PBZ78502\n",
      "Description: gi|2765627|emb|Z78502.1|PBZ78502 P.boissierianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACCAGGTTTCCGTAGGTGAACCTCCGGAAGGATCATTGTTGAGACCGCCA...CGC', SingleLetterAlphabet())\n",
      "ID: gi|2765626|emb|Z78501.1|PCZ78501\n",
      "Name: gi|2765626|emb|Z78501.1|PCZ78501\n",
      "Description: gi|2765626|emb|Z78501.1|PCZ78501 P.caudatum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACCGCAA...AGA', SingleLetterAlphabet())\n",
      "ID: gi|2765625|emb|Z78500.1|PWZ78500\n",
      "Name: gi|2765625|emb|Z78500.1|PWZ78500\n",
      "Description: gi|2765625|emb|Z78500.1|PWZ78500 P.warszewiczianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGCTCATTGTTGAGACCGCAA...AAG', SingleLetterAlphabet())\n",
      "ID: gi|2765624|emb|Z78499.1|PMZ78499\n",
      "Name: gi|2765624|emb|Z78499.1|PMZ78499\n",
      "Description: gi|2765624|emb|Z78499.1|PMZ78499 P.micranthum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAGGGATCATTGTTGAGATCGCAT...ACC', SingleLetterAlphabet())\n",
      "ID: gi|2765623|emb|Z78498.1|PMZ78498\n",
      "Name: gi|2765623|emb|Z78498.1|PMZ78498\n",
      "Description: gi|2765623|emb|Z78498.1|PMZ78498 P.malipoense 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAAGGTCATTGTTGAGATCACAT...AGC', SingleLetterAlphabet())\n",
      "ID: gi|2765622|emb|Z78497.1|PDZ78497\n",
      "Name: gi|2765622|emb|Z78497.1|PDZ78497\n",
      "Description: gi|2765622|emb|Z78497.1|PDZ78497 P.delenatii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...AGC', SingleLetterAlphabet())\n",
      "ID: gi|2765621|emb|Z78496.1|PAZ78496\n",
      "Name: gi|2765621|emb|Z78496.1|PAZ78496\n",
      "Description: gi|2765621|emb|Z78496.1|PAZ78496 P.armeniacum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCGCAT...AGC', SingleLetterAlphabet())\n",
      "ID: gi|2765620|emb|Z78495.1|PEZ78495\n",
      "Name: gi|2765620|emb|Z78495.1|PEZ78495\n",
      "Description: gi|2765620|emb|Z78495.1|PEZ78495 P.emersonii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTCCGGAAGGATCATTGTTGAGATCACAT...GTG', SingleLetterAlphabet())\n",
      "ID: gi|2765619|emb|Z78494.1|PNZ78494\n",
      "Name: gi|2765619|emb|Z78494.1|PNZ78494\n",
      "Description: gi|2765619|emb|Z78494.1|PNZ78494 P.niveum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGGTCGCAT...AAG', SingleLetterAlphabet())\n",
      "ID: gi|2765618|emb|Z78493.1|PGZ78493\n",
      "Name: gi|2765618|emb|Z78493.1|PGZ78493\n",
      "Description: gi|2765618|emb|Z78493.1|PGZ78493 P.godefroyae 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGATTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCGCAT...CCC', SingleLetterAlphabet())\n",
      "ID: gi|2765617|emb|Z78492.1|PBZ78492\n",
      "Name: gi|2765617|emb|Z78492.1|PBZ78492\n",
      "Description: gi|2765617|emb|Z78492.1|PBZ78492 P.bellatulum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCGCAT...ATA', SingleLetterAlphabet())\n",
      "ID: gi|2765616|emb|Z78491.1|PCZ78491\n",
      "Name: gi|2765616|emb|Z78491.1|PCZ78491\n",
      "Description: gi|2765616|emb|Z78491.1|PCZ78491 P.concolor 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCGCAT...AGC', SingleLetterAlphabet())\n",
      "ID: gi|2765615|emb|Z78490.1|PFZ78490\n",
      "Name: gi|2765615|emb|Z78490.1|PFZ78490\n",
      "Description: gi|2765615|emb|Z78490.1|PFZ78490 P.fairrieanum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...TGA', SingleLetterAlphabet())\n",
      "ID: gi|2765614|emb|Z78489.1|PDZ78489\n",
      "Name: gi|2765614|emb|Z78489.1|PDZ78489\n",
      "Description: gi|2765614|emb|Z78489.1|PDZ78489 P.druryi 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...GGC', SingleLetterAlphabet())\n",
      "ID: gi|2765613|emb|Z78488.1|PTZ78488\n",
      "Name: gi|2765613|emb|Z78488.1|PTZ78488\n",
      "Description: gi|2765613|emb|Z78488.1|PTZ78488 P.tigrinum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CTGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACGCAATAATTGATCGA...GCT', SingleLetterAlphabet())\n",
      "ID: gi|2765612|emb|Z78487.1|PHZ78487\n",
      "Name: gi|2765612|emb|Z78487.1|PHZ78487\n",
      "Description: gi|2765612|emb|Z78487.1|PHZ78487 P.hirsutissimum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...TAA', SingleLetterAlphabet())\n",
      "ID: gi|2765611|emb|Z78486.1|PBZ78486\n",
      "Name: gi|2765611|emb|Z78486.1|PBZ78486\n",
      "Description: gi|2765611|emb|Z78486.1|PBZ78486 P.barbigerum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTCACGAGGTTTCCGTAGGTGAATCTGCGGGAGGATCATTGTTGAGATCACAT...TGA', SingleLetterAlphabet())\n",
      "ID: gi|2765610|emb|Z78485.1|PHZ78485\n",
      "Name: gi|2765610|emb|Z78485.1|PHZ78485\n",
      "Description: gi|2765610|emb|Z78485.1|PHZ78485 P.henryanum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CTGAACCTGGTGTCCGAAGGTGAATCTGCGGATGGATCATTGTTGAGATATCAT...GTA', SingleLetterAlphabet())\n",
      "ID: gi|2765609|emb|Z78484.1|PCZ78484\n",
      "Name: gi|2765609|emb|Z78484.1|PCZ78484\n",
      "Description: gi|2765609|emb|Z78484.1|PCZ78484 P.charlesworthii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGGGGAAGGATCATTGTTGAGATCACAT...TTT', SingleLetterAlphabet())\n",
      "ID: gi|2765608|emb|Z78483.1|PVZ78483\n",
      "Name: gi|2765608|emb|Z78483.1|PVZ78483\n",
      "Description: gi|2765608|emb|Z78483.1|PVZ78483 P.villosum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...GCA', SingleLetterAlphabet())\n",
      "ID: gi|2765607|emb|Z78482.1|PEZ78482\n",
      "Name: gi|2765607|emb|Z78482.1|PEZ78482\n",
      "Description: gi|2765607|emb|Z78482.1|PEZ78482 P.exul 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('TCTACTGCAGTGACCGAGATTTGCCATCGAGCCTCCTGGGAGCTTTCTTGCTGG...GCA', SingleLetterAlphabet())\n",
      "ID: gi|2765606|emb|Z78481.1|PIZ78481\n",
      "Name: gi|2765606|emb|Z78481.1|PIZ78481\n",
      "Description: gi|2765606|emb|Z78481.1|PIZ78481 P.insigne 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...TGA', SingleLetterAlphabet())\n",
      "ID: gi|2765605|emb|Z78480.1|PGZ78480\n",
      "Name: gi|2765605|emb|Z78480.1|PGZ78480\n",
      "Description: gi|2765605|emb|Z78480.1|PGZ78480 P.gratrixianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...TGA', SingleLetterAlphabet())\n",
      "ID: gi|2765604|emb|Z78479.1|PPZ78479\n",
      "Name: gi|2765604|emb|Z78479.1|PPZ78479\n",
      "Description: gi|2765604|emb|Z78479.1|PPZ78479 P.primulinum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...AGT', SingleLetterAlphabet())\n",
      "ID: gi|2765603|emb|Z78478.1|PVZ78478\n",
      "Name: gi|2765603|emb|Z78478.1|PVZ78478\n",
      "Description: gi|2765603|emb|Z78478.1|PVZ78478 P.victoria 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTCCGGAAGGATCAGTGTTGAGATCACAT...GGC', SingleLetterAlphabet())\n",
      "ID: gi|2765602|emb|Z78477.1|PVZ78477\n",
      "Name: gi|2765602|emb|Z78477.1|PVZ78477\n",
      "Description: gi|2765602|emb|Z78477.1|PVZ78477 P.victoria 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...TGC', SingleLetterAlphabet())\n",
      "ID: gi|2765601|emb|Z78476.1|PGZ78476\n",
      "Name: gi|2765601|emb|Z78476.1|PGZ78476\n",
      "Description: gi|2765601|emb|Z78476.1|PGZ78476 P.glaucophyllum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...CCC', SingleLetterAlphabet())\n",
      "ID: gi|2765600|emb|Z78475.1|PSZ78475\n",
      "Name: gi|2765600|emb|Z78475.1|PSZ78475\n",
      "Description: gi|2765600|emb|Z78475.1|PSZ78475 P.supardii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...GGT', SingleLetterAlphabet())\n",
      "ID: gi|2765599|emb|Z78474.1|PKZ78474\n",
      "Name: gi|2765599|emb|Z78474.1|PKZ78474\n",
      "Description: gi|2765599|emb|Z78474.1|PKZ78474 P.kolopakingii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACGT...CTT', SingleLetterAlphabet())\n",
      "ID: gi|2765598|emb|Z78473.1|PSZ78473\n",
      "Name: gi|2765598|emb|Z78473.1|PSZ78473\n",
      "Description: gi|2765598|emb|Z78473.1|PSZ78473 P.sanderianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...AGG', SingleLetterAlphabet())\n",
      "ID: gi|2765597|emb|Z78472.1|PLZ78472\n",
      "Name: gi|2765597|emb|Z78472.1|PLZ78472\n",
      "Description: gi|2765597|emb|Z78472.1|PLZ78472 P.lowii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...AGC', SingleLetterAlphabet())\n",
      "ID: gi|2765596|emb|Z78471.1|PDZ78471\n",
      "Name: gi|2765596|emb|Z78471.1|PDZ78471\n",
      "Description: gi|2765596|emb|Z78471.1|PDZ78471 P.dianthum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...AGC', SingleLetterAlphabet())\n",
      "ID: gi|2765595|emb|Z78470.1|PPZ78470\n",
      "Name: gi|2765595|emb|Z78470.1|PPZ78470\n",
      "Description: gi|2765595|emb|Z78470.1|PPZ78470 P.parishii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...GTT', SingleLetterAlphabet())\n",
      "ID: gi|2765594|emb|Z78469.1|PHZ78469\n",
      "Name: gi|2765594|emb|Z78469.1|PHZ78469\n",
      "Description: gi|2765594|emb|Z78469.1|PHZ78469 P.haynaldianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...GTT', SingleLetterAlphabet())\n",
      "ID: gi|2765593|emb|Z78468.1|PAZ78468\n",
      "Name: gi|2765593|emb|Z78468.1|PAZ78468\n",
      "Description: gi|2765593|emb|Z78468.1|PAZ78468 P.adductum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCGCAT...GTT', SingleLetterAlphabet())\n",
      "ID: gi|2765592|emb|Z78467.1|PSZ78467\n",
      "Name: gi|2765592|emb|Z78467.1|PSZ78467\n",
      "Description: gi|2765592|emb|Z78467.1|PSZ78467 P.stonei 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...TGA', SingleLetterAlphabet())\n",
      "ID: gi|2765591|emb|Z78466.1|PPZ78466\n",
      "Name: gi|2765591|emb|Z78466.1|PPZ78466\n",
      "Description: gi|2765591|emb|Z78466.1|PPZ78466 P.philippinense 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...CCC', SingleLetterAlphabet())\n",
      "ID: gi|2765590|emb|Z78465.1|PRZ78465\n",
      "Name: gi|2765590|emb|Z78465.1|PRZ78465\n",
      "Description: gi|2765590|emb|Z78465.1|PRZ78465 P.rothschildianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...TGC', SingleLetterAlphabet())\n",
      "ID: gi|2765589|emb|Z78464.1|PGZ78464\n",
      "Name: gi|2765589|emb|Z78464.1|PGZ78464\n",
      "Description: gi|2765589|emb|Z78464.1|PGZ78464 P.glanduliferum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAGCGGAAGGGTCATTGTTGAGATCACATAATA...AGC', SingleLetterAlphabet())\n",
      "ID: gi|2765588|emb|Z78463.1|PGZ78463\n",
      "Name: gi|2765588|emb|Z78463.1|PGZ78463\n",
      "Description: gi|2765588|emb|Z78463.1|PGZ78463 P.glanduliferum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGTTCATTGTTGAGATCACAT...AGC', SingleLetterAlphabet())\n",
      "ID: gi|2765587|emb|Z78462.1|PSZ78462\n",
      "Name: gi|2765587|emb|Z78462.1|PSZ78462\n",
      "Description: gi|2765587|emb|Z78462.1|PSZ78462 P.sukhakulii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTCACGAGGTCTCCGGATGTGACCCTGCGGAAGGATCATTGTTGAGATCACAT...CAT', SingleLetterAlphabet())\n",
      "ID: gi|2765586|emb|Z78461.1|PWZ78461\n",
      "Name: gi|2765586|emb|Z78461.1|PWZ78461\n",
      "Description: gi|2765586|emb|Z78461.1|PWZ78461 P.wardii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTCCGGAAGGATCATTGTTGAGATCACAT...TAA', SingleLetterAlphabet())\n",
      "ID: gi|2765585|emb|Z78460.1|PCZ78460\n",
      "Name: gi|2765585|emb|Z78460.1|PCZ78460\n",
      "Description: gi|2765585|emb|Z78460.1|PCZ78460 P.ciliolare 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTCCGGAAGGATCATTGTTGAGATCACAT...TTA', SingleLetterAlphabet())\n",
      "ID: gi|2765584|emb|Z78459.1|PDZ78459\n",
      "Name: gi|2765584|emb|Z78459.1|PDZ78459\n",
      "Description: gi|2765584|emb|Z78459.1|PDZ78459 P.dayanum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...TTT', SingleLetterAlphabet())\n",
      "ID: gi|2765583|emb|Z78458.1|PHZ78458\n",
      "Name: gi|2765583|emb|Z78458.1|PHZ78458\n",
      "Description: gi|2765583|emb|Z78458.1|PHZ78458 P.hennisianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...TTG', SingleLetterAlphabet())\n",
      "ID: gi|2765582|emb|Z78457.1|PCZ78457\n",
      "Name: gi|2765582|emb|Z78457.1|PCZ78457\n",
      "Description: gi|2765582|emb|Z78457.1|PCZ78457 P.callosum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTCCGGAAGGATCATTGTTGAGATCACAT...GAG', SingleLetterAlphabet())\n",
      "ID: gi|2765581|emb|Z78456.1|PTZ78456\n",
      "Name: gi|2765581|emb|Z78456.1|PTZ78456\n",
      "Description: gi|2765581|emb|Z78456.1|PTZ78456 P.tonsum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...AGC', SingleLetterAlphabet())\n",
      "ID: gi|2765580|emb|Z78455.1|PJZ78455\n",
      "Name: gi|2765580|emb|Z78455.1|PJZ78455\n",
      "Description: gi|2765580|emb|Z78455.1|PJZ78455 P.javanicum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACCAGGTTTCCGTAGGTGGACCTTCGGGAGGATCATTTTTGAGATCACAT...GCA', SingleLetterAlphabet())\n",
      "ID: gi|2765579|emb|Z78454.1|PFZ78454\n",
      "Name: gi|2765579|emb|Z78454.1|PFZ78454\n",
      "Description: gi|2765579|emb|Z78454.1|PFZ78454 P.fowliei 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...AAC', SingleLetterAlphabet())\n",
      "ID: gi|2765578|emb|Z78453.1|PSZ78453\n",
      "Name: gi|2765578|emb|Z78453.1|PSZ78453\n",
      "Description: gi|2765578|emb|Z78453.1|PSZ78453 P.schoseri 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...GCA', SingleLetterAlphabet())\n",
      "ID: gi|2765577|emb|Z78452.1|PBZ78452\n",
      "Name: gi|2765577|emb|Z78452.1|PBZ78452\n",
      "Description: gi|2765577|emb|Z78452.1|PBZ78452 P.bougainvilleanum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...GCA', SingleLetterAlphabet())\n",
      "ID: gi|2765576|emb|Z78451.1|PHZ78451\n",
      "Name: gi|2765576|emb|Z78451.1|PHZ78451\n",
      "Description: gi|2765576|emb|Z78451.1|PHZ78451 P.hookerae 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGTACCTCCGGAAGGATCATTGTTGAGATCACAT...AGC', SingleLetterAlphabet())\n",
      "ID: gi|2765575|emb|Z78450.1|PPZ78450\n",
      "Name: gi|2765575|emb|Z78450.1|PPZ78450\n",
      "Description: gi|2765575|emb|Z78450.1|PPZ78450 P.papuanum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('GGAAGGATCATTGCTGATATCACATAATAATTGATCGAGTTAAGCTGGAGGATC...GAG', SingleLetterAlphabet())\n",
      "ID: gi|2765574|emb|Z78449.1|PMZ78449\n",
      "Name: gi|2765574|emb|Z78449.1|PMZ78449\n",
      "Description: gi|2765574|emb|Z78449.1|PMZ78449 P.mastersianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...TGC', SingleLetterAlphabet())\n",
      "ID: gi|2765573|emb|Z78448.1|PAZ78448\n",
      "Name: gi|2765573|emb|Z78448.1|PAZ78448\n",
      "Description: gi|2765573|emb|Z78448.1|PAZ78448 P.argus 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...AGG', SingleLetterAlphabet())\n",
      "ID: gi|2765572|emb|Z78447.1|PVZ78447\n",
      "Name: gi|2765572|emb|Z78447.1|PVZ78447\n",
      "Description: gi|2765572|emb|Z78447.1|PVZ78447 P.venustum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGATTCCGTAGGTGAACCTGCGGGAGGATCATTGTTGAGATCACAT...AGC', SingleLetterAlphabet())\n",
      "ID: gi|2765571|emb|Z78446.1|PAZ78446\n",
      "Name: gi|2765571|emb|Z78446.1|PAZ78446\n",
      "Description: gi|2765571|emb|Z78446.1|PAZ78446 P.acmodontum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTCCGGAAGGATCATTGTTGAGATCACAT...CCC', SingleLetterAlphabet())\n",
      "ID: gi|2765570|emb|Z78445.1|PUZ78445\n",
      "Name: gi|2765570|emb|Z78445.1|PUZ78445\n",
      "Description: gi|2765570|emb|Z78445.1|PUZ78445 P.urbanianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...TGT', SingleLetterAlphabet())\n",
      "ID: gi|2765569|emb|Z78444.1|PAZ78444\n",
      "Name: gi|2765569|emb|Z78444.1|PAZ78444\n",
      "Description: gi|2765569|emb|Z78444.1|PAZ78444 P.appletonianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGGTGAACTGCGGAAGGATCATTGTTGAGATCACAT...ATT', SingleLetterAlphabet())\n",
      "ID: gi|2765568|emb|Z78443.1|PLZ78443\n",
      "Name: gi|2765568|emb|Z78443.1|PLZ78443\n",
      "Description: gi|2765568|emb|Z78443.1|PLZ78443 P.lawrenceanum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...AGG', SingleLetterAlphabet())\n",
      "ID: gi|2765567|emb|Z78442.1|PBZ78442\n",
      "Name: gi|2765567|emb|Z78442.1|PBZ78442\n",
      "Description: gi|2765567|emb|Z78442.1|PBZ78442 P.bullenianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('GTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACATAATAATTGATCGAGT...AGT', SingleLetterAlphabet())\n",
      "ID: gi|2765566|emb|Z78441.1|PSZ78441\n",
      "Name: gi|2765566|emb|Z78441.1|PSZ78441\n",
      "Description: gi|2765566|emb|Z78441.1|PSZ78441 P.superbiens 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('GGAAGGTCATTGCCGATATCACATAATAATTGATCGAGTTAATCTGGAGGATCT...GAG', SingleLetterAlphabet())\n",
      "ID: gi|2765565|emb|Z78440.1|PPZ78440\n",
      "Name: gi|2765565|emb|Z78440.1|PPZ78440\n",
      "Description: gi|2765565|emb|Z78440.1|PPZ78440 P.purpuratum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGGACCTCCGGGAGGATCATTGTTGAGATCACAT...GCA', SingleLetterAlphabet())\n",
      "ID: gi|2765564|emb|Z78439.1|PBZ78439\n",
      "Name: gi|2765564|emb|Z78439.1|PBZ78439\n",
      "Description: gi|2765564|emb|Z78439.1|PBZ78439 P.barbatum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Number of features: 0\n",
      "Seq('CATTGTTGAGATCACATAATAATTGATCGAGTTAATCTGGAGGATCTGTTTACT...GCC', SingleLetterAlphabet())\n"
     ]
    }
   ],
   "source": [
    "records = [seq_record for seq_record in SeqIO.parse(\"ls_orchid.fasta\", \"fasta\")]\n",
    "\n",
    "for record in records:\n",
    "    print(record)"
   ]
  },
  {
   "cell_type": "markdown",
   "metadata": {},
   "source": [
    "Outra forma de criar uma lista de SeqRecords é fazendo um casting para lista."
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 1,
   "metadata": {},
   "outputs": [
    {
     "name": "stdout",
     "output_type": "stream",
     "text": [
      "<class 'list'>\n",
      "Found 94 records\n",
      "The last record\n",
      "gi|2765564|emb|Z78439.1|PBZ78439\n",
      "CATTGTTGAGATCACATAATAATTGATCGAGTTAATCTGGAGGATCTGTTTACTTTGGTCACCCATGGGCATTTGCTGTTGAAGTGACCTAGATTTGCCATCGAGCCTCCTTGGGAGCTTTCTTGTTGGCGAGATCTAAACCCCTGCCCGGCGGAGTTGGGCGCCAAGTCATATGACACATAATTGGTGAAGGGGGTGGTAATCCTGCCCTGACCCTCCCCAAATTATTTTTTTAACAACTCTCAGCAACGGATATCTCGGCTCTTGCATCGATGAAGAACGCAGCGAAATGCGATAATGGTGTGAATTGCAGAATCCCGTGAACATCGAGTCTTTGAACGCAAGTTGCGCCCGAGGCCATCAGGCCAAGGGCACGCCTGCCTGGGCATTGCGAGTCATATCTCTCCCTTAATGAGGCTGTCCATACATACTGTTCAGCCGGTGCGGATGTGAGTTTGGCCCCTTGTTCTTTGGTACGGGGGGTCTAAGAGCTGCATGGGCTTTGGATGGTCCTAAATACGGAAAGAGGTGGACGAACTATGCTACAACAAAATTGTTGTGCAAATGCCCCGGTTGGCCGTTTAGTTGGGCC\n",
      "592\n",
      "The first record\n",
      "gi|2765658|emb|Z78533.1|CIZ78533\n",
      "CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGATGAGACCGTGGAATAAACGATCGAGTGAATCCGGAGGACCGGTGTACTCAGCTCACCGGGGGCATTGCTCCCGTGGTGACCCTGATTTGTTGTTGGGCCGCCTCGGGAGCGTCCATGGCGGGTTTGAACCTCTAGCCCGGCGCAGTTTGGGCGCCAAGCCATATGAAAGCATCACCGGCGAATGGCATTGTCTTCCCCAAAACCCGGAGCGGCGGCGTGCTGTCGCGTGCCCAATGAATTTTGATGACTCTCGCAAACGGGAATCTTGGCTCTTTGCATCGGATGGAAGGACGCAGCGAAATGCGATAAGTGGTGTGAATTGCAAGATCCCGTGAACCATCGAGTCTTTTGAACGCAAGTTGCGCCCGAGGCCATCAGGCTAAGGGCACGCCTGCTTGGGCGTCGCGCTTCGTCTCTCTCCTGCCAATGCTTGCCCGGCATACAGCCAGGCCGGCGTGGTGCGGATGTGAAAGATTGGCCCCTTGTGCCTAGGTGCGGCGGGTCCAAGAGCTGGTGTTTTGATGGCCCGGAACCCGGCAAGAGGTGGACGGATGCTGGCAGCAGCTGCCGTGCGAATCCCCCATGTTGTCGTGCTTGTCGGACAGGCAGGAGAACCCTTCCGAACCCCAATGGAGGGCGGTTGACCGCCATTCGGATGTGACCCCAGGTCAGGCGGGGGCACCCGCTGAGTTTACGC\n",
      "740\n"
     ]
    }
   ],
   "source": [
    "from Bio import SeqIO\n",
    "records = list(SeqIO.parse(\"ls_orchid.fasta\", \"fasta\"))\n",
    "print (type(records))\n",
    "\n",
    "print(f\"Found {len(records)} records\")\n",
    "\n",
    "print(\"The last record\")\n",
    "last_record = records[-1] #using Python's list tricks\n",
    "print(last_record.id)\n",
    "print(last_record.seq)\n",
    "print(len(last_record))\n",
    "\n",
    "print(\"The first record\")\n",
    "first_record = records[0] #remember, Python counts from zero\n",
    "print(first_record.id)\n",
    "print(first_record.seq)\n",
    "print(len(first_record))"
   ]
  },
  {
   "cell_type": "markdown",
   "metadata": {},
   "source": [
    "### 3.3 Parser para o formato do GenBank\n",
    "\n",
    "Apesar do arquivo FASTA ser um dos formatos mais práticos na bioinformática, ele não necessariamente é o melhor. Por conta da sua simplicidade ele não contém diversas anotações que o formato Genbank do NCBI tem. Agora vamos dar uma olhada nele."
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 2,
   "metadata": {},
   "outputs": [
    {
     "name": "stdout",
     "output_type": "stream",
     "text": [
      "Id: Z78533.1\n",
      "Name: Z78533\n",
      "Description: C.irapeanum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:740](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:49711']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Cypripedium irapeanum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:740](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78533']\n",
      "sequence_version: 1\n",
      "gi: 2765658\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Cypripedium irapeanum\n",
      "organism: Cypripedium irapeanum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Cypripedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78532.1\n",
      "Name: Z78532\n",
      "Description: C.californicum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:753](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53039']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Cypripedium californicum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:753](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78532']\n",
      "sequence_version: 1\n",
      "gi: 2765657\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Cypripedium californicum\n",
      "organism: Cypripedium californicum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Cypripedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78531.1\n",
      "Name: Z78531\n",
      "Description: C.fasciculatum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:748](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53040']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Cypripedium fasciculatum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:748](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78531']\n",
      "sequence_version: 1\n",
      "gi: 2765656\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Cypripedium fasciculatum\n",
      "organism: Cypripedium fasciculatum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Cypripedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78530.1\n",
      "Name: Z78530\n",
      "Description: C.margaritaceum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:744](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53047']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Cypripedium margaritaceum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:744](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78530']\n",
      "sequence_version: 1\n",
      "gi: 2765655\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Cypripedium margaritaceum\n",
      "organism: Cypripedium margaritaceum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Cypripedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78529.1\n",
      "Name: Z78529\n",
      "Description: C.lichiangense 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:733](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53045']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Cypripedium lichiangense']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:733](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78529']\n",
      "sequence_version: 1\n",
      "gi: 2765654\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Cypripedium lichiangense\n",
      "organism: Cypripedium lichiangense\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Cypripedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78527.1\n",
      "Name: Z78527\n",
      "Description: C.yatabeanum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:718](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53053']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Cypripedium yatabeanum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:718](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78527']\n",
      "sequence_version: 1\n",
      "gi: 2765652\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Cypripedium yatabeanum\n",
      "organism: Cypripedium yatabeanum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Cypripedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78526.1\n",
      "Name: Z78526\n",
      "Description: C.guttatum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:730](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53043']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Cypripedium guttatum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:730](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78526']\n",
      "sequence_version: 1\n",
      "gi: 2765651\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Cypripedium guttatum\n",
      "organism: Cypripedium guttatum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Cypripedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78525.1\n",
      "Name: Z78525\n",
      "Description: C.acaule 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:704](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:38191']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Cypripedium acaule']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:704](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78525']\n",
      "sequence_version: 1\n",
      "gi: 2765650\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Cypripedium acaule (pink lady's slipper)\n",
      "organism: Cypripedium acaule\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Cypripedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78524.1\n",
      "Name: Z78524\n",
      "Description: C.formosanum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:740](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53042']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Cypripedium formosanum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:740](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78524']\n",
      "sequence_version: 1\n",
      "gi: 2765649\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Cypripedium formosanum\n",
      "organism: Cypripedium formosanum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Cypripedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78523.1\n",
      "Name: Z78523\n",
      "Description: C.himalaicum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:709](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53044']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Cypripedium himalaicum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:709](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78523']\n",
      "sequence_version: 1\n",
      "gi: 2765648\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Cypripedium himalaicum\n",
      "organism: Cypripedium himalaicum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Cypripedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78522.1\n",
      "Name: Z78522\n",
      "Description: C.macranthum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:700](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53046']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Cypripedium macranthon']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:700](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78522']\n",
      "sequence_version: 1\n",
      "gi: 2765647\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Cypripedium macranthon\n",
      "organism: Cypripedium macranthon\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Cypripedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78521.1\n",
      "Name: Z78521\n",
      "Description: C.calceolus 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:726](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53038']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Cypripedium calceolus']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:726](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78521']\n",
      "sequence_version: 1\n",
      "gi: 2765646\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Cypripedium calceolus\n",
      "organism: Cypripedium calceolus\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Cypripedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78520.1\n",
      "Name: Z78520\n",
      "Description: C.segawai 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:753](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53052']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Cypripedium segawai']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:753](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78520']\n",
      "sequence_version: 1\n",
      "gi: 2765645\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Cypripedium segawai\n",
      "organism: Cypripedium segawai\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Cypripedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78519.1\n",
      "Name: Z78519\n",
      "Description: C.pubescens 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:699](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53050']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Cypripedium parviflorum var. pubescens']\n",
      "    Key: variety, Value: ['pubescens']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:699](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78519']\n",
      "sequence_version: 1\n",
      "gi: 2765644\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Cypripedium parviflorum var. pubescens\n",
      "organism: Cypripedium parviflorum var. pubescens\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Cypripedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78518.1\n",
      "Name: Z78518\n",
      "Description: C.reginae 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:658](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53051']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Cypripedium reginae']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:658](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78518']\n",
      "sequence_version: 1\n",
      "gi: 2765643\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Cypripedium reginae\n",
      "organism: Cypripedium reginae\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Cypripedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78517.1\n",
      "Name: Z78517\n",
      "Description: C.flavum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:752](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53041']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Cypripedium flavum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:752](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78517']\n",
      "sequence_version: 1\n",
      "gi: 2765642\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Cypripedium flavum\n",
      "organism: Cypripedium flavum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Cypripedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78516.1\n",
      "Name: Z78516\n",
      "Description: C.passerinum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:726](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53048']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Cypripedium passerinum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:726](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78516']\n",
      "sequence_version: 1\n",
      "gi: 2765641\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Cypripedium passerinum\n",
      "organism: Cypripedium passerinum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Cypripedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78515.1\n",
      "Name: Z78515\n",
      "Description: M.xerophyticum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:765](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53063']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Mexipedium xerophyticum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:765](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78515']\n",
      "sequence_version: 1\n",
      "gi: 2765640\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Mexipedium xerophyticum\n",
      "organism: Mexipedium xerophyticum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Mexipedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78514.1\n",
      "Name: Z78514\n",
      "Description: P.schlimii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:755](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53137']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Phragmipedium schlimii']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:755](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78514']\n",
      "sequence_version: 1\n",
      "gi: 2765639\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Phragmipedium schlimii\n",
      "organism: Phragmipedium schlimii\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Phragmipedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78513.1\n",
      "Name: Z78513\n",
      "Description: P.besseae 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:742](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53125']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Phragmipedium besseae']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:742](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78513']\n",
      "sequence_version: 1\n",
      "gi: 2765638\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Phragmipedium besseae\n",
      "organism: Phragmipedium besseae\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Phragmipedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78512.1\n",
      "Name: Z78512\n",
      "Description: P.wallisii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:762](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53138']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Phragmipedium wallisii']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:762](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78512']\n",
      "sequence_version: 1\n",
      "gi: 2765637\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Phragmipedium wallisii\n",
      "organism: Phragmipedium wallisii\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Phragmipedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78511.1\n",
      "Name: Z78511\n",
      "Description: P.exstaminodium 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:745](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53130']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Phragmipedium exstaminodium']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:745](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78511']\n",
      "sequence_version: 1\n",
      "gi: 2765636\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Phragmipedium exstaminodium\n",
      "organism: Phragmipedium exstaminodium\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Phragmipedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78510.1\n",
      "Name: Z78510\n",
      "Description: P.caricinum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:750](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53127']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Phragmipedium caricinum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:750](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78510']\n",
      "sequence_version: 1\n",
      "gi: 2765635\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Phragmipedium caricinum\n",
      "organism: Phragmipedium caricinum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Phragmipedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78509.1\n",
      "Name: Z78509\n",
      "Description: P.pearcei 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:731](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53135']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Phragmipedium pearcei']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:731](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78509']\n",
      "sequence_version: 1\n",
      "gi: 2765634\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Phragmipedium pearcei\n",
      "organism: Phragmipedium pearcei\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Phragmipedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78508.1\n",
      "Name: Z78508\n",
      "Description: P.longifolium 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:741](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53134']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Phragmipedium longifolium']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:741](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78508']\n",
      "sequence_version: 1\n",
      "gi: 2765633\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Phragmipedium longifolium\n",
      "organism: Phragmipedium longifolium\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Phragmipedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78507.1\n",
      "Name: Z78507\n",
      "Description: P.lindenii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:740](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53132']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Phragmipedium lindenii']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:740](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78507']\n",
      "sequence_version: 1\n",
      "gi: 2765632\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Phragmipedium lindenii\n",
      "organism: Phragmipedium lindenii\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Phragmipedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78506.1\n",
      "Name: Z78506\n",
      "Description: P.lindleyanum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:727](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53133']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Phragmipedium lindleyanum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:727](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78506']\n",
      "sequence_version: 1\n",
      "gi: 2765631\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Phragmipedium lindleyanum\n",
      "organism: Phragmipedium lindleyanum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Phragmipedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78505.1\n",
      "Name: Z78505\n",
      "Description: P.sargentianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:711](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53136']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Phragmipedium sargentianum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:711](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78505']\n",
      "sequence_version: 1\n",
      "gi: 2765630\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Phragmipedium sargentianum\n",
      "organism: Phragmipedium sargentianum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Phragmipedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78504.1\n",
      "Name: Z78504\n",
      "Description: P.kaiteurum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:743](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53131']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Phragmipedium kaiteurum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:743](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78504']\n",
      "sequence_version: 1\n",
      "gi: 2765629\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Phragmipedium kaiteurum\n",
      "organism: Phragmipedium kaiteurum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Phragmipedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78503.1\n",
      "Name: Z78503\n",
      "Description: P.czerwiakowianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:727](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53129']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Phragmipedium czerwiakowianum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:727](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78503']\n",
      "sequence_version: 1\n",
      "gi: 2765628\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Phragmipedium czerwiakowianum\n",
      "organism: Phragmipedium czerwiakowianum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Phragmipedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78502.1\n",
      "Name: Z78502\n",
      "Description: P.boissierianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:757](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53126']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Phragmipedium boissierianum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:757](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78502']\n",
      "sequence_version: 1\n",
      "gi: 2765627\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Phragmipedium boissierianum\n",
      "organism: Phragmipedium boissierianum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Phragmipedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78501.1\n",
      "Name: Z78501\n",
      "Description: P.caudatum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:770](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53128']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Phragmipedium caudatum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:770](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78501']\n",
      "sequence_version: 1\n",
      "gi: 2765626\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Phragmipedium caudatum\n",
      "organism: Phragmipedium caudatum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Phragmipedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78500.1\n",
      "Name: Z78500\n",
      "Description: P.warszewiczianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:767](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53139']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Phragmipedium warszewiczianum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:767](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78500']\n",
      "sequence_version: 1\n",
      "gi: 2765625\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Phragmipedium warszewiczianum\n",
      "organism: Phragmipedium warszewiczianum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Phragmipedium']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78499.1\n",
      "Name: Z78499\n",
      "Description: P.micranthum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:759](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53103']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum micranthum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:759](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78499']\n",
      "sequence_version: 1\n",
      "gi: 2765624\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum micranthum\n",
      "organism: Paphiopedilum micranthum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78498.1\n",
      "Name: Z78498\n",
      "Description: P.malipoense 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:750](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53101']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum malipoense']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:750](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78498']\n",
      "sequence_version: 1\n",
      "gi: 2765623\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum malipoense\n",
      "organism: Paphiopedilum malipoense\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78497.1\n",
      "Name: Z78497\n",
      "Description: P.delenatii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:788](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:78826']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum delenatii']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:788](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78497']\n",
      "sequence_version: 1\n",
      "gi: 2765622\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum delenatii\n",
      "organism: Paphiopedilum delenatii\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78496.1\n",
      "Name: Z78496\n",
      "Description: P.armeniacum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:774](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53069']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum armeniacum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:774](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78496']\n",
      "sequence_version: 1\n",
      "gi: 2765621\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum armeniacum\n",
      "organism: Paphiopedilum armeniacum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78495.1\n",
      "Name: Z78495\n",
      "Description: P.emersonii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:789](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53083']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum emersonii']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:789](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78495']\n",
      "sequence_version: 1\n",
      "gi: 2765620\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum emersonii\n",
      "organism: Paphiopedilum emersonii\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78494.1\n",
      "Name: Z78494\n",
      "Description: P.niveum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:688](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53104']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum niveum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:688](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78494']\n",
      "sequence_version: 1\n",
      "gi: 2765619\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum niveum\n",
      "organism: Paphiopedilum niveum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78493.1\n",
      "Name: Z78493\n",
      "Description: P.godefroyae 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:719](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53089']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum godefroyae']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:719](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78493']\n",
      "sequence_version: 1\n",
      "gi: 2765618\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum godefroyae\n",
      "organism: Paphiopedilum godefroyae\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78492.1\n",
      "Name: Z78492\n",
      "Description: P.bellatulum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:743](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:78825']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum bellatulum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:743](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78492']\n",
      "sequence_version: 1\n",
      "gi: 2765617\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum bellatulum\n",
      "organism: Paphiopedilum bellatulum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78491.1\n",
      "Name: Z78491\n",
      "Description: P.concolor 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:737](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53078']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum concolor']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:737](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78491']\n",
      "sequence_version: 1\n",
      "gi: 2765616\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum concolor\n",
      "organism: Paphiopedilum concolor\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78490.1\n",
      "Name: Z78490\n",
      "Description: P.fairrieanum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:728](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53085']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum fairrieanum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:728](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78490']\n",
      "sequence_version: 1\n",
      "gi: 2765615\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum fairrieanum\n",
      "organism: Paphiopedilum fairrieanum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78489.1\n",
      "Name: Z78489\n",
      "Description: P.druryi 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:740](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53082']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum druryi']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:740](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78489']\n",
      "sequence_version: 1\n",
      "gi: 2765614\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum druryi\n",
      "organism: Paphiopedilum druryi\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78488.1\n",
      "Name: Z78488\n",
      "Description: P.tigrinum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:696](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53117']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum tigrinum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:696](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78488']\n",
      "sequence_version: 1\n",
      "gi: 2765613\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum tigrinum\n",
      "organism: Paphiopedilum tigrinum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78487.1\n",
      "Name: Z78487\n",
      "Description: P.hirsutissimum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:732](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53094']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum hirsutissimum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:732](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78487']\n",
      "sequence_version: 1\n",
      "gi: 2765612\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum hirsutissimum\n",
      "organism: Paphiopedilum hirsutissimum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78486.1\n",
      "Name: Z78486\n",
      "Description: P.barbigerum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:731](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53071']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum barbigerum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:731](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78486']\n",
      "sequence_version: 1\n",
      "gi: 2765611\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum barbigerum\n",
      "organism: Paphiopedilum barbigerum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78485.1\n",
      "Name: Z78485\n",
      "Description: P.henryanum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:735](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53093']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum henryanum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:735](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78485']\n",
      "sequence_version: 1\n",
      "gi: 2765610\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum henryanum\n",
      "organism: Paphiopedilum henryanum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78484.1\n",
      "Name: Z78484\n",
      "Description: P.charlesworthii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:720](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53076']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum charlesworthii']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:720](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78484']\n",
      "sequence_version: 1\n",
      "gi: 2765609\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum charlesworthii\n",
      "organism: Paphiopedilum charlesworthii\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78483.1\n",
      "Name: Z78483\n",
      "Description: P.villosum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:740](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53122']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum villosum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:740](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78483']\n",
      "sequence_version: 1\n",
      "gi: 2765608\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum villosum\n",
      "organism: Paphiopedilum villosum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78482.1\n",
      "Name: Z78482\n",
      "Description: P.exul 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:629](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53084']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum exul']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:629](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78482']\n",
      "sequence_version: 1\n",
      "gi: 2765607\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum exul\n",
      "organism: Paphiopedilum exul\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78481.1\n",
      "Name: Z78481\n",
      "Description: P.insigne 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:572](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53096']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum insigne']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:572](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78481']\n",
      "sequence_version: 1\n",
      "gi: 2765606\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum insigne\n",
      "organism: Paphiopedilum insigne\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78480.1\n",
      "Name: Z78480\n",
      "Description: P.gratrixianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:587](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53090']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum gratrixianum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:587](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78480']\n",
      "sequence_version: 1\n",
      "gi: 2765605\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum gratrixianum\n",
      "organism: Paphiopedilum gratrixianum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78479.1\n",
      "Name: Z78479\n",
      "Description: P.primulinum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:700](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53108']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum primulinum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:700](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78479']\n",
      "sequence_version: 1\n",
      "gi: 2765604\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum primulinum\n",
      "organism: Paphiopedilum primulinum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78478.1\n",
      "Name: Z78478\n",
      "Description: P.victoria 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:636](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53121']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum victoria']\n",
      "    Key: sub_species, Value: ['regina']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:636](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78478']\n",
      "sequence_version: 1\n",
      "gi: 2765603\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum victoria\n",
      "organism: Paphiopedilum victoria\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78477.1\n",
      "Name: Z78477\n",
      "Description: P.victoria 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:716](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53121']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum victoria']\n",
      "    Key: sub_species, Value: ['mariae']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:716](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78477']\n",
      "sequence_version: 1\n",
      "gi: 2765602\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum victoria\n",
      "organism: Paphiopedilum victoria\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78476.1\n",
      "Name: Z78476\n",
      "Description: P.glaucophyllum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:592](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53088']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum glaucophyllum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:592](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78476']\n",
      "sequence_version: 1\n",
      "gi: 2765601\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum glaucophyllum\n",
      "organism: Paphiopedilum glaucophyllum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78475.1\n",
      "Name: Z78475\n",
      "Description: P.supardii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:716](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53115']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum supardii']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:716](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78475']\n",
      "sequence_version: 1\n",
      "gi: 2765600\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum supardii\n",
      "organism: Paphiopedilum supardii\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78474.1\n",
      "Name: Z78474\n",
      "Description: P.kolopakingii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:733](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53098']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum kolopakingii']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:733](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78474']\n",
      "sequence_version: 1\n",
      "gi: 2765599\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum kolopakingii\n",
      "organism: Paphiopedilum kolopakingii\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78473.1\n",
      "Name: Z78473\n",
      "Description: P.sanderianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:626](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53111']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum sanderianum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:626](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78473']\n",
      "sequence_version: 1\n",
      "gi: 2765598\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum sanderianum\n",
      "organism: Paphiopedilum sanderianum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78472.1\n",
      "Name: Z78472\n",
      "Description: P.lowii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:737](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53100']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum lowii']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:737](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78472']\n",
      "sequence_version: 1\n",
      "gi: 2765597\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum lowii\n",
      "organism: Paphiopedilum lowii\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78471.1\n",
      "Name: Z78471\n",
      "Description: P.dianthum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:740](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53081']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum dianthum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:740](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78471']\n",
      "sequence_version: 1\n",
      "gi: 2765596\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum dianthum\n",
      "organism: Paphiopedilum dianthum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78470.1\n",
      "Name: Z78470\n",
      "Description: P.parishii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:574](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53106']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum parishii']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:574](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78470']\n",
      "sequence_version: 1\n",
      "gi: 2765595\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum parishii\n",
      "organism: Paphiopedilum parishii\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78469.1\n",
      "Name: Z78469\n",
      "Description: P.haynaldianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:594](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53091']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum haynaldianum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:594](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78469']\n",
      "sequence_version: 1\n",
      "gi: 2765594\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum haynaldianum\n",
      "organism: Paphiopedilum haynaldianum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78468.1\n",
      "Name: Z78468\n",
      "Description: P.adductum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:610](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53066']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum adductum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:610](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78468']\n",
      "sequence_version: 1\n",
      "gi: 2765593\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum adductum\n",
      "organism: Paphiopedilum adductum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78467.1\n",
      "Name: Z78467\n",
      "Description: P.stonei 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:730](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53113']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum stonei']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:730](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78467']\n",
      "sequence_version: 1\n",
      "gi: 2765592\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum stonei\n",
      "organism: Paphiopedilum stonei\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78466.1\n",
      "Name: Z78466\n",
      "Description: P.philippinense 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:641](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53107']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum philippinense']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:641](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78466']\n",
      "sequence_version: 1\n",
      "gi: 2765591\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum philippinense\n",
      "organism: Paphiopedilum philippinense\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78465.1\n",
      "Name: Z78465\n",
      "Description: P.rothschildianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:702](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53110']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum rothschildianum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:702](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78465']\n",
      "sequence_version: 1\n",
      "gi: 2765590\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum rothschildianum\n",
      "organism: Paphiopedilum rothschildianum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78464.1\n",
      "Name: Z78464\n",
      "Description: P.glanduliferum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:733](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53087']\n",
      "    Key: isolate, Value: ['B']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum glanduliferum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:733](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78464']\n",
      "sequence_version: 1\n",
      "gi: 2765589\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum glanduliferum\n",
      "organism: Paphiopedilum glanduliferum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78463.1\n",
      "Name: Z78463\n",
      "Description: P.glanduliferum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:738](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53087']\n",
      "    Key: isolate, Value: ['A']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum glanduliferum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:738](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78463']\n",
      "sequence_version: 1\n",
      "gi: 2765588\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum glanduliferum\n",
      "organism: Paphiopedilum glanduliferum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78462.1\n",
      "Name: Z78462\n",
      "Description: P.sukhakulii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:736](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:78827']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum sukhakulii']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:736](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78462']\n",
      "sequence_version: 1\n",
      "gi: 2765587\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum sukhakulii\n",
      "organism: Paphiopedilum sukhakulii\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78461.1\n",
      "Name: Z78461\n",
      "Description: P.wardii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:732](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53123']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum wardii']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:732](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78461']\n",
      "sequence_version: 1\n",
      "gi: 2765586\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum wardii\n",
      "organism: Paphiopedilum wardii\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78460.1\n",
      "Name: Z78460\n",
      "Description: P.ciliolare 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:745](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53077']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum ciliolare']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:745](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78460']\n",
      "sequence_version: 1\n",
      "gi: 2765585\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum ciliolare\n",
      "organism: Paphiopedilum ciliolare\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78459.1\n",
      "Name: Z78459\n",
      "Description: P.dayanum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:744](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53079']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum dayanum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:744](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78459']\n",
      "sequence_version: 1\n",
      "gi: 2765584\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum dayanum\n",
      "organism: Paphiopedilum dayanum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78458.1\n",
      "Name: Z78458\n",
      "Description: P.hennisianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:738](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53092']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum hennisianum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:738](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78458']\n",
      "sequence_version: 1\n",
      "gi: 2765583\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum hennisianum\n",
      "organism: Paphiopedilum hennisianum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78457.1\n",
      "Name: Z78457\n",
      "Description: P.callosum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:739](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53075']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum callosum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:739](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78457']\n",
      "sequence_version: 1\n",
      "gi: 2765582\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum callosum\n",
      "organism: Paphiopedilum callosum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78456.1\n",
      "Name: Z78456\n",
      "Description: P.tonsum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:740](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53118']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum tonsum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:740](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78456']\n",
      "sequence_version: 1\n",
      "gi: 2765581\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum tonsum\n",
      "organism: Paphiopedilum tonsum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78455.1\n",
      "Name: Z78455\n",
      "Description: P.javanicum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:745](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53097']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum javanicum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:745](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78455']\n",
      "sequence_version: 1\n",
      "gi: 2765580\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum javanicum\n",
      "organism: Paphiopedilum javanicum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78454.1\n",
      "Name: Z78454\n",
      "Description: P.fowliei 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:695](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53086']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum fowliei']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:695](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78454']\n",
      "sequence_version: 1\n",
      "gi: 2765579\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum fowliei\n",
      "organism: Paphiopedilum fowliei\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78453.1\n",
      "Name: Z78453\n",
      "Description: P.schoseri 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:745](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53112']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum schoseri']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:745](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78453']\n",
      "sequence_version: 1\n",
      "gi: 2765578\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum schoseri\n",
      "organism: Paphiopedilum schoseri\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78452.1\n",
      "Name: Z78452\n",
      "Description: P.bougainvilleanum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:743](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53073']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum bougainvilleanum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:743](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78452']\n",
      "sequence_version: 1\n",
      "gi: 2765577\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum bougainvilleanum\n",
      "organism: Paphiopedilum bougainvilleanum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78451.1\n",
      "Name: Z78451\n",
      "Description: P.hookerae 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:730](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53095']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum hookerae']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:730](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78451']\n",
      "sequence_version: 1\n",
      "gi: 2765576\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum hookerae\n",
      "organism: Paphiopedilum hookerae\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78450.1\n",
      "Name: Z78450\n",
      "Description: P.papuanum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:706](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53105']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum papuanum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:706](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78450']\n",
      "sequence_version: 1\n",
      "gi: 2765575\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum papuanum\n",
      "organism: Paphiopedilum papuanum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78449.1\n",
      "Name: Z78449\n",
      "Description: P.mastersianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:744](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53102']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum mastersianum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:744](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78449']\n",
      "sequence_version: 1\n",
      "gi: 2765574\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum mastersianum\n",
      "organism: Paphiopedilum mastersianum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78448.1\n",
      "Name: Z78448\n",
      "Description: P.argus 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:742](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53068']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum argus']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:742](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78448']\n",
      "sequence_version: 1\n",
      "gi: 2765573\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum argus\n",
      "organism: Paphiopedilum argus\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78447.1\n",
      "Name: Z78447\n",
      "Description: P.venustum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:694](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53120']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum venustum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:694](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78447']\n",
      "sequence_version: 1\n",
      "gi: 2765572\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum venustum\n",
      "organism: Paphiopedilum venustum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78446.1\n",
      "Name: Z78446\n",
      "Description: P.acmodontum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:712](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53065']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum acmodontum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:712](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78446']\n",
      "sequence_version: 1\n",
      "gi: 2765571\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum acmodontum\n",
      "organism: Paphiopedilum acmodontum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78445.1\n",
      "Name: Z78445\n",
      "Description: P.urbanianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:715](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53119']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum urbanianum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:715](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78445']\n",
      "sequence_version: 1\n",
      "gi: 2765570\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum urbanianum\n",
      "organism: Paphiopedilum urbanianum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78444.1\n",
      "Name: Z78444\n",
      "Description: P.appletonianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:688](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53067']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum appletonianum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:688](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78444']\n",
      "sequence_version: 1\n",
      "gi: 2765569\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum appletonianum\n",
      "organism: Paphiopedilum appletonianum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78443.1\n",
      "Name: Z78443\n",
      "Description: P.lawrenceanum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:784](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53099']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum lawrenceanum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:784](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78443']\n",
      "sequence_version: 1\n",
      "gi: 2765568\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum lawrenceanum\n",
      "organism: Paphiopedilum lawrenceanum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78442.1\n",
      "Name: Z78442\n",
      "Description: P.bullenianum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:721](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53074']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum bullenianum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:721](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78442']\n",
      "sequence_version: 1\n",
      "gi: 2765567\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum bullenianum\n",
      "organism: Paphiopedilum bullenianum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78441.1\n",
      "Name: Z78441\n",
      "Description: P.superbiens 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:703](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53116']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum superbiens']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:703](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78441']\n",
      "sequence_version: 1\n",
      "gi: 2765566\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum superbiens\n",
      "organism: Paphiopedilum superbiens\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78440.1\n",
      "Name: Z78440\n",
      "Description: P.purpuratum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:744](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53109']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum purpuratum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:744](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78440']\n",
      "sequence_version: 1\n",
      "gi: 2765565\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum purpuratum\n",
      "organism: Paphiopedilum purpuratum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n",
      "Id: Z78439.1\n",
      "Name: Z78439\n",
      "Description: P.barbatum 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "type: source\n",
      "location: [0:592](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['taxon:53070']\n",
      "    Key: mol_type, Value: ['genomic DNA']\n",
      "    Key: organism, Value: ['Paphiopedilum barbatum']\n",
      "\n",
      "type: misc_feature\n",
      "location: [0:380](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 1']\n",
      "\n",
      "type: gene\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "\n",
      "type: rRNA\n",
      "location: [380:550](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['5.8S rRNA']\n",
      "    Key: product, Value: ['5.8S ribosomal RNA']\n",
      "\n",
      "type: misc_feature\n",
      "location: [550:592](+)\n",
      "qualifiers:\n",
      "    Key: note, Value: ['internal transcribed spacer 2']\n",
      "\n",
      "molecule_type: DNA\n",
      "topology: linear\n",
      "data_file_division: PLN\n",
      "date: 30-NOV-2006\n",
      "accessions: ['Z78439']\n",
      "sequence_version: 1\n",
      "gi: 2765564\n",
      "keywords: ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']\n",
      "source: Paphiopedilum barbatum\n",
      "organism: Paphiopedilum barbatum\n",
      "taxonomy: ['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Cypripedioideae', 'Paphiopedilum']\n",
      "references: [Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae: Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct Submission', ...)]\n",
      "----------------------------------------------------------------------------------------------------\n",
      "\n"
     ]
    }
   ],
   "source": [
    "records = SeqIO.parse(\"ls_orchid.gbk\", \"genbank\")\n",
    "for record in records:\n",
    "    print(f\"Id: {record.id}\")\n",
    "    print(f\"Name: {record.name}\")\n",
    "    print(f\"Description: {record.description}\")\n",
    "    for feature in record.features:\n",
    "        print(feature)\n",
    "    for annotation in record.annotations:\n",
    "        print(f\"{annotation}: {record.annotations[annotation]}\")\n",
    "        \n",
    "    print(\"-\"*100+\"\\n\")"
   ]
  },
  {
   "cell_type": "markdown",
   "metadata": {},
   "source": [
    "Com as informações todas separadas na forma de atributos fica muito mas fácil acessa-las e criar, por exemplo, uma lista de organismos que estão presentes nas sequências:"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 7,
   "metadata": {},
   "outputs": [
    {
     "name": "stdout",
     "output_type": "stream",
     "text": [
      "['Cypripedium irapeanum', 'Cypripedium californicum', 'Cypripedium fasciculatum', 'Cypripedium margaritaceum', 'Cypripedium lichiangense', 'Cypripedium yatabeanum', 'Cypripedium guttatum', 'Cypripedium acaule', 'Cypripedium formosanum', 'Cypripedium himalaicum', 'Cypripedium macranthon', 'Cypripedium calceolus', 'Cypripedium segawai', 'Cypripedium parviflorum var. pubescens', 'Cypripedium reginae', 'Cypripedium flavum', 'Cypripedium passerinum', 'Mexipedium xerophyticum', 'Phragmipedium schlimii', 'Phragmipedium besseae', 'Phragmipedium wallisii', 'Phragmipedium exstaminodium', 'Phragmipedium caricinum', 'Phragmipedium pearcei', 'Phragmipedium longifolium', 'Phragmipedium lindenii', 'Phragmipedium lindleyanum', 'Phragmipedium sargentianum', 'Phragmipedium kaiteurum', 'Phragmipedium czerwiakowianum', 'Phragmipedium boissierianum', 'Phragmipedium caudatum', 'Phragmipedium warszewiczianum', 'Paphiopedilum micranthum', 'Paphiopedilum malipoense', 'Paphiopedilum delenatii', 'Paphiopedilum armeniacum', 'Paphiopedilum emersonii', 'Paphiopedilum niveum', 'Paphiopedilum godefroyae', 'Paphiopedilum bellatulum', 'Paphiopedilum concolor', 'Paphiopedilum fairrieanum', 'Paphiopedilum druryi', 'Paphiopedilum tigrinum', 'Paphiopedilum hirsutissimum', 'Paphiopedilum barbigerum', 'Paphiopedilum henryanum', 'Paphiopedilum charlesworthii', 'Paphiopedilum villosum', 'Paphiopedilum exul', 'Paphiopedilum insigne', 'Paphiopedilum gratrixianum', 'Paphiopedilum primulinum', 'Paphiopedilum victoria', 'Paphiopedilum victoria', 'Paphiopedilum glaucophyllum', 'Paphiopedilum supardii', 'Paphiopedilum kolopakingii', 'Paphiopedilum sanderianum', 'Paphiopedilum lowii', 'Paphiopedilum dianthum', 'Paphiopedilum parishii', 'Paphiopedilum haynaldianum', 'Paphiopedilum adductum', 'Paphiopedilum stonei', 'Paphiopedilum philippinense', 'Paphiopedilum rothschildianum', 'Paphiopedilum glanduliferum', 'Paphiopedilum glanduliferum', 'Paphiopedilum sukhakulii', 'Paphiopedilum wardii', 'Paphiopedilum ciliolare', 'Paphiopedilum dayanum', 'Paphiopedilum hennisianum', 'Paphiopedilum callosum', 'Paphiopedilum tonsum', 'Paphiopedilum javanicum', 'Paphiopedilum fowliei', 'Paphiopedilum schoseri', 'Paphiopedilum bougainvilleanum', 'Paphiopedilum hookerae', 'Paphiopedilum papuanum', 'Paphiopedilum mastersianum', 'Paphiopedilum argus', 'Paphiopedilum venustum', 'Paphiopedilum acmodontum', 'Paphiopedilum urbanianum', 'Paphiopedilum appletonianum', 'Paphiopedilum lawrenceanum', 'Paphiopedilum bullenianum', 'Paphiopedilum superbiens', 'Paphiopedilum purpuratum', 'Paphiopedilum barbatum']\n"
     ]
    }
   ],
   "source": [
    "records = SeqIO.parse(\"ls_orchid.gbk\", \"genbank\")\n",
    "all_species = [record.annotations[\"organism\"] for record in records]\n",
    "print(all_species)"
   ]
  },
  {
   "cell_type": "markdown",
   "metadata": {},
   "source": [
    "### 3.4 SeqIO to Dict\n",
    "\n",
    "Uma outra alternativa é transforma o Generator em dicionário usando o método do SeqIO to_dict(). Ao invés de criar uma lista ele cria um dicionário e por padrão ele usa o id de cada SeqRecord como chave do dicionário. Esse método facilita muito o acesso direto as sequências de interesse, porém ao mesmo tempo aumentos muito o uso de memória, então deve ser usado com precaução."
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 6,
   "metadata": {},
   "outputs": [
    {
     "data": {
      "text/plain": [
       "94"
      ]
     },
     "execution_count": 6,
     "metadata": {},
     "output_type": "execute_result"
    }
   ],
   "source": [
    "orchid_dict = SeqIO.to_dict(SeqIO.parse(\"ls_orchid.gbk\", \"genbank\"))\n",
    "len(orchid_dict)"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 16,
   "metadata": {
    "scrolled": false
   },
   "outputs": [
    {
     "data": {
      "text/plain": [
       "['Z78533.1',\n",
       " 'Z78532.1',\n",
       " 'Z78531.1',\n",
       " 'Z78530.1',\n",
       " 'Z78529.1',\n",
       " 'Z78527.1',\n",
       " 'Z78526.1',\n",
       " 'Z78525.1',\n",
       " 'Z78524.1',\n",
       " 'Z78523.1',\n",
       " 'Z78522.1',\n",
       " 'Z78521.1',\n",
       " 'Z78520.1',\n",
       " 'Z78519.1',\n",
       " 'Z78518.1',\n",
       " 'Z78517.1',\n",
       " 'Z78516.1',\n",
       " 'Z78515.1',\n",
       " 'Z78514.1',\n",
       " 'Z78513.1',\n",
       " 'Z78512.1',\n",
       " 'Z78511.1',\n",
       " 'Z78510.1',\n",
       " 'Z78509.1',\n",
       " 'Z78508.1',\n",
       " 'Z78507.1',\n",
       " 'Z78506.1',\n",
       " 'Z78505.1',\n",
       " 'Z78504.1',\n",
       " 'Z78503.1',\n",
       " 'Z78502.1',\n",
       " 'Z78501.1',\n",
       " 'Z78500.1',\n",
       " 'Z78499.1',\n",
       " 'Z78498.1',\n",
       " 'Z78497.1',\n",
       " 'Z78496.1',\n",
       " 'Z78495.1',\n",
       " 'Z78494.1',\n",
       " 'Z78493.1',\n",
       " 'Z78492.1',\n",
       " 'Z78491.1',\n",
       " 'Z78490.1',\n",
       " 'Z78489.1',\n",
       " 'Z78488.1',\n",
       " 'Z78487.1',\n",
       " 'Z78486.1',\n",
       " 'Z78485.1',\n",
       " 'Z78484.1',\n",
       " 'Z78483.1',\n",
       " 'Z78482.1',\n",
       " 'Z78481.1',\n",
       " 'Z78480.1',\n",
       " 'Z78479.1',\n",
       " 'Z78478.1',\n",
       " 'Z78477.1',\n",
       " 'Z78476.1',\n",
       " 'Z78475.1',\n",
       " 'Z78474.1',\n",
       " 'Z78473.1',\n",
       " 'Z78472.1',\n",
       " 'Z78471.1',\n",
       " 'Z78470.1',\n",
       " 'Z78469.1',\n",
       " 'Z78468.1',\n",
       " 'Z78467.1',\n",
       " 'Z78466.1',\n",
       " 'Z78465.1',\n",
       " 'Z78464.1',\n",
       " 'Z78463.1',\n",
       " 'Z78462.1',\n",
       " 'Z78461.1',\n",
       " 'Z78460.1',\n",
       " 'Z78459.1',\n",
       " 'Z78458.1',\n",
       " 'Z78457.1',\n",
       " 'Z78456.1',\n",
       " 'Z78455.1',\n",
       " 'Z78454.1',\n",
       " 'Z78453.1',\n",
       " 'Z78452.1',\n",
       " 'Z78451.1',\n",
       " 'Z78450.1',\n",
       " 'Z78449.1',\n",
       " 'Z78448.1',\n",
       " 'Z78447.1',\n",
       " 'Z78446.1',\n",
       " 'Z78445.1',\n",
       " 'Z78444.1',\n",
       " 'Z78443.1',\n",
       " 'Z78442.1',\n",
       " 'Z78441.1',\n",
       " 'Z78440.1',\n",
       " 'Z78439.1']"
      ]
     },
     "execution_count": 16,
     "metadata": {},
     "output_type": "execute_result"
    }
   ],
   "source": [
    "list(orchid_dict.keys())"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 8,
   "metadata": {},
   "outputs": [
    {
     "data": {
      "text/plain": [
       "[SeqRecord(seq=Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGATGAGACCGTGG...CGC', IUPACAmbiguousDNA()), id='Z78533.1', name='Z78533', description='C.irapeanum 5.8S rRNA gene and ITS1 and ITS2 DNA', dbxrefs=[]),\n",
       " SeqRecord(seq=Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACAACAG...GGC', IUPACAmbiguousDNA()), id='Z78532.1', name='Z78532', description='C.californicum 5.8S rRNA gene and ITS1 and ITS2 DNA', dbxrefs=[]),\n",
       " SeqRecord(seq=Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGACAGCAG...TAA', IUPACAmbiguousDNA()), id='Z78531.1', name='Z78531', description='C.fasciculatum 5.8S rRNA gene and ITS1 and ITS2 DNA', dbxrefs=[]),\n",
       " SeqRecord(seq=Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAAACAACAT...CAT', IUPACAmbiguousDNA()), id='Z78530.1', name='Z78530', description='C.margaritaceum 5.8S rRNA gene and ITS1 and ITS2 DNA', dbxrefs=[]),\n",
       " SeqRecord(seq=Seq('ACGGCGAGCTGCCGAAGGACATTGTTGAGACAGCAGAATATACGATTGAGTGAA...AAA', IUPACAmbiguousDNA()), id='Z78529.1', name='Z78529', description='C.lichiangense 5.8S rRNA gene and ITS1 and ITS2 DNA', dbxrefs=[])]"
      ]
     },
     "execution_count": 8,
     "metadata": {},
     "output_type": "execute_result"
    }
   ],
   "source": [
    "list(orchid_dict.values())[:5]"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 9,
   "metadata": {},
   "outputs": [
    {
     "name": "stdout",
     "output_type": "stream",
     "text": [
      "P.supardii 5.8S rRNA gene and ITS1 and ITS2 DNA\n",
      "Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...GGT', IUPACAmbiguousDNA())\n"
     ]
    }
   ],
   "source": [
    "record = orchid_dict[\"Z78475.1\"]\n",
    "print(record.description)\n",
    "print(repr(record.seq))"
   ]
  },
  {
   "cell_type": "markdown",
   "metadata": {},
   "source": [
    "### 3.5 Escrevendo SeqRecords em arquivo\n",
    "\n",
    "Da mesma forma que o SeqIO nos permite ler um arquivo ele também permite que escrevamos um arquivo com nossos SeqRecords. Para exemplificar vamos criar três SeqRecords e junta-los em uma lista. Em seguida vamos utilizar o método write() do SeqIO para escrever as sequências em um arquivo no formato FASTA."
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 10,
   "metadata": {},
   "outputs": [],
   "source": [
    "from Bio.Seq import Seq\n",
    "from Bio.SeqRecord import SeqRecord\n",
    "from Bio.Alphabet import generic_protein\n",
    "\n",
    "rec1 = SeqRecord(Seq(\"MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSETHLDSMVGQALFGD\" \\\n",
    "                    +\"GAGAVIVGSDPDLSVERPLYELVWTGATLLPDSEGAIDGHLREVGLTFHLLKDVPGLISK\" \\\n",
    "                    +\"NIEKSLKEAFTPLGISDWNSTFWIAHPGGPAILDQVEAKLGLKEEKMRATREVLSEYGNM\" \\\n",
    "                    +\"SSAC\", generic_protein),\n",
    "                 id=\"gi|14150838|gb|AAK54648.1|AF376133_1\",\n",
    "                 description=\"chalcone synthase [Cucumis sativus]\")\n",
    "\n",
    "rec2 = SeqRecord(Seq(\"YPDYYFRITNREHKAELKEKFQRMCDKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQ\" \\\n",
    "                    +\"DMVVVEIPKLGKEAAVKAIKEWGQ\", generic_protein),\n",
    "                 id=\"gi|13919613|gb|AAK33142.1|\",\n",
    "                 description=\"chalcone synthase [Fragaria vesca subsp. bracteata]\")\n",
    "\n",
    "rec3 = SeqRecord(Seq(\"MVTVEEFRRAQCAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC\" \\\n",
    "                    +\"EKSMIKKRYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP\" \\\n",
    "                    +\"KSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN\" \\\n",
    "                    +\"NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIIGSDPIPEVERPLFELV\" \\\n",
    "                    +\"SAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFW\" \\\n",
    "                    +\"IAHPGGPAILDQVELKLGLKQEKLKATRKVLSNYGNMSSACVLFILDEMRKASAKEGLGT\" \\\n",
    "                    +\"TGEGLEWGVLFGFGPGLTVETVVLHSVAT\", generic_protein),\n",
    "                 id=\"gi|13925890|gb|AAK49457.1|\",\n",
    "                 description=\"chalcone synthase [Nicotiana tabacum]\")\n",
    "\n",
    "my_records = [rec1, rec2, rec3]"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 11,
   "metadata": {},
   "outputs": [
    {
     "data": {
      "text/plain": [
       "3"
      ]
     },
     "execution_count": 11,
     "metadata": {},
     "output_type": "execute_result"
    }
   ],
   "source": [
    "from Bio import SeqIO\n",
    "SeqIO.write(my_records, \"minhas_proteinas.fa\", \"fasta\")"
   ]
  },
  {
   "cell_type": "markdown",
   "metadata": {},
   "source": [
    "Em seguida vamos abrir esse arquivo e verificar se as sequências foram escritas de maneira correta."
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 12,
   "metadata": {},
   "outputs": [
    {
     "name": "stdout",
     "output_type": "stream",
     "text": [
      "gi|14150838|gb|AAK54648.1|AF376133_1\n",
      "MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSETHLDSMVGQALFGDGAGAVIVGSDPDLSVERPLYELVWTGATLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFTPLGISDWNSTFWIAHPGGPAILDQVEAKLGLKEEKMRATREVLSEYGNMSSAC\n",
      "184\n",
      "gi|13919613|gb|AAK33142.1|\n",
      "YPDYYFRITNREHKAELKEKFQRMCDKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQ\n",
      "84\n",
      "gi|13925890|gb|AAK49457.1|\n",
      "MVTVEEFRRAQCAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCEKSMIKKRYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIIGSDPIPEVERPLFELVSAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGPAILDQVELKLGLKQEKLKATRKVLSNYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEWGVLFGFGPGLTVETVVLHSVAT\n",
      "389\n"
     ]
    }
   ],
   "source": [
    "for record in SeqIO.parse(\"minhas_proteinas.fa\", \"fasta\"):\n",
    "    print(record.id)\n",
    "    print(record.seq)\n",
    "    print(len(record))"
   ]
  },
  {
   "cell_type": "markdown",
   "metadata": {},
   "source": [
    "### Exercício 5\n",
    "Abra o arquivo `ls_orchid.gbk` e para todos os records que forem da espécie `Paphiopedilum concolor` salve o record em um arquivo fasta utilizando o comando `SeqIO.write` e nome do arquivo `Pconcolor.fa`. "
   ]
  },
  {
   "cell_type": "code",
   "execution_count": null,
   "metadata": {},
   "outputs": [],
   "source": [
    "from Bio import SeqIO\n",
    "records = SeqIO.parse(\"ls_orchid.gbk\", \"genbank\")\n",
    "my_records = []\n",
    "for record in records:\n",
    "    \n",
    "        \n",
    "SeqIO.write(my_records, \"Pconcolor.fa\", \"fasta\")"
   ]
  },
  {
   "cell_type": "markdown",
   "metadata": {},
   "source": [
    "## 4 Recuperando sequências direto do NCBI\n",
    "\n",
    "Se a sequência que vocês está trabalhando está no NCBI, você pode recupera-la diretamento da web pelo id. Depois de importar a classe Entrez você deve setar o email que será utilizado. Esse controle por email é só para evitar que muitas requisições sejam feitas ao mesmo tempo por uma pessoa. Utilizando o método efetch() você pode escolher de qual banco de dados você quer recuperar a sequência, qual o formato de retorno e o id da sequência e ele te retorna um handle para essa sequência. Com o handle você pode utilizar o SeqIO para fazer o parser dessa sequência."
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 3,
   "metadata": {},
   "outputs": [
    {
     "name": "stdout",
     "output_type": "stream",
     "text": [
      ">NM_015565.2\n",
      "AGTGGGGCAGCAAATGGACAGGGTGGGTGGCGGAAAAGGGCCCGGGGGAAGTTATTACAGGGTGTCCTCT...TTGTACTTCT\n"
     ]
    }
   ],
   "source": [
    "from Bio import Entrez\n",
    "from Bio import SeqIO\n",
    "\n",
    "Entrez.email = \"osvaldor@unicamp.br\"\n",
    "with Entrez.efetch(db=\"nucleotide\", rettype=\"fasta\", retmode=\"text\", id=\"NM_015565.2\") as handle:\n",
    "    record = SeqIO.read(handle, \"fasta\")\n",
    "    print(f\">{record.id}\\n{record.seq[:70]}...{record.seq[-10:]}\")"
   ]
  },
  {
   "cell_type": "markdown",
   "metadata": {},
   "source": [
    "Da mesma forma você também pode fazer o download da sequência no formato do Genbank também."
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 5,
   "metadata": {},
   "outputs": [
    {
     "name": "stdout",
     "output_type": "stream",
     "text": [
      ">NM_015565.2\n",
      "AGTGGGGCAGCAAATGGACAGGGTGGGTGGCGGAAAAGGGCCCGGGGGAAGTTATTACAGGGTGTCCTCT...TTGTACTTCT\n",
      "type: source\n",
      "location: [0:7756](+)\n",
      "qualifiers:\n",
      "    Key: chromosome, Value: ['21']\n",
      "    Key: db_xref, Value: ['taxon:9606']\n",
      "    Key: map, Value: ['21q21.3']\n",
      "    Key: mol_type, Value: ['mRNA']\n",
      "    Key: organism, Value: ['Homo sapiens']\n",
      "\n",
      "type: gene\n",
      "location: [0:7756](+)\n",
      "qualifiers:\n",
      "    Key: db_xref, Value: ['GeneID:26046', 'HGNC:HGNC:13082', 'MIM:613083']\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: note, Value: ['listerin E3 ubiquitin protein ligase 1']\n",
      "\n",
      "type: exon\n",
      "location: [0:193](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: CDS\n",
      "location: [13:5452](+)\n",
      "qualifiers:\n",
      "    Key: EC_number, Value: ['2.3.2.27']\n",
      "    Key: codon_start, Value: ['1']\n",
      "    Key: db_xref, Value: ['CCDS:CCDS33527.2', 'GeneID:26046', 'HGNC:HGNC:13082', 'MIM:613083']\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: note, Value: ['isoform 1 is encoded by transcript variant 1; ring finger protein 160; zinc finger protein 294; E3 ubiquitin-protein ligase listerin; RING-type E3 ubiquitin transferase listerin']\n",
      "    Key: product, Value: ['E3 ubiquitin-protein ligase listerin isoform 1']\n",
      "    Key: protein_id, Value: ['NP_056380.2']\n",
      "    Key: translation, Value: ['MDRVGGGKGPGGSYYRVSSSAARSRKLCPGRVNRGLSAQSTAATATMGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPAIQGAEEIDSLVDSDFRMVLRKLSKKDVTTKLKAMQEFGTMCTERDTETVKGVLPYWPRIFCKISLDHDRRVREATQQAFEKLILKVKKQLAPYLKSLMGYWLMAQCDTYTPAAFAAKDAFEAAFPPSKQPEAIAFCKDEITSVLQDHLIKETPDTLSDPQTVPEEEREAKFYRVVTCSLLALKRLLCLLPDNELDSLEEKFKSLLSQNKFWKYGKHSVPQIRSAYFELVSALCQRIPQLMKEEASKVSPSVLLSIDDSDPIVCPALWEAVLYTLTTIEDCWLHVNAKKSVFPKLSTVIREGGRGLATVIYPYLLPFISKLPQSITNPKLDFFKNFLTSLVAGLSTERTKTSSLESSAVISAFFECLRFIMQQNLGEEEIEQMLVNDQLIPFIDAVLKDPGLQHGQLFNHLAETLSSWEAKADTEKDEKTAHNLENVLIHFWERLSEICVAKISEPEADVESVLGVSNLLQVLQKPKSSLKSSKKKNGKVRFADEILESNKENEKCVSSEGEKIEGWELTTEPSLTHNSSGLLSPLRKKPLEDLVCKLADISINYVNERKSEQHLRFLSTLLDSFSSSRVFKMLLGDEKQSIVQAKPLEIAKLVQKNPAVQFLYQKLIGWLNEDQRKDFGFLVDILYSALRCCDNDMERKKVLDDLTKVDLKWNSLLKIIEKACPSSDKHALVTPWLKGDILGEKLVNLADCLCNEDLESRVSSESHFSERWTLLSLVLSQHVKNDYLIGDVYVERIIVRLHETLFKTKKLSEAESSDSSVSFICDVAYNYFSSAKGCLLMPSSEDLLLTLFQLCAQSKEKTHLPDFLICKLKNTWLSGVNLLVHQTDSSYKESTFLHLSALWLKNQVQASSLDINSLQVLLSAVDDLLNTLLESEDSYLMGVYIGSVMPNDSEWEKMRQSLPMQWLHRPLLEGRLSLNYECFKTDFKEQDIKTLPSHLCTSALLSKMVLIALRKETVLENNELEKIIAELLYSLQWCEELDNPPIFLIGFCEILQKMNITYDNLRVLGNTSGLLQLLFNRSREHGTLWSLIIAKLILSRSISSDEVKPHYKRKESFFPLTEGNLHTIQSLCPFLSKEEKKEFSAQCIPALLGWTKKDLCSTNGGFGHLAIFNSCLQTKSIDDGELLHGILKIIISWKKEHEDIFLFSCNLSEASPEVLGVNIEIIRFLSLFLKYCSSPLAESEWDFIMCSMLAWLETTSENQALYSIPLVQLFACVSCDLACDLSAFFDSTTLDTIGNLPVNLISEWKEFFSQGIHSLLLPILVTVTGENKDVSETSFQNAMLKPMCETLTYISKEQLLSHKLPARLVADQKTNLPEYLQTLLNTLAPLLLFRARPVQIAVYHMLYKLMPELPQYDQDNLKSYGDEEEEPALSPPAALMSLLSIQEDLLENVLGCIPVGQIVTIKPLSEDFCYVLGYLLTWKLILTFFKAASSQLRALYSMYLRKTKSLNKLLYHLFRLMPENPTYAETAVEVPNKDPKTFFTEELQLSIRETTMLPYHIPHLACSVYHMTLKDLPAMVRLWWNSSEKRVFNIVDRFTSKYVSSVLSFQEISSVQTSTQLFNGMTVKARATTREVMATYTIEDIVIELIIQLPSNYPLGSIIVESGKRVGVAVQQWRNWMLQLSTYLTHQNGSIMEGLALWKNNVDKRFEGVEDCMICFSVIHGFNYSLPKKACRTCKKKFHSACLYKWFTSSNKSTCPLCRETFF']\n",
      "\n",
      "type: exon\n",
      "location: [193:397](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [397:496](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [496:727](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [727:780](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [780:961](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [961:1135](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [1135:1326](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [1326:1462](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [1462:2272](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [2272:2314](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [2314:2504](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [2504:2744](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [2744:2898](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [2898:3043](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [3043:3230](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [3230:3390](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [3390:3495](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [3495:3638](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [3638:3774](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [3774:3919](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [3919:4133](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [4133:4371](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [4371:4446](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [4446:4633](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [4633:4805](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [4805:5026](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [5026:5221](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [5221:5389](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n",
      "type: exon\n",
      "location: [5389:7756](+)\n",
      "qualifiers:\n",
      "    Key: gene, Value: ['LTN1']\n",
      "    Key: gene_synonym, Value: ['C21orf10; C21orf98; RNF160; ZNF294']\n",
      "    Key: inference, Value: ['alignment:Splign:2.1.0']\n",
      "\n"
     ]
    }
   ],
   "source": [
    "with Entrez.efetch(db=\"nucleotide\", rettype=\"gb\", retmode=\"text\", id=\"NM_015565.2\") as handle:\n",
    "    record = SeqIO.read(handle, \"gb\")\n",
    "    print(f\">{record.id}\\n{record.seq[:70]}...{record.seq[-10:]}\")\n",
    "    for feature in record.features:\n",
    "        print(feature)"
   ]
  },
  {
   "cell_type": "markdown",
   "metadata": {},
   "source": [
    "Também é possível buscar por uma lista de ids separados por vírgula."
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 6,
   "metadata": {},
   "outputs": [
    {
     "name": "stdout",
     "output_type": "stream",
     "text": [
      "AF191665.1 Opuntia marenae rpl16 gene; chloroplast gene for c...\n",
      "AF191664.1 Opuntia clavata rpl16 gene; chloroplast gene for c...\n",
      "AF191663.1 Opuntia bradtiana rpl16 gene; chloroplast gene for...\n"
     ]
    }
   ],
   "source": [
    "with Entrez.efetch(db=\"nucleotide\", rettype=\"gb\", retmode=\"text\",\n",
    "                   id=\"6273291,6273290,6273289\") as handle:\n",
    "    for record in SeqIO.parse(handle, \"gb\"):\n",
    "        print(f\"{record.id} {record.description[:50]}...\")\n",
    "    "
   ]
  },
  {
   "cell_type": "markdown",
   "metadata": {},
   "source": [
    "### Exercício 6\n",
    "\n",
    "Abra o arquivo 'ls_orchid.fasta' dos exemplos anteriores, selecione apenas as sequências dos ids abaixo e faça o complementar reverso delas. No final salve tudo em um arquivo no formato FASTA. \n",
    "\n",
    "Z78533.1\n",
    "\n",
    "Z78532.1\n",
    "\n",
    "Z78531.1\n",
    "\n",
    "Z78440.1\n",
    "\n",
    "Z78439.1"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": null,
   "metadata": {},
   "outputs": [],
   "source": []
  }
 ],
 "metadata": {
  "kernelspec": {
   "display_name": "Python 3",
   "language": "python",
   "name": "python3"
  },
  "language_info": {
   "codemirror_mode": {
    "name": "ipython",
    "version": 3
   },
   "file_extension": ".py",
   "mimetype": "text/x-python",
   "name": "python",
   "nbconvert_exporter": "python",
   "pygments_lexer": "ipython3",
   "version": "3.7.3"
  }
 },
 "nbformat": 4,
 "nbformat_minor": 2
}